diff --git a/CHANGELOG b/CHANGELOG index d0336bb6c605f6eef99d72f5a79aa195e1731ba1..9c9ba86de73c69b98b8e46e93abced278a4a3f8a 100644 --- a/CHANGELOG +++ b/CHANGELOG @@ -16,4 +16,8 @@ Changes in Release 0.2 * added html documentation to repository * meld renamed to rawmodel +Changes in Release 0.3 (to be released) +------------------------------------------------------------------------------- + * merged argcheck into the helper module + .. LocalWords: Changelog reStructuredText changelog txt diff --git a/CMakeLists.txt b/CMakeLists.txt index f4fefd1dee282246bf0fb20f579e972b3ebada1c..d19495eb2d22c9e43512a15cfe81c6031f7be8fe 100644 --- a/CMakeLists.txt +++ b/CMakeLists.txt @@ -23,7 +23,7 @@ option(DISABLE_DOCUMENTATION "Do not build documentation" OFF) option(DISABLE_DISABLE_DOCTEST "Do not check examples in documentation" OFF) option(DISABLE_DISABLE_LINKCHECK "Do not check links in the documentation" OFF) -if (CMAKE_COMPILER_IS_GNUCXX) +if(CMAKE_COMPILER_IS_GNUCXX) exec_program(gcc ARGS --version OUTPUT_VARIABLE CMAKE_C_COMPILER_VERSION) if(CMAKE_C_COMPILER_VERSION MATCHES ".*4\\.[5-9].*") set(PROMOD_GCC_45 true) @@ -32,7 +32,7 @@ if (CMAKE_COMPILER_IS_GNUCXX) endif() endif() -if (OPTIMIZE) +if(OPTIMIZE) set(CMAKE_BUILD_TYPE Release) set(_OPT ON) else() @@ -67,7 +67,7 @@ find_package(OPENSTRUCTURE 1.4 REQUIRED #The Lapack dependency can be dropped. find_package(LAPACK) -if (CMAKE_COMPILER_IS_GNUCXX) +if(CMAKE_COMPILER_IS_GNUCXX) # do not write back into cache, otherwise the compile command line gets # expanded with multiple -fno-strict-aliasing flags, triggering a complete # rebuild whenever cmake is run @@ -110,6 +110,7 @@ add_subdirectory(scripts) add_subdirectory(actions) add_subdirectory(extras) add_subdirectory(cmake_support) +add_subdirectory(scripts) if(NOT DISABLE_DOCUMENTATION) add_changelog_to_doc(FILE "${CMAKE_CURRENT_SOURCE_DIR}/CHANGELOG") add_subdirectory(doc) diff --git a/README b/README index 02b2c56028d9008ee594fedcb7a560c6eaad930a..225a68587660452c2e5006b3d7e1b4a1dcd70a4e 100644 --- a/README +++ b/README @@ -1,6 +1,6 @@ -=============== ProMod3 -- Homology Modelling Engine =============== +=============== ProMod3 -- Homology Modelling Engine ============== Information on ProMod3 may be found at doc/html/index.html. -=============== The ProMod3 Team =================================== +=============== The ProMod3 Team ================================== diff --git a/actions/CMakeLists.txt b/actions/CMakeLists.txt index 90f98aa6c1a51439f859649a864205f60ce0b5aa..8c8b88f572cdab4f4da7c473137361c81537fbba 100644 --- a/actions/CMakeLists.txt +++ b/actions/CMakeLists.txt @@ -1,4 +1,5 @@ add_custom_target(actions ALL) +add_subdirectory(doc) add_subdirectory(tests) pm_action_init() diff --git a/actions/doc/CMakeLists.txt b/actions/doc/CMakeLists.txt new file mode 100644 index 0000000000000000000000000000000000000000..4dc86eb219c7893e1cd742181bc351cebc855c39 --- /dev/null +++ b/actions/doc/CMakeLists.txt @@ -0,0 +1,5 @@ +set(ACTION_RST +index_dev.rst +) + +add_doc_source(NAME actions RST ${ACTION_RST}) diff --git a/actions/doc/index_dev.rst b/actions/doc/index_dev.rst new file mode 100644 index 0000000000000000000000000000000000000000..8594a9dd4480a51680093fbc15db84995fc9d2ef --- /dev/null +++ b/actions/doc/index_dev.rst @@ -0,0 +1,365 @@ +:mod:`test_actions.ActionTestCase` - Testing Actions +================================================================================ + +.. module:: test_actions + +.. currentmodule:: test_actions + +This module is **not** part of the |project| binary distribution. That is the +productive bit running to produce models. It is only part of the source +distribution intended to help developing |project|. Basically it supports you +creating new actions along immediate tests, which will be stored as unit tests +and stay available to monitor later changes. + +.. note:: + + A couple of different paths will be mentioned in the following. To make + things easier to tell apart, a prefix :file:`<SOURCE>` refers to the code + repository, :file:`<BUILD>` to the build directory tree. + +Inside the development environment, the module is only available to unit tests +in the :file:`<SOURCE>/actions/tests` directory. There is one special thing +about using it in your tests for an action, emerging from the way ``make`` runs +unit tests as set up via |cmake|. |python| modules are imported from the source +directory, here this is :file:`<SOURCE>/actions/tests`, while the tests run +inside :file:`<BUILD>/tests`, here this is :file:`<BUILD>/tests/actions`. When +|python| imports a module, its usually compiled into bytecode. This new file +would clutter up the source repository, it would always show up as untracked +file on ``git status``. To prevent this, tell |python| to stop producing +bytecode right at the beginning of your test-script: + +.. testcode:: nobytecode + :hide: + + import sys + sys.dont_write_bytecode = True + +.. code-block:: python + :emphasize-lines: 5 + :linenos: + + import sys + + # this is needed so there will be no test_actions.pyc created in the source + # directory + sys.dont_write_bytecode = True + +Line 5 does the trick. This needs to be set by you in every action unit test +file since |python| only recognises it **before** the module is imported. +Otherwise a module could disable bytecoding for all other modules loaded. + +Testing actions, basically those are commands run in a shell, is very similar +across various actions. Additionally, there are some things that should be +tested for all actions like exit codes. That is why this module exists. + +When developing an action, you will try it in the shell during the process. You +have to check that its doing what you intend, that it delivers the right +output, that it just behaves right on various kinds of input. This module +supports you by providing functionality to run scripts out of |python|. The +goal is to not trigger test runs manually in a shell but have a script that +does it for you. From there, you do not need to remember all the calls you +punched into the command line a year ago, when you come back to change +something, add new functionality, etc.. + +-------------------------------------------------------------------------------- +Creating an Action Unit Test Script +-------------------------------------------------------------------------------- +In the next couple of paragraphs, we will walk through setting up a new unit +test script for an imaginary action. We will continuously extend the file +started above, so keep an eye on line numbers. Lets just assume your action is +called ``do-awesome`` for the rest of this section. + +The Test Script +-------------------------------------------------------------------------------- +The script to supervise your action needs to be placed in +:file:`<SOURCE>/actions/tests` and follow the naming convention +:file:`test_action_<NAME>.py`, where :file:`<NAME>` is the name for your +action. So here we create a file :file:`test_action_do_awesome.py` (recognise +the underscore between ``do`` and ``awesome`` instead of a hyphen, that's +|pep8|_). + +.. code-block:: console + + $ touch <SOURCE>/actions/tests/test_action_do_awesome.py + $ + +As a starter, we disable bytecode compilation in the script: + +.. testsetup:: actiontest + :hide: + + import sys + sys.dont_write_bytecode = True + +.. code-block:: python + :linenos: + + import sys + + # this is needed so there will be no test_actions.pyc created in the source + # directory + sys.dont_write_bytecode = True + +|cmake| Integration +-------------------------------------------------------------------------------- +As always, when introducing new material to |project|, it has to be announced +to the |cmake| build system. For action unit tests, fire up +:file:`<SOURCE>/actions/tests/CMakeLists.txt` in your favourite text editor and +add your new script: + +.. code-block:: cmake + :emphasize-lines: 3 + :linenos: + + set(ACTION_UNIT_TESTS + test_action_help.py + test_action_do_awesome.py + test_actions.py # leave this as last item so it will be executed first! + ) + + promod3_unittest(MODULE actions SOURCES "${ACTION_UNIT_TESTS}" TARGET actions) + +The important thing is to leave :file:`test_actions.py` as last item in the +list. This script contains the tests around the +:class:`test_actions.ActionTestCase` class, which is the foundation of the +tests for your action. If this class is broken, we are lost. Putting it as the +last element in the list, |cmake| will execute this script first, before any +other action test script is run. + +Creating a Test Subclass +-------------------------------------------------------------------------------- +:class:`test_actions.ActionTestCase` is sort of a template class for your +tests. By spawning off from this you inherit a bunch of useful methods for your +testing. To make it work, the childclass needs to be set up properly. But +first, :file:`test_actions.py` has to be loaded as a module: + +.. testcode:: actiontest + :hide: + + import test_actions + +.. code-block:: python + :linenos: + :lineno-start: 6 + + import test_actions + +Now create the childclass for your action. Go for :class:`<NAME>ActionTests` as +a naming scheme: + +.. testcode:: actiontest + :hide: + + class DoAwesomeActionTests(test_actions.ActionTestCase): + def __init__(self, *args, **kwargs): + test_actions.ActionTestCase.__init__(self, *args, **kwargs) + self.pm_action = 'do-awesome' + +.. code-block:: python + :linenos: + :lineno-start: 7 + + class DoAwesomeActionTests(test_actions.ActionTestCase): + def __init__(self, *args, **kwargs): + test_actions.ActionTestCase.__init__(self, *args, **kwargs) + self.pm_action = 'do-awesome' + +Pay attention that in your own class, you must set :attr:`pm_action` to make +everything work. Also :meth:`__init__` needs certain parameters, as everything +is derived from the :class:`unittest.TestCase` class. + +Must Have Tests +-------------------------------------------------------------------------------- +What needs testing without exclusion are the exit codes of actions. Those +states will be placed in the userlevel documentation. This topic is already +covered in :class:`test_actions.ActionTestCase` by :meth:`RunExitStatusTest`. +As an example, testing for ``$?=0`` could work like this: + +.. testcode:: actiontest + :hide: + + class DoAwesomeActionTests(test_actions.ActionTestCase): + def __init__(self, *args, **kwargs): + test_actions.ActionTestCase.__init__(self, *args, **kwargs) + self.pm_action = 'do-awesome' + + def testExit0(self): + self.RunExitStatusTest(0, list()) + +.. code-block:: python + :linenos: + :lineno-start: 11 + + def testExit0(self): + self.RunExitStatusTest(0, list()) + +That will call the action stored in :attr:`pm_action` with the provided list of +parameters and check that ``0`` is returned on the command line. + +In a more general way, you need to test that your action is working as +intended. Do not forget some negative testing, with the idea in mind what +happens if a user throws dirty input data in. + +Making the Script Executable +-------------------------------------------------------------------------------- +In |project|, unit tests are run via |ost_s|_ and |python|'s +:class:`unittest.TestCase`. Those are called when the test module is executed +as a script: + +.. testcode:: actiontest + :hide: + + import unittest + + class DoAwesomeActionTests(test_actions.ActionTestCase): + def __init__(self, *args, **kwargs): + test_actions.ActionTestCase.__init__(self, *args, **kwargs) + self.pm_bin = os.path.join(os.getcwd(), os.pardir, 'stage', 'bin', + 'pm') + self.pm_action = 'help' + + def testExit0(self): + self.RunExitStatusTest(0, list()) + + if __name__ == "__builtin__": + import os + suite = unittest.TestLoader().loadTestsFromTestCase(DoAwesomeActionTests) + unittest.TextTestRunner().run(suite) + +.. code-block:: python + :linenos: + :lineno-start: 13 + + if __name__ == "__main__": + from ost import testutils + testutils.RunTests() + +These three lines should be the same for all unit tests. + +Running the Test Script +-------------------------------------------------------------------------------- +Unit tests are executed via ``make check`` and so are |project| action tests. +But for every test script, we also provide a private ``make`` target, ending +with :file:`_run`. To solely run the tests for the awesome action, hit + +.. code-block:: console + + $ make test_action_do_awesome.py_run + +Output Of :class:`test_actions.ActionTestCase` +-------------------------------------------------------------------------------- +When running the test script you will notice that its not really talkative. +Basically you do not see output to :file:`stdout`/ :file:`stderr` of your +action, while the test script fires it a couple of times. That is by design. +When running the full unit test suite, usually nobody wants to see the output +of **everything** tested and working. The interesting bits are where we fail. +But for developing a new application you certainly need all the output you can +get. For this, some functions in :class:`test_actions.ActionTestCase` have a +parameter :attr:`verbose`. That triggers specific functions to flush captured +output onto the command line. The idea is to turn it on for development, but +once done, disable it to keep output of unit tests low. + +To get the test for exit code ``0`` talking to you, just do + +.. testcode:: actiontest + :hide: + + import unittest + + class DoAwesomeActionTests(test_actions.ActionTestCase): + def __init__(self, *args, **kwargs): + test_actions.ActionTestCase.__init__(self, *args, **kwargs) + self.pm_bin = os.path.join(os.getcwd(), os.pardir, 'stage', 'bin', + 'pm') + self.pm_action = 'help' + + def testExit0(self): + self.RunExitStatusTest(0, list(), verbose=True) + + if __name__ == "__builtin__": + import os + suite = unittest.TestLoader().loadTestsFromTestCase(DoAwesomeActionTests) + unittest.TextTestRunner().run(suite) + +.. testoutput:: actiontest + :hide: + :options: +NORMALIZE_WHITESPACE +ELLIPSIS + + stdout of '.../doc/../stage/bin/pm help' + ------ + Following actions are available: + build-rawmodel + help + Each action should respond to "--help". + ------ + stderr of '.../doc/../stage/bin/pm help' + ------ + ------ + +.. code-block:: python + :linenos: + :lineno-start: 11 + + def testExit0(self): + self.RunExitStatusTest(0, list(), verbose=True) + +and + +.. testcode:: actiontest + :hide: + + import unittest + + class DoAwesomeActionTests(test_actions.ActionTestCase): + def __init__(self, *args, **kwargs): + test_actions.ActionTestCase.__init__(self, *args, **kwargs) + self.pm_bin = os.path.join(os.getcwd(), os.pardir, 'stage', 'bin', + 'pm') + self.pm_action = 'help' + + def testExit0(self): + self.RunExitStatusTest(0, list()) + + if __name__ == "__builtin__": + import os + suite = unittest.TestLoader().loadTestsFromTestCase(DoAwesomeActionTests) + unittest.TextTestRunner().run(suite) + +.. code-block:: python + :linenos: + :lineno-start: 11 + + def testExit0(self): + self.RunExitStatusTest(0, list()) + +keeps it silent (:attr:`verbose` is set to ``False`` by default). If enabled, +output will be separated into :file:`stdout` and :file:`stderr`: + +.. code-block:: console + + $ make test_action_do_awesome.py_run + <Lots of output from the build process> + [100%] running checks test_action_do_awesome.py + stdout of '<BUILD>/stage/bin/pm do-awesome' + ------ + <Output to stdout> + ------ + stderr of '<BUILD>/stage/bin/pm do-awesome' + ------ + <Output to stderr> + ------ + +-------------------------------------------------------------------------------- +Unit Test Actions API +-------------------------------------------------------------------------------- + +.. autoclass:: test_actions.ActionTestCase + :members: + +.. LocalWords: ActionTestCase currentmodule cmake bytecode emphasize sys py +.. LocalWords: linenos pyc dont promod unittest childclass lineno init args +.. LocalWords: ActionTests DoAwesomeActionTests kwargs attr meth TestCase +.. LocalWords: userlevel RunExitStatusTest testExit ost testutils RunTests +.. LocalWords: stdout stderr testcode nobytecode testsetup actiontest os +.. LocalWords: getcwd pardir builtin testoutput NORMALIZE WHITESPACE API +.. LocalWords: rawmodel autoclass diff --git a/actions/tests/CMakeLists.txt b/actions/tests/CMakeLists.txt index 64930f89fb9d6bdd8db67bca6d1ed3b4b59db7ad..159b8d2830e4311e24ca407af2d20d125c5dcd6f 100644 --- a/actions/tests/CMakeLists.txt +++ b/actions/tests/CMakeLists.txt @@ -3,4 +3,9 @@ set(ACTION_UNIT_TESTS test_actions.py # leave this as last item so it will be executed first! ) -promod3_unittest(MODULE actions SOURCES "${ACTION_UNIT_TESTS}" TARGET actions) \ No newline at end of file +promod3_unittest(MODULE actions SOURCES "${ACTION_UNIT_TESTS}" TARGET actions) + +if(NOT DISABLE_DOCUMENTATION) + add_doc_dependency(NAME actions + DEP "${CMAKE_CURRENT_SOURCE_DIR}/test_actions.py") +endif() \ No newline at end of file diff --git a/actions/tests/test_action_help.py b/actions/tests/test_action_help.py index 56ea0f0594d86fee5cb3f5c4adb3ab2f29a6f9ab..74f24159ca4209d9211f6762a4c9279f9e9ce3cd 100644 --- a/actions/tests/test_action_help.py +++ b/actions/tests/test_action_help.py @@ -6,7 +6,7 @@ actions. """ import sys -# this is needed so there will be not test_actions.pyc created in the source +# this is needed so there will be no test_actions.pyc created in the source # directory sys.dont_write_bytecode = True diff --git a/actions/tests/test_actions.py b/actions/tests/test_actions.py index 9030f24afdf4c17f45504d27137c7722d3b18bab..94eb6a6bd356f33f6cb0f0ad6f133626db697b92 100644 --- a/actions/tests/test_actions.py +++ b/actions/tests/test_actions.py @@ -10,10 +10,33 @@ import ost ost.PushVerbosityLevel(2) class ActionTestCase(unittest.TestCase): + """ + Class to help developing actions. Comes with a lot of convenience wrappers + around what should be tested and serves as a recorder for test calls... + just for in two years when you come back to rewrite the whole action... + + While inheriting this class, :attr:`pm_action` needs to be defined. + Otherwise the whole idea does not work. + + .. attribute:: pm_bin + + This is the path of the ``pm`` binary. Automatically set by calling + :meth:`~ActionTestCase.__init__` inside the initialisation of your class. + + :type: :class:`str` + + .. attribute:: pm_action + + The action to be tested. Needs to be set by your initialisation routine, + **after** calling :meth:`~ActionTestCase.__init__` from here. Skip the + "pm-" in front of the action name. + + :type: :class:`str` + """ def __init__(self, *args, **kwargs): - ''' + """ Convenience stuff for action testing. - ''' + """ # Determining the pm binary to be called. Going hard-coded is a bad # thing. But this is a unit test and we now where we are. Also be # putting it into the 'setUp' function, we only need to change it once, @@ -87,6 +110,11 @@ class ActionTestCase(unittest.TestCase): "but returned as '%d'." % exit_code_run) def testPMExists(self): + """ + This is an internal test, executed when the source code of the test + class is run as unit test. Verifies that :attr:`pm_bin` is an existing + file (also complains if a directory is found instead). + """ self.assertEqual(os.path.isfile(self.pm_bin), True, msg="Could not find 'pm' bin at '%s', " % self.pm_bin+ "cannot proceed unit tests.") @@ -96,3 +124,5 @@ if __name__ == "__main__": from ost import testutils sys.dont_write_bytecode = True testutils.RunTests() + +# LocalWords: attr meth ActionTestCase init str stdout stderr param bool diff --git a/cmake_support/PROMOD3.cmake b/cmake_support/PROMOD3.cmake index ce2b285a78c60711a65ce00d2bf53decb9b9210f..e3456820e8219c6c80114b5648e111beb519dccb 100644 --- a/cmake_support/PROMOD3.cmake +++ b/cmake_support/PROMOD3.cmake @@ -999,13 +999,7 @@ macro(setup_boost) endmacro(setup_boost) #------------------------------------------------------------------------------- -# Synopsis: -# add_doc_dependency(NAME module DEP depending module) -# -# Description: -# Add a dependency for the doc build system. -# NAME - name of the module, these dependencies belong to -# DEP - modules to be added +# Documentation to be found in cmake_support/doc/index.rst #------------------------------------------------------------------------------- macro(add_doc_dependency) parse_argument_list(_ADD_ARG "NAME;DEP" "" ${ARGN}) @@ -1033,13 +1027,7 @@ macro(add_doc_dependency) endmacro(add_doc_dependency) #------------------------------------------------------------------------------- -# Synopsis: -# add_doc_source(NAME module RST rst1 rst2) -# -# Description: -# Add reStructuredText sources for the doc build system. -# NAME - name of the module, the rst files belong to -# RST - file/ cmake list of rst files to be added +# Documentation to be found in cmake_support/doc/index.rst #------------------------------------------------------------------------------- macro(add_doc_source) parse_argument_list(_ARG "NAME;RST" "" ${ARGN}) diff --git a/cmake_support/doc/index.rst b/cmake_support/doc/index.rst index 3ac94db350b4ffc8f3971c6cc4a44303ac9697fd..a104b61a5a6b2a871aa303263af13b93ed47f156 100644 --- a/cmake_support/doc/index.rst +++ b/cmake_support/doc/index.rst @@ -58,7 +58,7 @@ Unit Tests needs to be a single word. Ends up in ``make help`` as a prefix, nothing will break if it does not match the name of any existing module. - ``Sources`` + ``SOURCES`` Describe a set of files hosting unit test code here. If its a wild mix of |C++| and |python| files does not matter, |cmake| will sort this out for you. But the programming language makes a difference for the ``make`` @@ -80,7 +80,59 @@ Unit Tests build directory. ``TARGET`` - This defines an additional dependency for the unit test. + This defines an additional dependency for the unit test. That is, before + running this unit test, this target will be built. + +Documentation +^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ +.. cmake:command:: add_doc_source + + .. code-block:: cmake + + add_doc_source(NAME name + RST rst1 [rst2...]) + + Add reStructuredText sources for the doc build system. This is most preferable + used in :file:`doc` directories for keeping the documentation sorted per + module. This does not create any ``make`` targets. Lists filled here will all + be evaluated in the :file:`doc/CMakeLists.txt` of the repository root. + + The parameters are: + + ``NAME`` + Specify the name of the module this branch of documentation belongs to. + Needs to be set, needs to be a single word. Using module names is best + practice, while nothing will break if it does not refer to an existing one. + You will find a directory in :file:`doc/source` with that name in the build + root. + + ``RST`` + Describe a set of files containing the documentation. Feed it a single file + name or a |cmake| list. + +.. cmake:command:: add_doc_dependency + + .. code-block:: cmake + + add_doc_source(NAME name + DEP dependency1 [dependency2...]) + + Add a dependency to the doc build system. For an existing name, add some + dependencies when it comes to building documentation. Mostly for internal use. + + The parameters are: + + ``NAME`` + Specify a name the dependencies belong to. This name needs to be already + known in the doc build system. Names of |python| modules are good, otherwise + names introduced by :cmake:command:`add_doc_source` work well. Dependencies + will be create for all reStructuredText files listed by + :cmake:command:`add_doc_source` under this name and for all ``make`` + targets related to the documentation. + + ``DEP`` + Hand over a dependency here or a |cmake| list. Files work, if given with + absolute path. Actions ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ @@ -100,8 +152,9 @@ Actions The parameters are: ``ACTION`` - Name of the action to be added. Should start with ``pm-``. Needs to be an - existing file in the same directory as the invoking :file:`CMakeLists.txt`. + Name of the action to be added. Should start with :file:`pm-`. Needs to be + an existing file in the same directory as the invoking + :file:`CMakeLists.txt`. ``TARGET`` Provide a ``make`` target to trigger copying the action's script file. The @@ -114,4 +167,4 @@ Actions .. ----------------- .. LocalWords: cmake PROMOD CMakeLists txt promod unittest codetest xml py -.. LocalWords: libexec +.. LocalWords: libexec reStructuredText RST subtree rst DEP diff --git a/core/doc/CMakeLists.txt b/core/doc/CMakeLists.txt index fbf3f9ec5ccd6aac30b6bcc6fb3f3ae0595d51a9..e9ceb33e80b6765d78a42c8eed13dd70150b211c 100644 --- a/core/doc/CMakeLists.txt +++ b/core/doc/CMakeLists.txt @@ -1,6 +1,6 @@ set(CORE_RST index.rst -argcheck.rst +pm3argparse.rst helper.rst setcompoundschemlib.rst ) diff --git a/core/doc/argcheck.rst b/core/doc/argcheck.rst deleted file mode 100644 index 53f517f1c77a98f14edaf19f8065563c194a8ed4..0000000000000000000000000000000000000000 --- a/core/doc/argcheck.rst +++ /dev/null @@ -1,66 +0,0 @@ -:mod:`~promod3.core.argcheck` - Standard Tests For Command Line Arguments -================================================================================ - -.. currentmodule:: promod3.core.argcheck - -Introduction --------------------------------------------------------------------------------- - -For parsing command line arguments - -:py_docs:`optional <howto/argparse.html#introducing-optional-arguments>` and -:py_docs:`positional <howto/argparse.html#introducing-positional-arguments>` - -|project| tools should utilise Pythons own -:py_docs:`argparse <library/argparse.html>` module. While this comes with a lot -of functionality to fetch values from the command line comfortably, it has no -means in checking/ verifying input. Some of the most common tests are covered -here. All tests are designed to exit a script on failure. - -.. testcode:: argcheck - :hide: - - import os - import argparse - import tempfile - from promod3.core import argcheck - - (fh, fn) = tempfile.mkstemp(suffix='.pdb') - os.close(fh) - - p = argparse.ArgumentParser() - p.add_argument('file', type=str) - opts = p.parse_args([fn]) - - argcheck.FileExists('Test file', 1, opts.file) - - opts.name, opts.ext, opts.gz = argcheck.FileExtension('Test file', 2, - opts.file, - ('pdb', 'mmcif'), - gz=True) - - os.remove(fn) - -.. doctest:: argcheck - - import argparse - from promod3.core import argcheck - - p = argparse.ArgumentParser() - p.add_argument('file', type=str) - opts = p.parse_args() - - argcheck.FileExists('Test file', 1, opts.file) - - opts.name, opts.ext, opts.gz = argcheck.FileExtension('Test file', 2, - opts.file, - ('pdb', 'mmcif'), - gz=True) - - -File Tests --------------------------------------------------------------------------------- - -.. autofunction:: FileExists - -.. autofunction:: FileExtension - -.. LocalWords: currentmodule py howto argparse diff --git a/core/doc/helper.rst b/core/doc/helper.rst index 3d9413f97bc22b455aca6a9bf7f9dd45a22bf19e..93ea65eba08e08234f2080564a8f113ab107dc71 100644 --- a/core/doc/helper.rst +++ b/core/doc/helper.rst @@ -39,3 +39,52 @@ Messages .. autofunction:: MsgErrorAndExit +File Tests +-------------------------------------------------------------------------------- + +.. testcode:: helper + :hide: + + import os + import tempfile + from promod3.core import helper + from promod3.core import pm3argparse + + (fh, fn) = tempfile.mkstemp(suffix='.pdb') + os.close(fh) + + p = pm3argparse.PM3ArgumentParser('Dummy') + p.add_argument('file', type=str) + opts = p.Parse([fn]) + + helper.FileExists('Test file', 1, opts.file) + + opts.name, opts.ext, opts.gz = helper.FileExtension('Test file', 2, + opts.file, + ('pdb', 'mmcif'), + gzip=True) + + os.remove(fn) + +.. doctest:: helper + + from promod3.core import helper + from promod3.core import pm3argparse + + p = pm3argparse.PM3ArgumentParser(__doc__) + p.add_argument('file', type=str) + opts = p.Parse() + + helper.FileExists('Test file', 1, opts.file) + + opts.name, opts.ext, opts.gz = helper.FileExtension('Test file', 2, + opts.file, + ('pdb', 'mmcif'), + gzip=True) + + +.. autofunction:: FileExists + +.. autofunction:: FileExtension + +.. autofunction:: FileGzip diff --git a/core/doc/index.rst b/core/doc/index.rst index 1e2eccafc89bbb443c29d0b55bf9fc0eeec8aaac..904e46a8b44899eccf980857b40fde819be59a33 100644 --- a/core/doc/index.rst +++ b/core/doc/index.rst @@ -9,8 +9,8 @@ modeling per se but cover standard programming issues. .. toctree:: :maxdepth: 2 - - argcheck + + pm3argparse helper diff --git a/core/doc/pm3argparse.rst b/core/doc/pm3argparse.rst new file mode 100644 index 0000000000000000000000000000000000000000..b787f1144335b62a4c102dab7464675678d1242e --- /dev/null +++ b/core/doc/pm3argparse.rst @@ -0,0 +1,37 @@ +:mod:`~promod3.core.pm3argparse` - Parsing Command Lines +================================================================================ + +.. currentmodule:: promod3.core.pm3argparse + +.. module:: promod3.core.pm3argparse + +Introduction +-------------------------------------------------------------------------------- + +A lot of the actions in |project| have a bunch of command line parameters/ +arguments in common. For example we need an input alignment quite often and +usually for an alignment we need information on what is the target sequence, +what identifies a template sequence and eventually a hint on the format. That +means we need the same functionality on the command line in several actions. +There :class:`~promod3.core.pm3argparse.PM3ArgumentParser` serves as a +simplification. It provides a set of standard arguments you just need to +activate for your action plus it comes with some verification functionality for +input. + +.. synopsis/ example + +Argument Parser +-------------------------------------------------------------------------------- + +.. autoclass:: PM3ArgumentParser + :members: + + .. automethod:: __init__ + +.. |descattr| replace:: :attr:`description` +.. |argpinit| replace:: :meth:`argparse.ArgumentParser.__init__` +.. |progattr| replace:: :attr:`prog` +.. |sysargv| replace:: :attr:`sys.argv` + +.. LocalWords: currentmodule argparse ArgumentParser autoclass automethod +.. LocalWords: init descattr attr argpinit meth progattr prog diff --git a/core/pymod/CMakeLists.txt b/core/pymod/CMakeLists.txt index 36acc8aea487dc2fcecd7c081521f26a09c445e9..c2225ec321dfe0d5cfc2c51672c7edd5e6663e4f 100644 --- a/core/pymod/CMakeLists.txt +++ b/core/pymod/CMakeLists.txt @@ -1,4 +1,4 @@ -set(PROMOD3_CORE_FILES __init__.py argcheck.py helper.py) +set(PROMOD3_CORE_FILES __init__.py helper.py pm3argparse.py) # for translation of __init__.py set(_CRE_INIT_SUBST_DICT OST_COMPOUNDS_CHEMLIB_PATH="${OST_COMPOUNDS_CHEMLIB_PATH}" diff --git a/core/pymod/core/argcheck.py b/core/pymod/core/argcheck.py deleted file mode 100644 index 8907d4134bc9c1b17ffec98344c49b1eb2e859d2..0000000000000000000000000000000000000000 --- a/core/pymod/core/argcheck.py +++ /dev/null @@ -1,107 +0,0 @@ -""" -Basic helpers for arguments. -""" - -import os, sys -import ost -import helper - -def FileExists(prefix, exit_status, file): - ''' - Checks if a file exists, terminates if not. The error message displayed is - fixed and only needs a *prefix* describing the specimen of file. - - :param prefix: String to put in front of the failure-message - "file does not exist: ``file``". - :type prefix: :class:`str` - - :param exit_status: Exit code on missing file, ends up in ``$?`` in the - shell. ``0`` is traditionally reserved to successful commands. - :type exit_status: :class:`int` - - :param file: Path including file name to be checked. - :type file: :class:`str` - - :returns: No return value, exits script with value ``exit_status`` if file is - missing. - ''' - if not os.path.exists(file): - helper.MsgErrorAndExit('%s file does not exist: %s\n' % (prefix, file), - exit_status) - -def FileExtension(prefix, exit_status, file, extensions, gz=False): - ''' - Checks a file to carry a known extension given by a list of strings. Since - files are very often compressed these days, an additional "gz" suffix can be - tracked automatically by this function. Thus, the list of *extensions* only - needs to contain what you are really looking for, e.g. ("pdb") instead of - ("pdb", "pdb.gz"). The *gz* flag also determines the output of this function. - If enabled, a triple is returned: name of the file without extension, its - extension and a Boolean to tell whether the file carries the gzip extension - or not. If *gz* detection is turned of, only a tuple is returned: file name - and extension. If the tested file name has an unrecognised extension, this - function terminates the script. - - :param prefix: String to put in front of the failure-message - "file extension not supported: ``file``". - :type prefix: :class:`str` - - :param exit_status: Exit code on missing file, ends up in ``$?`` in the - shell. ``0`` is traditionally reserved to successful commands. - :type exit_status: :class:`int` - - :param file: Path including file name to be checked. - :type file: :class:`str` - - :param extensions: List of strings without a leading ".". - :type extensions: :class:`list` - - :param gz: Indicates whether to check for an additional "gz" extension. - :type gz: :class:`bool` - - :returns: (base name of ``file`` (:class:`str`), extension of file without a - ".gz" (:class:`str`), flag to indicate an additional ".gz" - (:class:`bool`)) **if** ``gz`` is set, (base name of ``file`` - (:class:`str`), extension of file) **if not**. - ''' - filename, fileext = os.path.splitext(file) - is_gz = False - if fileext.lower() == '.gz': - is_gz = True - filename, fileext = os.path.splitext(filename) - if not gz: - extension_string = ', '.join(extensions) - helper.MsgErrorAndExit('%s file extension not supported: %s. ' % (prefix, - file)+ - 'Allowed extensions are: %s\n' % extension_string, - exit_status) - if fileext == '': - extension_string = ', '.join(extensions) - if gz: - extension_string += ', ' + '.gz, '.join(extensions) + '.gz' - helper.MsgErrorAndExit('%s file extension not supported: %s. ' % (prefix, - file)+ - 'Allowed extensions are: %s\n' % extension_string, - exit_status) - fileext = fileext[1:].lower() - for ext in extensions: - if fileext == ext.lower(): - if gz: - return os.path.basename(filename), fileext, is_gz - else: - return os.path.basename(filename), fileext - extension_string = ', '.join(extensions) - if gz: - extension_string += ', ' + '.gz, '.join(extensions) + '.gz' - helper.MsgErrorAndExit('%s file extension not supported: %s. ' % (prefix, - file)+ - 'Allowed extensions are: %s\n' % extension_string, - exit_status) - -__all__ = ( - 'FileExists', - 'FileExtension', -) - -# LocalWords: gz pdb gzip bool os sys FileExists FileExtension filename -# LocalWords: fileext diff --git a/core/pymod/core/helper.py b/core/pymod/core/helper.py index 7f5871d5b6432502d94d48abac8658dc8fbfa873..91e9d6a5783805caca7b10f2ffe94dbdb01ef77f 100644 --- a/core/pymod/core/helper.py +++ b/core/pymod/core/helper.py @@ -2,26 +2,158 @@ Uncategorised functions which may come handy at several places. """ +import os import sys import ost def MsgErrorAndExit(msg, exit_status): - ''' - Send a messages to the |ost_s| :ost_docs:`error log <base/logging/>` and exit - the Python interpreter. + ''' + Send a messages to the |ost_s| :ost_docs:`error log <base/logging/>` and + exit the Python interpreter. - :param msg: The message. - :type msg: :class:`str` + :param msg: The message. + :type msg: :class:`str` - :param exit_status: Exit code, ends up in ``$?`` in the shell. ``0`` is + :param exit_status: Exit code, ends up in ``$?`` in the shell. ``0`` is traditionally reserved to successful commands. - :type exit_status: :class:`int` + :type exit_status: :class:`int` - :returns: No return value, exits script with value ``exit_status``. - ''' - ost.LogError(msg) - sys.exit(exit_status) + :returns: No return value, exits script with value ``exit_status``. + ''' + ost.LogError(msg) + sys.exit(exit_status) + +def FileExists(prefix, exit_status, filename): + ''' + Checks if a file exists, terminates if not. The error message displayed is + fixed and only needs a *prefix* describing the specimen of file. + + :param prefix: String to put in front of the failure-message + "file does not exist: ``file``". + :type prefix: :class:`str` + + :param exit_status: Exit code on missing file, ends up in ``$?`` in the + shell. ``0`` is traditionally reserved to successful commands. + :type exit_status: :class:`int` + + :param file: Path including file name to be checked. + :type file: :class:`str` + + :returns: No return value, exits script with value ``exit_status`` if file + is missing. + ''' + if not os.path.exists(filename): + MsgErrorAndExit('%s file does not exist: %s\n' % (prefix, filename), + exit_status) + +def FileGzip(prefix, exit_status, filename, allowed=True): + ''' + See if a file is gzipped or not. This is basically done by checking for a + "gz" suffix. May also be used to verify that a file is not compressed where + it does not apply. That is where *allowed* comes in. If "gz" is not allowed, + terminates the script on gzip files. + + :param prefix: String to put in front of the failure-message where gzip + files are not allowed. + :type prefix: :class:`str` + + :param exit_status: Exit code on gzip files to be avoided, ends up in + ``$?`` in the shell. ``0`` is traditionally reserved to + successful commands. + :type exit_status: :class:`int` + + :param filename: Path including file name to be checked. + :type filename: :class:`str` + + :param allowed: Set to ``False`` if gzipped files are not allowed. Then the + script will terminate if a gzip file is found. + :type allowed: :class:`bool` + + :returns: Flag to indicate if file is gzipped (:class:`bool`). + ''' + _, fileext = os.path.splitext(filename) + is_gz = False + if fileext.lower() == '.gz': + is_gz = True + if not allowed: + MsgErrorAndExit('%s file in Gzip not supported: %s. ' % (prefix, + filename), + exit_status) + return is_gz + +def FileExtension(prefix, exit_status, filename, extensions, gzip=False): + ''' + Checks a file to carry a known extension given by a list of strings. Since + files are very often compressed these days, an additional "gz" suffix can be + tracked automatically by this function. Thus, the list of *extensions* only + needs to contain what you are really looking for, e.g. ("pdb") instead of + ("pdb", "pdb.gz"). The *gzip* flag also determines the output of this + function. If enabled, a triple is returned: name of the file without + extension, its extension and a Boolean to tell whether the file carries the + gzip extension or not. If *gzip* detection is turned of, only a tuple is + returned: file name and extension. If the tested file name has an + unrecognised extension, this function terminates the script. + + :param prefix: String to put in front of the failure-message + "file extension not supported: ``filename``". + :type prefix: :class:`str` + + :param exit_status: Exit code on missing file, ends up in ``$?`` in the + shell. ``0`` is traditionally reserved to successful commands. + :type exit_status: :class:`int` + + :param filename: Path including file name to be checked. + :type filename: :class:`str` + + :param extensions: List of strings without a leading ".". + :type extensions: :class:`list` + + :param gzip: Indicates whether to check for an additional "gz" extension. + :type gzip: :class:`bool` + + :returns: (base name of ``filename`` (:class:`str`), extension of file + without a ".gz" (:class:`str`), flag to indicate an additional + ".gz" (:class:`bool`)) **if** ``gzip`` is set, (base name of + ``filename`` (:class:`str`), extension of file) **if not**. + ''' + pfilename, fileext = os.path.splitext(filename) + is_gz = False + if fileext.lower() == '.gz': + is_gz = True + pfilename, fileext = os.path.splitext(pfilename) + if not gzip: + extension_string = ', '.join(extensions) + MsgErrorAndExit('%s file extension not supported: %s. ' %(prefix, + filename)+ + 'Allowed extensions are: %s\n' % extension_string, + exit_status) + if fileext == '': + extension_string = ', '.join(extensions) + if gzip: + extension_string += ', ' + '.gz, '.join(extensions) + '.gz' + MsgErrorAndExit('%s file extension not supported: %s. ' %(prefix, + filename)+ + 'Allowed extensions are: %s\n' % extension_string, + exit_status) + fileext = fileext[1:].lower() + for ext in extensions: + if fileext == ext.lower(): + if gzip: + return os.path.basename(pfilename), fileext, is_gz + else: + return os.path.basename(pfilename), fileext + extension_string = ', '.join(extensions) + if gzip: + extension_string += ', ' + '.gz, '.join(extensions) + '.gz' + MsgErrorAndExit('%s file extension not supported: %s. ' % (prefix, + filename)+ + 'Allowed extensions are: %s\n' % extension_string, + exit_status) __all__ = ( - 'MsgErrorAndExit', + 'MsgErrorAndExit', + 'FileExists', + 'FileExtension', ) + +# LocalWords: gzipped gz param str gzip bool diff --git a/core/pymod/core/pm3argparse.py b/core/pymod/core/pm3argparse.py new file mode 100644 index 0000000000000000000000000000000000000000..8233e2893bc566196825b7768beb9f6491912058 --- /dev/null +++ b/core/pymod/core/pm3argparse.py @@ -0,0 +1,298 @@ +""" +Extensions for the argparse module. +""" + +import argparse +import sys +import os +import gzip +import tempfile + +import ost +from ost import io, seq + +from promod3.core import helper + +def _AssembleTrgTplAln(target, template): + """ + Internal function: Assemble a target-template alignment without leading/ + final gaps in the target sequence. Set the offset for the template sequence. + """ + # count leading gaps to get the start position + start = 0 + for i in range(0, target.length): + if target[i] != '-': + start = i + break + # get rid of closing gaps at the end + end = target.length + for i in range(target.length, 1, -1): + if target[i-1] != '-': + end = i + break + # assemble template sequence + tpl_str = '' + for i in range(start, end): + tpl_str += template[i] + new_aln = seq.CreateAlignment(seq.CreateSequence(target.name.strip(), + str(target)[start:end]), + seq.CreateSequence(template.name.strip(), + tpl_str)) + new_aln.SetSequenceOffset(1, start) + return new_aln + +class PM3ArgumentParser(argparse.ArgumentParser): + """ + This class is a child of :class:`argparse.ArgumentParser`. It provides a + set of standard arguments which can be activated, rather than added via the + traditional way. This helps keeping up a common naming scheme throughout + all |project| actions. As a real extension, this subclass provides checking + of input parameters on :meth:`Parse`. Beside + this, everything you can do with a 'real' :class:`~argparse.ArgumentParser` + instance is possible here. + + A note on exit codes: if :meth:`~pm3argparse.PM3ArgumentParser.Parse` is + called on unrecognised arguments, the script exits with a code 2 by + :class:`argparse.ArgumentParser.parse_args()`. + + Attributes beyond :class:`argparse.ArgumentParser`: + + .. attribute:: action + + Indicates if the calling script is a |project| action. + + :type: :class:`bool` + """ + def __init__(self, description, action=True): + """ + Create a new instance of :class:`~pm3argparse.PM3ArgumentParser`. + + :param description: Help text for this script, handed down to + |descattr|_ of |argpinit|_. + :type description: :class:`str` + + :param action: Indicates if the calling script is a |project| action. + This influences |progattr|_ of + :class:`~argparse.ArgumentParser` by clipping of the + first 3 characters of the file name of the script. If + ``False``, default behaviour of + :class:`~argparse.ArgumentParser` kicks in. + :type action: :class:`bool` + + :returns: :class:`argparse.ArgumentParser`. + """ + prog = None + if action: + prog = os.path.basename(sys.argv[0])[3:] + argparse.ArgumentParser.__init__(self, prog=prog, + description=description, + formatter_class=\ + argparse.ArgumentDefaultsHelpFormatter) + self.action = action + self.activate = dict() + + def _print_message(self, message, file=None): + #pylint: disable=redefined-builtin + """ + This is like a welcome message to the "country of bad style"... we are + overwriting a "_" function from the parent-class. Those guys should not + be used outside of the housing module, never... but here it is a single + function to bend :mod:`argparse` to use :class:`ost.Logger`. + """ + if message: + no_nl_msg = message + if message[-1] == '\n': + no_nl_msg = message[:-1] + if file is None or file is sys.stderr: + ost.LogError(no_nl_msg) + else: + ost.LogScript(no_nl_msg) + + def Parse(self, args=None): + """ + Parse an argument string. + + :param args: The argument string. As default |sysargv|_ is used. + :type args: :class:`list` + + :returns: :class:`promod3.cor.pm3argparse.PM3OptionsNamespace`. + """ + opts = PM3OptionsNamespace() + self.parse_args(args=args, namespace=opts) + + opts.PostProcess(self.activate.keys()) + return opts + + def AssembleParser(self): + """ + When adding options via the :meth:`Add*` methods, call this after you + are done. Everything before just tells the parser that it should + contain those option sets but does not actually add anything. + :meth:`AssembleParser` will put everything in place, in the right order + and with the right constraints. + """ + if 'ALIGNMENT' in self.activate.keys(): + self._AssembleAlignment() + + def AddAlignment(self): + """ + Add everything needed to load alignments to the argument parser. Creates + several options/ arguments and adds some checks for post processing. + This method only adds a flag to the parser to add alignment options on + :meth:`AssembleParser`. Depending on which options you activate, things + need to be added in a different order or have other constraints. + + Options/ arguments added: + + * ``--fasta trg:<NAME> <FILE>`` - describing a target-template alignment + with ``trg:`` marking the target sequence inside :file:`<FILE>` + + Exit codes related to alignment input: + + * 11 - no prefix ``trg:`` found for an argument to '--fasta' + + * 12 - a given alignment file does not exist + + * 13 - never raised (parameter for checking gzip files) + + * 14 - empty target name found (``trg:``) + + * 15 - found an empty alignment file + + * 16 - alignment with more than 2 sequences found + + * 17 - target sequence name not found in alignment + + * 18 - sequences in the alignment have different length + + Attributes added to the namespace returned by + :meth:`Parse`: + + * :attr:`fasta` - filled with the input of the '--fasta' argument, a + :class:`list` with multiple :class:`list` objects + + * :attr:`alignments` - :class:`ost.AlignmentList`, same order as + :attr:`fasta` + + * :attr:`aln_sources` - the original source of the alignment, may be + filename(s) or a string in JSON format, + :class:`list` of all sources + """ + self.activate['ALIGNMENT'] = 1 + + def _AssembleAlignment(self): + """ + Actually add alignment arguments/ options + """ + # FastA input: - always pairwise alignments + # - callable multiple times + # - goes by 'trg:<SEQNAME> <FILE>' + # - excludes JSON file/ object + # - leading whitespaces will be deleted + self.add_argument('-f', '--fasta', nargs=2, action='append', + metavar=('trg:<NAME>', '<FILE>'), + help='Pairwise alignment in FastA format, needs to '+ + 'declare what is the target sequence.') + # input: FastA/ JSON + # determined by extension: if we are wrong, the whole loading fails + # possibility to add JSON: mention limitation! + +class PM3OptionsNamespace(object): + """ + This one is mainly for internal use. You can use it like everything that + comes out of :meth:`argparse.ArgumentParser.parse_args`. Attributes are + added regarding how you assembled your argument parser. + """ + def __init__(self): + pass + + def PostProcess(self, activated): + """ + Post processing of activated option packs. + """ + if 'ALIGNMENT' in activated: + self._PostProcessAlignment() + + def _PostProcessAlignment(self): + #pylint: disable=no-member + #pylint: disable=attribute-defined-outside-init + """ + Doing some extra work after parsing. + """ + self.aln_sources = list() + self.alignments = seq.AlignmentList() + if self.fasta: + for src in self.fasta: + if src[0].startswith('trg:'): + trgname = src[0][4:] + seqfile = src[1] + elif src[1].startswith('trg:'): + trgname = src[1][4:] + seqfile = src[0] + else: + helper.MsgErrorAndExit("'--fasta' requires one argument "+ + "prefixed with 'trg:' marking the "+ + "target sequence name", 11) + if not len(trgname): + helper.MsgErrorAndExit("'--fasta' requires argument "+ + "'trg:' defining the "+ + "target sequence name, empty one "+ + "found: '%s'" % ' '.join(src), 14) + helper.FileExists("Alignment", 12, seqfile) + is_gz = helper.FileGzip("Alignment", 13, seqfile) + readfile = seqfile + if is_gz: + zip_fh = gzip.open(seqfile) + unzip_str = zip_fh.read() + zip_fh.close() + unzip_file = tempfile.NamedTemporaryFile(mode='w', + suffix='.fas') + unzip_file.write(unzip_str) + unzip_file.flush() + readfile = unzip_file.name + try: + aln = io.LoadAlignment(readfile, format="fasta") + except Exception, exc: #pylint: disable=broad-except + if exc.message == 'Bad FASTA file: File is empty': + helper.MsgErrorAndExit("'--fasta' refers to an empty "+\ + "file or its in the wrong "+ + "format: %s" % seqfile, 15) + elif exc.message == 'sequences have different lengths': + helper.MsgErrorAndExit("'--fasta %s': " % ' '.join(src)+ + "sequences in the alignment "+ + "have different length.", 18) + else: + raise + finally: + if is_gz: + unzip_file.close() + # check alignment + nos = aln.GetCount() + if nos > 2: + helper.MsgErrorAndExit("'--fasta %s' " % ' '.join(src)+ + "points to an alignment with "+ + "more than 2 sequences.", 16) + fst_seq = aln.GetSequence(0) + snd_seq = aln.GetSequence(1) + if fst_seq.name.strip() == trgname: + new_aln = _AssembleTrgTplAln(fst_seq, snd_seq) + elif snd_seq.name.strip() == trgname: + new_aln = _AssembleTrgTplAln(snd_seq, fst_seq) + else: + helper.MsgErrorAndExit("'--fasta %s' " % ' '.join(src)+ + "does not define a target name "+ + "found in the alignment.", 17) + + self.alignments.append(new_aln) + self.aln_sources.append(seqfile) + +# LocalWords: param attr prog argparse ArgumentParser bool sys os init str +# LocalWords: progattr descattr argpinit argv formatter meth args namespace +# LocalWords: ArgumentDefaultsHelpFormatter sysargv AssembleParser fasta io +# LocalWords: metavar trg tpl FastA gzip tempfile ost promod aln stderr src +# LocalWords: AssembleTrgTplAln CreateSequence SetSequenceOffset LogError +# LocalWords: LogScript OptionsNamespace PostProcess AssembleAlignment JSON +# LocalWords: AddAlignment AlignmentList SEQNAME whitespaces nargs trgname +# LocalWords: PostProcessAlignment startswith seqfile elif MsgErrorAndExit +# LocalWords: len FileExists gz FileGzip readfile fh NamedTemporaryFile fas +# LocalWords: LoadAlignment exc GetCount fst GetSequence snd diff --git a/core/tests/CMakeLists.txt b/core/tests/CMakeLists.txt index 51736e2fbf75cba2ffd657b3a9a9e25439261fe3..f18de9d1b8be508993ab6d0e31a75f1372803f1c 100644 --- a/core/tests/CMakeLists.txt +++ b/core/tests/CMakeLists.txt @@ -1,11 +1,18 @@ set(CORE_UNIT_TESTS test_setcompoundschemlib.py - test_argcheck.py + test_helper.py + test_pm3argparse.py ) set(CORE_TEST_DATA - test_argcheck.py + test_helper.py data/broken_on_purpose.chemlib + data/fasta/alignment.fas + data/fasta/1ake.fas + data/fasta/1ake_3.fas + data/fasta/1ake.fas.gz + data/fasta/1ake_nel.fas + data/fasta/1ake_sw.fas ) promod3_unittest(MODULE core diff --git a/core/tests/data/fasta/1ake.fas b/core/tests/data/fasta/1ake.fas new file mode 100644 index 0000000000000000000000000000000000000000..6e08a6c407f9c016660376c29376b7ade696d12f --- /dev/null +++ b/core/tests/data/fasta/1ake.fas @@ -0,0 +1,8 @@ +> 1AKE.B +MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNG +FLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQ +EETVRKRLVEYHQMTAPLIGYYYYSKEAEAGNTKYAKVDGTKPV---AEVRADLEKILG +> target +-------APGAGKGTQAQFIMEKYGIPQISTGGGLRAAVKS---LGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNG +FLLDGFPRTIPQADAMKEAGINVDYVLEF----ELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQ +EETVRKRLVEYHQMTAPLL--YYYYKEAEAGNTKYAKVDGTKPVAEVRADLEKILG--- diff --git a/core/tests/data/fasta/1ake.fas.gz b/core/tests/data/fasta/1ake.fas.gz new file mode 100644 index 0000000000000000000000000000000000000000..bb5e75d520a68a70bc4d67b94bf43b8fae4174f0 Binary files /dev/null and b/core/tests/data/fasta/1ake.fas.gz differ diff --git a/core/tests/data/fasta/1ake_3.fas b/core/tests/data/fasta/1ake_3.fas new file mode 100644 index 0000000000000000000000000000000000000000..859543a424b046da616aa6ccc1058a3d727be991 --- /dev/null +++ b/core/tests/data/fasta/1ake_3.fas @@ -0,0 +1,12 @@ +> 1AKE.B +MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNG +FLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQ +EETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPV---AEVRADLEKILG +> 1AKE.B +MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNG +FLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQ +EETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPV---AEVRADLEKILG +> target +-------APGAGKGTQAQFIMEKYGIPQISTGGGLRAAVKS---LGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNG +FLLDGFPRTIPQADAMKEAGINVDYVLEF----ELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQ +EETVRKRLVEYHQMTAPLLYYYYKEAEAGNTKYAKVDGTKPVAEVRADLEKILG--- diff --git a/core/tests/data/fasta/1ake_nel.fas b/core/tests/data/fasta/1ake_nel.fas new file mode 100644 index 0000000000000000000000000000000000000000..a1ac37bf67d6fefa82b86468529e666e3696c85c --- /dev/null +++ b/core/tests/data/fasta/1ake_nel.fas @@ -0,0 +1,8 @@ +> 1AKE.B +MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNG +FLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQ +EETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG +> target +-------APGAGKGTQAQFIMEKYGIPQISTGGGLRAAVKS---LGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNG +FLLDGFPRTIPQADAMKEAGINVDYVLEF----ELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQ +EETVRKRLVEYHQMTAPLLYYYYKEAEAGNTKYAKVDGTKPVAEVRADLEKILG--- diff --git a/core/tests/data/fasta/1ake_sw.fas b/core/tests/data/fasta/1ake_sw.fas new file mode 100644 index 0000000000000000000000000000000000000000..ed5f3c08cfb15e7aab8f004ac1991b628c0d188b --- /dev/null +++ b/core/tests/data/fasta/1ake_sw.fas @@ -0,0 +1,9 @@ +> target +-------APGAGKGTQAQFIMEKYGIPQISTGGGLRAAVKS---LGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNG +FLLDGFPRTIPQADAMKEAGINVDYVLEF----ELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQ +EETVRKRLVEYHQMTAPLL--YYYYKEAEAGNTKYAKVDGTKPVAEVRADLEKILG--- +> 1AKE.B +MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNG +FLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQ +EETVRKRLVEYHQMTAPLIGYYYYSKEAEAGNTKYAKVDGTKPV---AEVRADLEKILG + diff --git a/core/tests/data/fasta/alignment.fas b/core/tests/data/fasta/alignment.fas new file mode 100644 index 0000000000000000000000000000000000000000..e69de29bb2d1d6434b8b29ae775ad8c2e48c5391 diff --git a/core/tests/test_argcheck.py b/core/tests/test_argcheck.py deleted file mode 100644 index df4e5757fa901a30da0588a93a9a29d99433e4ae..0000000000000000000000000000000000000000 --- a/core/tests/test_argcheck.py +++ /dev/null @@ -1,99 +0,0 @@ -import unittest, sys -import ost -from promod3.core import argcheck - -# setting up an OST LogSink to capture error messages -class _FetchLog(ost.LogSink): - def __init__(self): - ost.LogSink.__init__(self) - self.messages = dict() - - def LogMessage(self, message, severity): - levels=['ERROR', 'WARNING', 'INFO', 'VERBOSE', 'DEBUG', 'TRACE'] - level=levels[severity] - if not level in self.messages.keys(): - self.messages[level] = list() - self.messages[level].append(message.strip()) - -class ArgcheckTests(unittest.TestCase): - def testFileExistsTrue(self): - # test that checking for existing files works like a charm - argcheck.FileExists('Argcheck test', 1, 'test_argcheck.py') - self.assertTrue(True) - - def testFileExistsFalse(self): - # test that missing file leads to abortion - log = _FetchLog() - ost.PushLogSink(log) - with self.assertRaises(SystemExit) as ec: - argcheck.FileExists('Argcheck test', 28, '') - self.assertEqual(ec.exception.code, 28) - self.assertEqual(log.messages['ERROR'][0], - 'Argcheck test file does not exist:') - - def testFileExtensionTrueNgz(self): - # most basic test: extension supported, no gz mode - # this also checks, that the 'gz' param is 'False' by default by not - # providing it - name, ext = argcheck.FileExtension('Argcheck test', 1, - 'test_argcheck.py', ['py']) - self.assertEqual('test_argcheck', name) - self.assertEqual('py', ext) - - def testFileExtensionTrueIgz(self): - # extension supported, in gz mode but without gz extension - name, ext, is_gz = argcheck.FileExtension('Argcheck test', 1, - 'test_argcheck.py', ['py'], - gz=True) - self.assertEqual('test_argcheck', name) - self.assertEqual('py', ext) - self.assertFalse(is_gz) - - def testFileExtensionTrueIgz(self): - # extension supported, in gz mode - name, ext, is_gz = argcheck.FileExtension('Argcheck test', 1, - 'data/filewgzext.pdb.gz', ['pdb'], - gz=True) - self.assertEqual('filewgzext', name) - self.assertEqual('pdb', ext) - self.assertTrue(is_gz) - - def testFileExtensionFalseNoExt(self): - # make sure we fail on missing extension - log = _FetchLog() - ost.PushLogSink(log) - with self.assertRaises(SystemExit) as ec: - name, ext = argcheck.FileExtension('Argcheck test', 27, - 'noextension', ['py']) - self.assertEqual(ec.exception.code, 27) - self.assertEqual(log.messages['ERROR'][0], - 'Argcheck test file extension not supported: noextension. ' - +'Allowed extensions are: py') - - def testFileExtensionFalseGZ(self): - # make sure we fail outside gz mode if a gz extension is provided - log = _FetchLog() - ost.PushLogSink(log) - with self.assertRaises(SystemExit) as ec: - name, ext = argcheck.FileExtension('Argcheck test', 26, - 'wrongname.gz', ['py']) - self.assertEqual(ec.exception.code, 26) - self.assertEqual(log.messages['ERROR'][0], - 'Argcheck test file extension not supported: wrongname.gz.' - +' Allowed extensions are: py') - - def testFileExtensionFalse(self): - # check file name with unknown extension - log = _FetchLog() - ost.PushLogSink(log) - with self.assertRaises(SystemExit) as ec: - name, ext = argcheck.FileExtension('Argcheck test', 25, - 'unknown.ext', ['py']) - self.assertEqual(ec.exception.code, 25) - self.assertEqual(log.messages['ERROR'][0], - 'Argcheck test file extension not supported: unknown.ext. ' - +'Allowed extensions are: py') - -if __name__ == "__main__": - from ost import testutils - testutils.RunTests() diff --git a/core/tests/test_helper.py b/core/tests/test_helper.py new file mode 100644 index 0000000000000000000000000000000000000000..bf570fb3897c625e216cef411bec73354be25339 --- /dev/null +++ b/core/tests/test_helper.py @@ -0,0 +1,129 @@ +import unittest +import ost +from promod3.core import helper + +# setting up an OST LogSink to capture error messages +class _FetchLog(ost.LogSink): + def __init__(self): + ost.LogSink.__init__(self) + self.messages = dict() + + def LogMessage(self, message, severity): + levels = ['ERROR', 'WARNING', 'INFO', 'VERBOSE', 'DEBUG', 'TRACE'] + level = levels[severity] + if not level in self.messages.keys(): + self.messages[level] = list() + self.messages[level].append(message.strip()) + +class HelperTests(unittest.TestCase): + def testFileExistsTrue(self): + # test that checking for existing files works like a charm + helper.FileExists('Helper test', 1, 'test_helper.py') + self.assertTrue(True) + + def testFileExistsFalse(self): + # test that missing file leads to abortion + log = _FetchLog() + ost.PushLogSink(log) + with self.assertRaises(SystemExit) as ecd: + helper.FileExists('Helper test', 28, '') + self.assertEqual(ecd.exception.code, 28) + self.assertEqual(log.messages['ERROR'][0], + 'Helper test file does not exist:') + + def testFileExtensionTrueNgz(self): + # most basic test: extension supported, no gzip mode + # this also checks, that the 'gzip' param is 'False' by default by not + # providing it + name, ext = helper.FileExtension('Helper test', 1, + 'test_helper.py', ['py']) + self.assertEqual('test_helper', name) + self.assertEqual('py', ext) + + def testFileExtensionTrueIgz(self): + # extension supported, in gzip mode but without gzip extension + name, ext, is_gz = helper.FileExtension('Helper test', 1, + 'test_helper.py', ['py'], + gzip=True) + self.assertEqual('test_helper', name) + self.assertEqual('py', ext) + self.assertFalse(is_gz) + + def testFileExtensionTrueIIgz(self): + # extension supported, in gz mode + name, ext, is_gz = helper.FileExtension('Helper test', 1, + 'data/filewgzext.pdb.gz', + ['pdb'], gzip=True) + self.assertEqual('filewgzext', name) + self.assertEqual('pdb', ext) + self.assertTrue(is_gz) + + def testFileExtensionFalseNoExt(self): + # make sure we fail on missing extension + log = _FetchLog() + ost.PushLogSink(log) + with self.assertRaises(SystemExit) as ecd: + _, _ = helper.FileExtension('Helper test', 27, 'noextension', + ['py']) + self.assertEqual(ecd.exception.code, 27) + self.assertEqual(log.messages['ERROR'][0], + 'Helper test file extension not supported: '+ + 'noextension. Allowed extensions are: py') + + def testFileExtensionFalseGZ(self): + # make sure we fail outside gz mode if a gz extension is provided + log = _FetchLog() + ost.PushLogSink(log) + with self.assertRaises(SystemExit) as ecd: + _, _ = helper.FileExtension('Helper test', 26, + 'wrongname.gz', ['py']) + self.assertEqual(ecd.exception.code, 26) + self.assertEqual(log.messages['ERROR'][0], + 'Helper test file extension not supported: '+ + 'wrongname.gz. Allowed extensions are: py') + + def testFileExtensionFalse(self): + # check file name with unknown extension + log = _FetchLog() + ost.PushLogSink(log) + with self.assertRaises(SystemExit) as ecd: + _, _ = helper.FileExtension('Helper test', 25, 'unknown.ext', + ['py']) + self.assertEqual(ecd.exception.code, 25) + self.assertEqual(log.messages['ERROR'][0], + 'Helper test file extension not supported: '+ + 'unknown.ext. Allowed extensions are: py') + + def testMsgErrorAndExit(self): + # check that we print a message and exit + log = _FetchLog() + ost.PushLogSink(log) + with self.assertRaises(SystemExit) as ecd: + helper.MsgErrorAndExit("FooBar", 42) + self.assertEqual(ecd.exception.code, 42) + self.assertEqual(log.messages['ERROR'][0], "FooBar") + + def testFileGzipFound(self): + # check that we recognise gz extensions + gzip = helper.FileGzip("GzipFound", 42, "gzipped_file.txt.gz") + self.assertEqual(gzip, True) + + def testFileGzipNotFound(self): + # check that we recognise non-gz extensions + gzip = helper.FileGzip("GzipNotFound", 42, "gzipped_file.txt") + self.assertEqual(gzip, False) + + def testFileGzipNotAllowed(self): + # refuse Gzip + log = _FetchLog() + ost.PushLogSink(log) + with self.assertRaises(SystemExit) as ecd: + helper.FileGzip("GzipFound", 42, "gzipped_file.txt.gz", + allowed=False) + self.assertEqual(ecd.exception.code, 42) + self.assertEqual(log.messages['ERROR'][0], "GzipFound file in Gzip "+ + "not supported: gzipped_file.txt.gz.") + +if __name__ == "__main__": + from ost import testutils + testutils.RunTests() diff --git a/core/tests/test_pm3argparse.py b/core/tests/test_pm3argparse.py new file mode 100644 index 0000000000000000000000000000000000000000..cc2f4aed3cc328725c723ad572741c78e5d3aaa9 --- /dev/null +++ b/core/tests/test_pm3argparse.py @@ -0,0 +1,251 @@ +""" +Testing our own little argument parser. +""" + +import unittest +import ost +from promod3.core import pm3argparse + + +class _FetchLog(ost.LogSink): + """ + Capturing output of the OST logger + """ + def __init__(self): + ost.LogSink.__init__(self) + self.messages = dict() + + def LogMessage(self, message, severity): + levels = ['ERROR', 'WARNING', 'SCRIPT', 'INFO', 'VERBOSE', 'DEBUG', + 'TRACE'] + level = levels[severity] + if not level in self.messages.keys(): + self.messages[level] = list() + self.messages[level].append(message.strip()) + +class PM3ArgParseTests(unittest.TestCase): + def setUp(self): + self.log = _FetchLog() + ost.PushLogSink(self.log) + ost.PushVerbosityLevel(2) + + def tearDown(self): + ost.PopVerbosityLevel() + ost.PopLogSink() + + def testUnrecognisedArguments(self): + parser = pm3argparse.PM3ArgumentParser(__doc__, action=False) + with self.assertRaises(SystemExit) as ecd: + parser.Parse(['-x']) + self.assertEqual(ecd.exception.code, 2) + self.assertEqual(self.log.messages['ERROR'], + ['usage: test_pm3argparse.py [-h]', + 'test_pm3argparse.py: error: unrecognized '+ + 'arguments: -x']) + + def testActionSwitch(self): + parser = pm3argparse.PM3ArgumentParser(__doc__, action=False) + with self.assertRaises(SystemExit) as ecd: + parser.Parse(['--help']) + self.assertEqual(ecd.exception.code, 0) + self.assertEqual(self.log.messages['SCRIPT'], + ['usage: test_pm3argparse.py [-h]\n\nTesting our '+ + 'own little argument parser.\n\noptional '+ + 'arguments:\n -h, --help show this help message '+ + 'and exit']) + + self.log.messages = dict() + parser = pm3argparse.PM3ArgumentParser(__doc__, action=True) + with self.assertRaises(SystemExit) as ecd: + parser.Parse(['--help']) + self.assertEqual(ecd.exception.code, 0) + self.assertEqual(self.log.messages['SCRIPT'], + ['usage: t_pm3argparse.py [-h]\n\nTesting our own '+ + 'little argument parser.\n\noptional '+ + 'arguments:\n -h, --help show this help message '+ + 'and exit']) + + + def testDescription(self): + parser = pm3argparse.PM3ArgumentParser(action=False, + description='This is a test.') + with self.assertRaises(SystemExit) as ecd: + parser.Parse(['--help']) + self.assertEqual(ecd.exception.code, 0) + self.assertEqual(self.log.messages['SCRIPT'], + ['usage: test_pm3argparse.py [-h]\n\nThis is a '+ + 'test.\n\noptional arguments:\n -h, --help show '+ + 'this help message and exit']) + + def testAddAlignemntNoTrgPfx(self): + # checking that we fail on missing 'trg:' prefix for arguments of + # --fasta + parser = pm3argparse.PM3ArgumentParser(__doc__, action=False) + parser.AddAlignment() + parser.AssembleParser() + with self.assertRaises(SystemExit) as ecd: + parser.Parse(['--fasta', 'foo', 'bar']) + self.assertEqual(ecd.exception.code, 11) + self.assertEqual(self.log.messages['ERROR'][0], + "'--fasta' requires one "+ + "argument prefixed with 'trg:' marking the target "+ + "sequence name") + + def testAddAlignemntEmptyTrgPfx(self): + # checking that we fail on empty 'trg:' prefix for arguments of + # --fasta + parser = pm3argparse.PM3ArgumentParser(__doc__, action=False) + parser.AddAlignment() + parser.AssembleParser() + with self.assertRaises(SystemExit) as ecd: + parser.Parse(['--fasta', 'trg:', 'bar']) + self.assertEqual(ecd.exception.code, 14) + self.assertEqual(self.log.messages['ERROR'][0], "'--fasta' requires "+ + "argument 'trg:' defining the target sequence name, "+ + "empty one found: 'trg: bar'") + + def testAddAlignemntSwapTrgPfx(self): + # checking that we fail on empty 'trg:' prefix for arguments of + # --fasta + parser = pm3argparse.PM3ArgumentParser(__doc__, action=False) + parser.AddAlignment() + parser.AssembleParser() + with self.assertRaises(SystemExit) as ecd: + parser.Parse(['--fasta', 'bar', 'trg:']) + self.assertEqual(ecd.exception.code, 14) + self.assertEqual(self.log.messages['ERROR'][0], "'--fasta' requires "+ + "argument 'trg:' defining the target sequence name, "+ + "empty one found: 'bar trg:'") + + def testAddAlignmentNoFile(self): + # check that we throw an error if a non-exisiting file is given + parser = pm3argparse.PM3ArgumentParser(__doc__, action=False) + parser.AddAlignment() + parser.AssembleParser() + with self.assertRaises(SystemExit) as ecd: + parser.Parse(['--fasta', 'trg:foo', 'notexistingfile.fas']) + self.assertEqual(ecd.exception.code, 12) + self.assertEqual(self.log.messages['ERROR'][0], + "Alignment file does not exist: notexistingfile.fas") + + def testAddAlignmentEmpty(self): + # we want to fail if we get an empty FastA file + parser = pm3argparse.PM3ArgumentParser(__doc__, action=False) + parser.AddAlignment() + parser.AssembleParser() + with self.assertRaises(SystemExit) as ecd: + parser.Parse(['--fasta', 'trg:foo', 'data/fasta/alignment.fas']) + self.assertEqual(ecd.exception.code, 15) + self.assertEqual(self.log.messages['ERROR'][0], + "'--fasta' refers to an empty file or its in the "+ + "wrong format: data/fasta/alignment.fas") + + def testAddAlignmentToMany(self): + parser = pm3argparse.PM3ArgumentParser(__doc__, action=False) + parser.AddAlignment() + parser.AssembleParser() + with self.assertRaises(SystemExit) as ecd: + parser.Parse(['--fasta', 'trg:target', 'data/fasta/1ake_3.fas']) + self.assertEqual(ecd.exception.code, 16) + self.assertEqual(self.log.messages['ERROR'][0], "'--fasta trg:target "+ + "data/fasta/1ake_3.fas' points to an alignment with "+ + "more than 2 sequences.") + + def testAddAlignmentMissingTargetName(self): + parser = pm3argparse.PM3ArgumentParser(__doc__, action=False) + parser.AddAlignment() + parser.AssembleParser() + with self.assertRaises(SystemExit) as ecd: + parser.Parse(['--fasta', 'trg:trg', 'data/fasta/1ake.fas']) + self.assertEqual(ecd.exception.code, 17) + self.assertEqual(self.log.messages['ERROR'][0], "'--fasta trg:trg "+ + "data/fasta/1ake.fas' does not define a target name "+ + "found in the alignment.") + + def testAddAlignmentDifferentSeqLens(self): + parser = pm3argparse.PM3ArgumentParser(__doc__, action=False) + parser.AddAlignment() + parser.AssembleParser() + with self.assertRaises(SystemExit) as ecd: + parser.Parse(['--fasta', 'trg:target', 'data/fasta/1ake_nel.fas']) + self.assertEqual(ecd.exception.code, 18) + self.assertEqual(self.log.messages['ERROR'][0], "'--fasta trg:target "+ + "data/fasta/1ake_nel.fas': sequences in the "+ + "alignment have different length.") + + def testAddAlignmentGzipIn(self): + parser = pm3argparse.PM3ArgumentParser(__doc__, action=False) + parser.AddAlignment() + parser.AssembleParser() + opts = parser.Parse(['--fasta', 'trg:target', + 'data/fasta/1ake.fas.gz', '--fasta', 'trg:target', + 'data/fasta/1ake.fas']) + self.assertEqual(str(opts.alignments[0]), 'target APGAGKGTQAQFIMEKYG'+ + 'IPQISTGGGLRAAVKS---LGKQAKDIMDAGKLVTDELVIALVKERIAQED'+ + 'CRN\n1AKE.B APGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSEL'+ + 'GKQAKDIMDAGKLVTDELVIALVKERIAQEDCRN\n\ntarget GFLLD'+ + 'GFPRTIPQADAMKEAGINVDYVLEF----ELIVDRIVGRRVHAPSGRVYHV'+ + 'KFNPPKVEGKDDVTGE\n1AKE.B GFLLDGFPRTIPQADAMKEAGINVD'+ + 'YVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGE\n\n'+ + 'target ELTTRKDDQEETVRKRLVEYHQMTAPLLYYYYKEAEAGNTKYA'+ + 'KVDGTKPVAEVRADLEKILG\n1AKE.B ELTTRKDDQEETVRKRLVEYH'+ + 'QMTAPLIGYYSKEAEAGNTKYAKVDGTKPV---AEVRADLEK\n') + self.assertEqual(opts.alignments[0].GetSequence(1).offset, 7) + self.assertEqual(str(opts.alignments[1]), 'target APGAGKGTQAQFIMEKYG'+ + 'IPQISTGGGLRAAVKS---LGKQAKDIMDAGKLVTDELVIALVKERIAQED'+ + 'CRN\n1AKE.B APGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSEL'+ + 'GKQAKDIMDAGKLVTDELVIALVKERIAQEDCRN\n\ntarget GFLLD'+ + 'GFPRTIPQADAMKEAGINVDYVLEF----ELIVDRIVGRRVHAPSGRVYHV'+ + 'KFNPPKVEGKDDVTGE\n1AKE.B GFLLDGFPRTIPQADAMKEAGINVD'+ + 'YVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGE\n\n'+ + 'target ELTTRKDDQEETVRKRLVEYHQMTAPLL--YYYYKEAEAGNTK'+ + 'YAKVDGTKPVAEVRADLEKILG\n1AKE.B ELTTRKDDQEETVRKRLVE'+ + 'YHQMTAPLIGYYYYSKEAEAGNTKYAKVDGTKPV---AEVRADLEK\n') + + def testAddAlignmentSwitchSeqs(self): + parser = pm3argparse.PM3ArgumentParser(__doc__, action=False) + parser.AddAlignment() + parser.AssembleParser() + opts = parser.Parse(['--fasta', 'trg:target', + 'data/fasta/1ake.fas']) + self.assertEqual(str(opts.alignments[0].GetSequence(0)), + 'APGAGKGTQAQFIMEKYGIPQISTGGGLRAAVKS---LGKQAKDIMDAGK'+ + 'LVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVL'+ + 'EF----ELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRK'+ + 'DDQEETVRKRLVEYHQMTAPLL--YYYYKEAEAGNTKYAKVDGTKPVAEV'+ + 'RADLEKILG') + + parser = pm3argparse.PM3ArgumentParser(__doc__, action=False) + parser.AddAlignment() + parser.AssembleParser() + opts = parser.Parse(['--fasta', 'trg:target', + 'data/fasta/1ake_sw.fas']) + self.assertEqual(str(opts.alignments[0].GetSequence(0)), + 'APGAGKGTQAQFIMEKYGIPQISTGGGLRAAVKS---LGKQAKDIMDAGK'+ + 'LVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVL'+ + 'EF----ELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRK'+ + 'DDQEETVRKRLVEYHQMTAPLL--YYYYKEAEAGNTKYAKVDGTKPVAEV'+ + 'RADLEKILG') + + def testAddAlignment(self): + parser = pm3argparse.PM3ArgumentParser(__doc__, action=False) + parser.AddAlignment() + parser.AssembleParser() + opts = parser.Parse(['--fasta', 'trg:target', + 'data/fasta/1ake.fas']) + self.assertEqual(len(opts.alignments), 1) + self.assertEqual(opts.alignments[0].GetLength(), 209) + self.assertEqual(opts.alignments[0].GetSequenceOffset(0), 0) + self.assertEqual(opts.alignments[0].GetSequenceOffset(1), 7) + self.assertEqual(opts.alignments[0].GetSequence(0).gapless_string, + 'APGAGKGTQAQFIMEKYGIPQISTGGGLRAAVKSLGKQAKDIMDAGKLVT'+ + 'DELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFE'+ + 'LIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETV'+ + 'RKRLVEYHQMTAPLLYYYYKEAEAGNTKYAKVDGTKPVAEVRADLEKILG') + self.assertEqual(opts.alignments[0].GetSequence(0).name, 'target') + self.assertEqual(opts.alignments[0].GetSequence(1).name, '1AKE.B') + self.assertEqual(opts.aln_sources[0], 'data/fasta/1ake.fas') + +if __name__ == "__main__": + from ost import testutils + testutils.RunTests() diff --git a/doc/CMakeLists.txt b/doc/CMakeLists.txt index 6517753a1aecd7195c3a584d9976e1722315edcb..a922908435f7092c5dc4de3ab3ca5942ab9b1665 100644 --- a/doc/CMakeLists.txt +++ b/doc/CMakeLists.txt @@ -31,7 +31,8 @@ set(_SPHINX_CONF_SUBST_DICT PROMOD3_VERSION_MAJOR="${PROMOD3_VERSION_MAJOR}" OST_PYMOD_PATH="${OST_PYMOD_PATH}" OST_DOC_URL="${OST_DOC_URL}" LIB_DIR="${LIB_DIR}" - THIS_DIR="${_RST_SOURCE_DIR}") + THIS_DIR="${_RST_SOURCE_DIR}" + PROJECT_SOURCE_DIR="${PROJECT_SOURCE_DIR}") set(_CONF_SUBST_DICT -DINPUT_FILE=${CMAKE_CURRENT_SOURCE_DIR}/conf.py.in) list(APPEND _CONF_SUBST_DICT -DOUT_FILE=${_SPHINX_CONF_PY}) diff --git a/doc/conf.py.in b/doc/conf.py.in index cced43b79bc2754ea7c7b17dec709bdfcfd0a943..737213b7e04c103165ffba73745b56b428dd9e97 100644 --- a/doc/conf.py.in +++ b/doc/conf.py.in @@ -17,13 +17,14 @@ # pylint: disable=invalid-name,missing-docstring import sys - +sys.dont_write_bytecode = True # If extensions (or modules to document with autodoc) are in another directory, # add these directories to sys.path here. If the directory is relative to the # documentation root, use os.path.abspath to make it absolute, like shown here. sys.path.insert(0, r'@LIB_STAGE_PATH@/@PYTHON_MODULE_PATH@') sys.path.insert(1, r'@OST_PYMOD_PATH@') sys.path.insert(2, r'@THIS_DIR@') +sys.path.insert(3, r'@PROJECT_SOURCE_DIR@/actions/tests/') # -- General configuration ----------------------------------------------------- @@ -55,7 +56,7 @@ master_doc = 'index' # General information about the project. project = u'ProMod3' -copyright = u'2014, Bienchen'# pylint: disable=redefined-builtin +copyright = u'2015, Bienchen'# pylint: disable=redefined-builtin # The version info for the project you're documenting, acts as replacement for # |version| and |release|, also used in various other places throughout the @@ -105,7 +106,7 @@ pygments_style = 'sphinx' # The theme to use for HTML and HTML Help pages. See the documentation for # a list of builtin themes. -html_theme = 'default' +html_theme = 'alabaster' # Theme options are theme-specific and customize the look and feel of a theme # further. For a list of options available for each theme, see the @@ -267,7 +268,8 @@ extlinks = {'py_docs' : ('@PYTHON_DOC_URL@/%s', 'OpenStructure documentation')} # The _nameattr is a bit ugly: we want to have __name__ formatted as Python # attribute but Sphinx does not go with calling :attr: inside extlinks. To keep -# the Python url prefix, we define sth here. +# the Python url prefix, we define sth here. Same holds for _mainattr. But this +# time instead of printing '__name__' we want to see '__main__'. rst_epilog = """ .. |project| replace:: %s .. |cmake| replace:: CMake @@ -283,6 +285,13 @@ rst_epilog = """ .. |C++| replace:: C++ .. _ost_s: http://www.OpenStructure.org .. _nameattr: @PYTHON_DOC_URL@/library/__main__.html +.. _mainattr: @PYTHON_DOC_URL@/library/__main__.html +.. _descattr: @PYTHON_DOC_URL@/library/argparse.html#description +.. _progattr: @PYTHON_DOC_URL@/library/argparse.html#prog +.. _argpinit: @PYTHON_DOC_URL@/library/argparse.html#argparse.ArgumentParser +.. _sysargv: @PYTHON_DOC_URL@/library/sys.html#sys.argv +.. |pep8| replace:: PEP 8 +.. _pep8: https://www.python.org/dev/peps/pep-0008/ """ % project # in some versions of sphinx, doctest invokes doctest_path AFTER executing code doctest_global_setup = """ @@ -300,7 +309,7 @@ class DocTestLogger(ost.LogSink): def LogMessage(self, message, severity): # there is a reason why we do not put 'severity' to any use in the message - # written to stdou. If we modify the message handed in by a doctest, + # written to stdout. If we modify the message handed in by a doctest, # verifying it would mean the creator of the doctest would have to check # that very code here to get the test right. sys.stdout.write('%s' % message) diff --git a/doc/contributing.rst b/doc/contributing.rst index e2f9ce22d0ac7275956500c542c40215c7239088..f9cdb6d7d62a2cd76625bc5d8a661341d49c10e3 100644 --- a/doc/contributing.rst +++ b/doc/contributing.rst @@ -270,6 +270,8 @@ http://sphinx-doc.org/markup/inline.html If you write new functionality for |project|, or fix bugs, feel free to extend the Changelog. It will be automatically pulled into the documentation. +.. _how-to-start-your-own-module: + -------------------------------------------------------------------------------- How To Start Your Own Module -------------------------------------------------------------------------------- @@ -641,6 +643,142 @@ you. Now tests should be available by ``make check``, ``make codetest`` and ``make test_something.py_run``. +-------------------------------------------------------------------------------- +How To Start Your Own Action +-------------------------------------------------------------------------------- +In |project| we call scripts/ programs 'actions'. They are started by a +launcher found in your staging directory at :file:`stage/bin/pm`. This little +guy helps keeping the shell environment in the right mood to carry out your +job. So usually you will start an action by + +.. code-block:: console + + $ stage/bin/pm help + +To start your own action, follow :ref:`how-to-start-your-own-module` until +creating a directory structure for a new module. Also **do** go for a dedicated +branch for action-development. There you can produce intermediate commits while +other branches stay clean in case you have to do some work there which needs to +get public. + +After preparing your repository its time to create a file for the action. That +is a bit different than for modules. Assuming we are sitting in the +repository's root: + +.. code-block:: console + + $ touch action/pm-awesome-action + $ chmod +x action/pm-awesome-action + +Two things are important here: actions are prefixed with :file:`pm-`, so they +are recognised by the :file:`pm` launcher. Secondly, action files need to be +executable, which does not propagate if you do it **after** the first call to +``make``. + +To get the new action recognised by ``make`` to be placed in +:file:`stage/libexec/promod3`, it has to be registered with |cmake| in +:file:`actions/CMakeLists.txt`: + +.. code-block:: cmake + :linenos: + + add_custom_target(actions ALL) + add_subdirectory(tests) + + pm_action_init() + pm_action(pm-build-rawmodel actions) + pm_action(pm-help actions) + pm_action(pm-awesome-action actions) + +Just add your action with its full filename with a call to +:cmake:command:`pm_action` at the end of the file. + +Before coding your action, lets set up unit tests for it. Usually when adding +features, you will immediately try them, check that everything works as +intended, etc.. |project| helps you automatising those tests so its rather easy +to check later, if code changes break anything. Start with a file +:file:`actions/tests/test_action_awesome.py`: + +.. testcode:: contribute_action + :hide: + + import sys + sys.dont_write_bytecode = True + + import test_actions + import unittest + + class DoAwesomeActionTests(test_actions.ActionTestCase): + def __init__(self, *args, **kwargs): + test_actions.ActionTestCase.__init__(self, *args, **kwargs) + self.pm_bin = os.path.join(os.getcwd(), os.pardir, 'stage', 'bin', + 'pm') + self.pm_action = 'help' + + def testExit0(self): + self.RunExitStatusTest(0, list()) + + if __name__ == "__builtin__": + import os + suite = unittest.TestLoader().loadTestsFromTestCase(DoAwesomeActionTests) + unittest.TextTestRunner().run(suite) + +.. code-block:: python + :linenos: + + import sys + + # this is needed so there will be no test_actions.pyc created in the source + # directory + sys.dont_write_bytecode = True + + import test_actions + + class AwesomeActionTests(test_actions.ActionTestCase): + def __init__(self, *args, **kwargs): + test_actions.ActionTestCase.__init__(self, *args, **kwargs) + self.pm_action = 'awesome' + + def testExit0(self): + self.RunExitStatusTest(0, list()) + + if __name__ == "__main__": + from ost import testutils + testutils.RunTests() + +Please note that for actions we are using +:class:`test_actions.ActionTestCase <test_actions>` instead of +:class:`unittest.TestCase`. Since testing has a lot in common for different +actions, we decided to put up a little wrapper around this subject. See the +documentation of :class:`ActionTestCase <test_actions>` for more information. + +Now its time to fill your action with code. Instead of reading a lot more of +explanations, it should be easy to go by examples from the :file:`actions` +directory. There are only two really important points: + +* No shebang line (``#! /usr/bin/python``) in your action! Also no + ``#! /usr/bin/env python`` or anything like this. This may lead to funny side + effects, like calling a |python| interpreter from outside a virtual + environment or a different version |ost_s|. Basically it may mess up the + environment your action is running in. Actions are called by :file:`pm`, + that's enough to get everything just right. + +* The action of your action happens in the |mainattr|_ branch of the script. + Your action will have own function definitions, variables and all the bells + and whistles. Hiding behind |mainattr|_ keeps everything separated and makes + things easier when it gets to debugging. So just after + + .. code-block:: python + + import alot + + def functions_specific_to_your_action(...): + + if __name__ == "__main__": + <put together what your action should do here> + + start putting your action together. + -------------------------------------------------------------------------------- Third Party Contributions (License Issues) -------------------------------------------------------------------------------- @@ -675,10 +813,9 @@ contributions to web pages using |project|. .. |fedora| replace:: Fedora .. |nameattr| replace:: :attr:`__name__` +.. |mainattr| replace:: :attr:`__main__` .. |pylint| replace:: Pylint .. _pylint: http://www.pylint.org -.. |pep8| replace:: PEP 8 -.. _pep8: https://www.python.org/dev/peps/pep-0008/ .. LocalWords: cmake hotfix doctest linkcheck rebase BRANCHNAME rebasing py .. LocalWords: CMakeLists txt rst pymod init submodule src restructuredtext .. LocalWords: makefiles formatters Changelog codetest promod sidechains io @@ -687,6 +824,8 @@ contributions to web pages using |project|. .. LocalWords: changelog Optimized DOPTIMIZE gitignore cd conf subtree attr .. LocalWords: unittest TestCase nameattr testcode staticmethod builtin cp .. LocalWords: SomethingTests testFileExistsFalse testutils RunTests DQMEAN -.. LocalWords: pre API inline CMake hh ProMod Bienchen OST OPENSTRUCTURE +.. LocalWords: pre API inline CMake hh ProMod Bienchen OST OPENSTRUCTURE os .. LocalWords: mol alg conop QMEAN KIC eigen eigenvectors Lapack rawmodel -.. LocalWords: OpenStructure ost pylint +.. LocalWords: OpenStructure ost pylint chmod sys pyc dont bytecode args +.. LocalWords: AwesomeActionTests ActionTestCase kwargs testExit getcwd +.. LocalWords: RunExitStatusTest DoAwesomeActionTests pardir mainattr alot diff --git a/doc/developers.rst b/doc/developers.rst index c95efc638baaaccf5fcd97b46b06376923efa044..387c9b0a510c06a37cedacf69b3f4caa319805ec 100644 --- a/doc/developers.rst +++ b/doc/developers.rst @@ -14,6 +14,7 @@ Contents: rawmodel/index loop/index sidechain/index + actions/index_dev buildsystem contributing cmake/index diff --git a/doc/html/_modules/index.html b/doc/html/_modules/index.html index dfe8a0d878b483d68340234f4cd07a05c5685ff4..71f48a347297969fa05bf47a58c120918316f7a2 100644 --- a/doc/html/_modules/index.html +++ b/doc/html/_modules/index.html @@ -8,7 +8,7 @@ <title>Overview: module code — ProMod3 0 documentation</title> - <link rel="stylesheet" href="../_static/default.css" type="text/css" /> + <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> <script type="text/javascript"> @@ -23,10 +23,14 @@ <script type="text/javascript" src="../_static/jquery.js"></script> <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> - <link rel="top" title="ProMod3 0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 0 documentation" href="../index.html" /> + + + <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9"> + </head> - <body> - <div class="related"> + <body role="document"> + <div class="related" role="navigation" aria-label="related navigation"> <h3>Navigation</h3> <ul> <li class="right" style="margin-right: 10px"> @@ -35,28 +39,29 @@ <li class="right" > <a href="../py-modindex.html" title="Python Module Index" >modules</a> |</li> - <li><a href="../index.html">ProMod3 0 documentation</a> »</li> + <li class="nav-item nav-item-0"><a href="../index.html">ProMod3 0 documentation</a> »</li> </ul> </div> <div class="document"> <div class="documentwrapper"> <div class="bodywrapper"> - <div class="body"> + <div class="body" role="main"> <h1>All modules for which code is available</h1> <ul><li><a href="promod3.html">promod3</a></li> -<ul><li><a href="promod3/core/argcheck.html">promod3.core.argcheck</a></li> -<li><a href="promod3/core/helper.html">promod3.core.helper</a></li> -<li><a href="promod3/rawmodel.html">promod3.rawmodel</a></li> -</ul></ul> +<ul><li><a href="promod3/core/helper.html">promod3.core.helper</a></li> +<li><a href="promod3/core/pm3argparse.html">promod3.core.pm3argparse</a></li> +<li><a href="promod3/rawmodel/_rawmodel.html">promod3.rawmodel._rawmodel</a></li> +</ul><li><a href="test_actions.html">test_actions</a></li> +</ul> </div> </div> </div> - <div class="sphinxsidebar"> + <div class="sphinxsidebar" role="navigation" aria-label="main navigation"> <div class="sphinxsidebarwrapper"> -<div id="searchbox" style="display: none"> +<div id="searchbox" style="display: none" role="search"> <h3>Quick search</h3> <form class="search" action="../search.html" method="get"> <input type="text" name="q" /> @@ -73,22 +78,17 @@ </div> <div class="clearer"></div> </div> - <div class="related"> - <h3>Navigation</h3> - <ul> - <li class="right" style="margin-right: 10px"> - <a href="../genindex.html" title="General Index" - >index</a></li> - <li class="right" > - <a href="../py-modindex.html" title="Python Module Index" - >modules</a> |</li> - <li><a href="../index.html">ProMod3 0 documentation</a> »</li> - </ul> - </div> <div class="footer"> - © Copyright 2014, Bienchen. - Last updated on Mar 24 17:42, 2015. - Created using <a href="http://sphinx-doc.org/">Sphinx</a> 1.2.3. + ©2015, Bienchen. + + | + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.3</a> + </div> + + + + </body> </html> \ No newline at end of file diff --git a/doc/html/_modules/promod3.html b/doc/html/_modules/promod3.html index ebd9347a2fa3eb5df3dd5c7db6af1d206a2540f2..952276bf7e790c266131a2ecf65785ede4b31dbd 100644 --- a/doc/html/_modules/promod3.html +++ b/doc/html/_modules/promod3.html @@ -8,7 +8,7 @@ <title>promod3 — ProMod3 0 documentation</title> - <link rel="stylesheet" href="../_static/default.css" type="text/css" /> + <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> <script type="text/javascript"> @@ -24,10 +24,14 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <link rel="top" title="ProMod3 0 documentation" href="../index.html" /> - <link rel="up" title="Module code" href="index.html" /> + <link rel="up" title="Module code" href="index.html" /> + + + <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9"> + </head> - <body> - <div class="related"> + <body role="document"> + <div class="related" role="navigation" aria-label="related navigation"> <h3>Navigation</h3> <ul> <li class="right" style="margin-right: 10px"> @@ -36,15 +40,15 @@ <li class="right" > <a href="../py-modindex.html" title="Python Module Index" >modules</a> |</li> - <li><a href="../index.html">ProMod3 0 documentation</a> »</li> - <li><a href="index.html" accesskey="U">Module code</a> »</li> + <li class="nav-item nav-item-0"><a href="../index.html">ProMod3 0 documentation</a> »</li> + <li class="nav-item nav-item-1"><a href="index.html" accesskey="U">Module code</a> »</li> </ul> </div> <div class="document"> <div class="documentwrapper"> <div class="bodywrapper"> - <div class="body"> + <div class="body" role="main"> <h1>Source code for promod3</h1><div class="highlight"><pre> <span class="c"># load compounds library</span> @@ -90,9 +94,9 @@ </div> </div> </div> - <div class="sphinxsidebar"> + <div class="sphinxsidebar" role="navigation" aria-label="main navigation"> <div class="sphinxsidebarwrapper"> -<div id="searchbox" style="display: none"> +<div id="searchbox" style="display: none" role="search"> <h3>Quick search</h3> <form class="search" action="../search.html" method="get"> <input type="text" name="q" /> @@ -109,23 +113,17 @@ </div> <div class="clearer"></div> </div> - <div class="related"> - <h3>Navigation</h3> - <ul> - <li class="right" style="margin-right: 10px"> - <a href="../genindex.html" title="General Index" - >index</a></li> - <li class="right" > - <a href="../py-modindex.html" title="Python Module Index" - >modules</a> |</li> - <li><a href="../index.html">ProMod3 0 documentation</a> »</li> - <li><a href="index.html" >Module code</a> »</li> - </ul> - </div> <div class="footer"> - © Copyright 2014, Bienchen. - Last updated on Mar 24 17:42, 2015. - Created using <a href="http://sphinx-doc.org/">Sphinx</a> 1.2.3. + ©2015, Bienchen. + + | + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.3</a> + </div> + + + + </body> </html> \ No newline at end of file diff --git a/doc/html/_modules/promod3/core/helper.html b/doc/html/_modules/promod3/core/helper.html index 42cd70240d07952892c243f499e9014443321643..26a25b8bccbc719d9b953ba8e1badfe18f0fb53d 100644 --- a/doc/html/_modules/promod3/core/helper.html +++ b/doc/html/_modules/promod3/core/helper.html @@ -8,7 +8,7 @@ <title>promod3.core.helper — ProMod3 0 documentation</title> - <link rel="stylesheet" href="../../../_static/default.css" type="text/css" /> + <link rel="stylesheet" href="../../../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../../../_static/pygments.css" type="text/css" /> <script type="text/javascript"> @@ -24,10 +24,14 @@ <script type="text/javascript" src="../../../_static/underscore.js"></script> <script type="text/javascript" src="../../../_static/doctools.js"></script> <link rel="top" title="ProMod3 0 documentation" href="../../../index.html" /> - <link rel="up" title="promod3" href="../../promod3.html" /> + <link rel="up" title="promod3" href="../../promod3.html" /> + + + <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9"> + </head> - <body> - <div class="related"> + <body role="document"> + <div class="related" role="navigation" aria-label="related navigation"> <h3>Navigation</h3> <ul> <li class="right" style="margin-right: 10px"> @@ -36,53 +40,185 @@ <li class="right" > <a href="../../../py-modindex.html" title="Python Module Index" >modules</a> |</li> - <li><a href="../../../index.html">ProMod3 0 documentation</a> »</li> - <li><a href="../../index.html" >Module code</a> »</li> - <li><a href="../../promod3.html" accesskey="U">promod3</a> »</li> + <li class="nav-item nav-item-0"><a href="../../../index.html">ProMod3 0 documentation</a> »</li> + <li class="nav-item nav-item-1"><a href="../../index.html" >Module code</a> »</li> + <li class="nav-item nav-item-2"><a href="../../promod3.html" accesskey="U">promod3</a> »</li> </ul> </div> <div class="document"> <div class="documentwrapper"> <div class="bodywrapper"> - <div class="body"> + <div class="body" role="main"> <h1>Source code for promod3.core.helper</h1><div class="highlight"><pre> <span class="sd">"""</span> <span class="sd">Uncategorised functions which may come handy at several places.</span> <span class="sd">"""</span> +<span class="kn">import</span> <span class="nn">os</span> <span class="kn">import</span> <span class="nn">sys</span> <span class="kn">import</span> <span class="nn">ost</span> <div class="viewcode-block" id="MsgErrorAndExit"><a class="viewcode-back" href="../../../core/helper.html#promod3.core.helper.MsgErrorAndExit">[docs]</a><span class="k">def</span> <span class="nf">MsgErrorAndExit</span><span class="p">(</span><span class="n">msg</span><span class="p">,</span> <span class="n">exit_status</span><span class="p">):</span> - <span class="sd">'''</span> -<span class="sd"> Send a messages to the |ost_s| :ost_docs:`error log <base/logging/>` and exit</span> -<span class="sd"> the Python interpreter.</span> + <span class="sd">'''</span> +<span class="sd"> Send a messages to the |ost_s| :ost_docs:`error log <base/logging/>` and</span> +<span class="sd"> exit the Python interpreter.</span> -<span class="sd"> :param msg: The message.</span> -<span class="sd"> :type msg: :class:`str`</span> +<span class="sd"> :param msg: The message.</span> +<span class="sd"> :type msg: :class:`str`</span> -<span class="sd"> :param exit_status: Exit code, ends up in ``$?`` in the shell. ``0`` is</span> +<span class="sd"> :param exit_status: Exit code, ends up in ``$?`` in the shell. ``0`` is</span> <span class="sd"> traditionally reserved to successful commands.</span> -<span class="sd"> :type exit_status: :class:`int`</span> +<span class="sd"> :type exit_status: :class:`int`</span> -<span class="sd"> :returns: No return value, exits script with value ``exit_status``.</span> -<span class="sd"> '''</span> - <span class="n">ost</span><span class="o">.</span><span class="n">LogError</span><span class="p">(</span><span class="n">msg</span><span class="p">)</span> - <span class="n">sys</span><span class="o">.</span><span class="n">exit</span><span class="p">(</span><span class="n">exit_status</span><span class="p">)</span> +<span class="sd"> :returns: No return value, exits script with value ``exit_status``.</span> +<span class="sd"> '''</span> + <span class="n">ost</span><span class="o">.</span><span class="n">LogError</span><span class="p">(</span><span class="n">msg</span><span class="p">)</span> + <span class="n">sys</span><span class="o">.</span><span class="n">exit</span><span class="p">(</span><span class="n">exit_status</span><span class="p">)</span> +</div> +<div class="viewcode-block" id="FileExists"><a class="viewcode-back" href="../../../core/helper.html#promod3.core.helper.FileExists">[docs]</a><span class="k">def</span> <span class="nf">FileExists</span><span class="p">(</span><span class="n">prefix</span><span class="p">,</span> <span class="n">exit_status</span><span class="p">,</span> <span class="n">filename</span><span class="p">):</span> + <span class="sd">'''</span> +<span class="sd"> Checks if a file exists, terminates if not. The error message displayed is</span> +<span class="sd"> fixed and only needs a *prefix* describing the specimen of file.</span> + +<span class="sd"> :param prefix: String to put in front of the failure-message</span> +<span class="sd"> "file does not exist: ``file``".</span> +<span class="sd"> :type prefix: :class:`str`</span> + +<span class="sd"> :param exit_status: Exit code on missing file, ends up in ``$?`` in the</span> +<span class="sd"> shell. ``0`` is traditionally reserved to successful commands.</span> +<span class="sd"> :type exit_status: :class:`int`</span> + +<span class="sd"> :param file: Path including file name to be checked.</span> +<span class="sd"> :type file: :class:`str`</span> + +<span class="sd"> :returns: No return value, exits script with value ``exit_status`` if file</span> +<span class="sd"> is missing.</span> +<span class="sd"> '''</span> + <span class="k">if</span> <span class="ow">not</span> <span class="n">os</span><span class="o">.</span><span class="n">path</span><span class="o">.</span><span class="n">exists</span><span class="p">(</span><span class="n">filename</span><span class="p">):</span> + <span class="n">MsgErrorAndExit</span><span class="p">(</span><span class="s">'</span><span class="si">%s</span><span class="s"> file does not exist: </span><span class="si">%s</span><span class="se">\n</span><span class="s">'</span> <span class="o">%</span> <span class="p">(</span><span class="n">prefix</span><span class="p">,</span> <span class="n">filename</span><span class="p">),</span> + <span class="n">exit_status</span><span class="p">)</span> +</div> +<div class="viewcode-block" id="FileGzip"><a class="viewcode-back" href="../../../core/helper.html#promod3.core.helper.FileGzip">[docs]</a><span class="k">def</span> <span class="nf">FileGzip</span><span class="p">(</span><span class="n">prefix</span><span class="p">,</span> <span class="n">exit_status</span><span class="p">,</span> <span class="n">filename</span><span class="p">,</span> <span class="n">allowed</span><span class="o">=</span><span class="bp">True</span><span class="p">):</span> + <span class="sd">'''</span> +<span class="sd"> See if a file is gzipped or not. This is basically done by checking for a</span> +<span class="sd"> "gz" suffix. May also be used to verify that a file is not compressed where</span> +<span class="sd"> it does not apply. That is where *allowed* comes in. If "gz" is not allowed,</span> +<span class="sd"> terminates the script on gzip files.</span> + +<span class="sd"> :param prefix: String to put in front of the failure-message where gzip</span> +<span class="sd"> files are not allowed.</span> +<span class="sd"> :type prefix: :class:`str`</span> + +<span class="sd"> :param exit_status: Exit code on gzip files to be avoided, ends up in</span> +<span class="sd"> ``$?`` in the shell. ``0`` is traditionally reserved to</span> +<span class="sd"> successful commands.</span> +<span class="sd"> :type exit_status: :class:`int`</span> + +<span class="sd"> :param filename: Path including file name to be checked.</span> +<span class="sd"> :type filename: :class:`str`</span> + +<span class="sd"> :param allowed: Set to ``False`` if gzipped files are not allowed. Then the</span> +<span class="sd"> script will terminate if a gzip file is found.</span> +<span class="sd"> :type allowed: :class:`bool`</span> + +<span class="sd"> :returns: Flag to indicate if file is gzipped (:class:`bool`).</span> +<span class="sd"> '''</span> + <span class="n">_</span><span class="p">,</span> <span class="n">fileext</span> <span class="o">=</span> <span class="n">os</span><span class="o">.</span><span class="n">path</span><span class="o">.</span><span class="n">splitext</span><span class="p">(</span><span class="n">filename</span><span class="p">)</span> + <span class="n">is_gz</span> <span class="o">=</span> <span class="bp">False</span> + <span class="k">if</span> <span class="n">fileext</span><span class="o">.</span><span class="n">lower</span><span class="p">()</span> <span class="o">==</span> <span class="s">'.gz'</span><span class="p">:</span> + <span class="n">is_gz</span> <span class="o">=</span> <span class="bp">True</span> + <span class="k">if</span> <span class="ow">not</span> <span class="n">allowed</span><span class="p">:</span> + <span class="n">MsgErrorAndExit</span><span class="p">(</span><span class="s">'</span><span class="si">%s</span><span class="s"> file in Gzip not supported: </span><span class="si">%s</span><span class="s">. '</span> <span class="o">%</span> <span class="p">(</span><span class="n">prefix</span><span class="p">,</span> + <span class="n">filename</span><span class="p">),</span> + <span class="n">exit_status</span><span class="p">)</span> + <span class="k">return</span> <span class="n">is_gz</span> +</div> +<div class="viewcode-block" id="FileExtension"><a class="viewcode-back" href="../../../core/helper.html#promod3.core.helper.FileExtension">[docs]</a><span class="k">def</span> <span class="nf">FileExtension</span><span class="p">(</span><span class="n">prefix</span><span class="p">,</span> <span class="n">exit_status</span><span class="p">,</span> <span class="n">filename</span><span class="p">,</span> <span class="n">extensions</span><span class="p">,</span> <span class="n">gzip</span><span class="o">=</span><span class="bp">False</span><span class="p">):</span> + <span class="sd">'''</span> +<span class="sd"> Checks a file to carry a known extension given by a list of strings. Since</span> +<span class="sd"> files are very often compressed these days, an additional "gz" suffix can be</span> +<span class="sd"> tracked automatically by this function. Thus, the list of *extensions* only</span> +<span class="sd"> needs to contain what you are really looking for, e.g. ("pdb") instead of</span> +<span class="sd"> ("pdb", "pdb.gz"). The *gzip* flag also determines the output of this</span> +<span class="sd"> function. If enabled, a triple is returned: name of the file without</span> +<span class="sd"> extension, its extension and a Boolean to tell whether the file carries the</span> +<span class="sd"> gzip extension or not. If *gzip* detection is turned of, only a tuple is</span> +<span class="sd"> returned: file name and extension. If the tested file name has an</span> +<span class="sd"> unrecognised extension, this function terminates the script.</span> + +<span class="sd"> :param prefix: String to put in front of the failure-message</span> +<span class="sd"> "file extension not supported: ``filename``".</span> +<span class="sd"> :type prefix: :class:`str`</span> + +<span class="sd"> :param exit_status: Exit code on missing file, ends up in ``$?`` in the</span> +<span class="sd"> shell. ``0`` is traditionally reserved to successful commands.</span> +<span class="sd"> :type exit_status: :class:`int`</span> + +<span class="sd"> :param filename: Path including file name to be checked.</span> +<span class="sd"> :type filename: :class:`str`</span> + +<span class="sd"> :param extensions: List of strings without a leading ".".</span> +<span class="sd"> :type extensions: :class:`list`</span> + +<span class="sd"> :param gzip: Indicates whether to check for an additional "gz" extension.</span> +<span class="sd"> :type gzip: :class:`bool`</span> + +<span class="sd"> :returns: (base name of ``filename`` (:class:`str`), extension of file</span> +<span class="sd"> without a ".gz" (:class:`str`), flag to indicate an additional</span> +<span class="sd"> ".gz" (:class:`bool`)) **if** ``gzip`` is set, (base name of</span> +<span class="sd"> ``filename`` (:class:`str`), extension of file) **if not**.</span> +<span class="sd"> '''</span> + <span class="n">pfilename</span><span class="p">,</span> <span class="n">fileext</span> <span class="o">=</span> <span class="n">os</span><span class="o">.</span><span class="n">path</span><span class="o">.</span><span class="n">splitext</span><span class="p">(</span><span class="n">filename</span><span class="p">)</span> + <span class="n">is_gz</span> <span class="o">=</span> <span class="bp">False</span> + <span class="k">if</span> <span class="n">fileext</span><span class="o">.</span><span class="n">lower</span><span class="p">()</span> <span class="o">==</span> <span class="s">'.gz'</span><span class="p">:</span> + <span class="n">is_gz</span> <span class="o">=</span> <span class="bp">True</span> + <span class="n">pfilename</span><span class="p">,</span> <span class="n">fileext</span> <span class="o">=</span> <span class="n">os</span><span class="o">.</span><span class="n">path</span><span class="o">.</span><span class="n">splitext</span><span class="p">(</span><span class="n">pfilename</span><span class="p">)</span> + <span class="k">if</span> <span class="ow">not</span> <span class="n">gzip</span><span class="p">:</span> + <span class="n">extension_string</span> <span class="o">=</span> <span class="s">', '</span><span class="o">.</span><span class="n">join</span><span class="p">(</span><span class="n">extensions</span><span class="p">)</span> + <span class="n">MsgErrorAndExit</span><span class="p">(</span><span class="s">'</span><span class="si">%s</span><span class="s"> file extension not supported: </span><span class="si">%s</span><span class="s">. '</span> <span class="o">%</span><span class="p">(</span><span class="n">prefix</span><span class="p">,</span> + <span class="n">filename</span><span class="p">)</span><span class="o">+</span> + <span class="s">'Allowed extensions are: </span><span class="si">%s</span><span class="se">\n</span><span class="s">'</span> <span class="o">%</span> <span class="n">extension_string</span><span class="p">,</span> + <span class="n">exit_status</span><span class="p">)</span> + <span class="k">if</span> <span class="n">fileext</span> <span class="o">==</span> <span class="s">''</span><span class="p">:</span> + <span class="n">extension_string</span> <span class="o">=</span> <span class="s">', '</span><span class="o">.</span><span class="n">join</span><span class="p">(</span><span class="n">extensions</span><span class="p">)</span> + <span class="k">if</span> <span class="n">gzip</span><span class="p">:</span> + <span class="n">extension_string</span> <span class="o">+=</span> <span class="s">', '</span> <span class="o">+</span> <span class="s">'.gz, '</span><span class="o">.</span><span class="n">join</span><span class="p">(</span><span class="n">extensions</span><span class="p">)</span> <span class="o">+</span> <span class="s">'.gz'</span> + <span class="n">MsgErrorAndExit</span><span class="p">(</span><span class="s">'</span><span class="si">%s</span><span class="s"> file extension not supported: </span><span class="si">%s</span><span class="s">. '</span> <span class="o">%</span><span class="p">(</span><span class="n">prefix</span><span class="p">,</span> + <span class="n">filename</span><span class="p">)</span><span class="o">+</span> + <span class="s">'Allowed extensions are: </span><span class="si">%s</span><span class="se">\n</span><span class="s">'</span> <span class="o">%</span> <span class="n">extension_string</span><span class="p">,</span> + <span class="n">exit_status</span><span class="p">)</span> + <span class="n">fileext</span> <span class="o">=</span> <span class="n">fileext</span><span class="p">[</span><span class="mi">1</span><span class="p">:]</span><span class="o">.</span><span class="n">lower</span><span class="p">()</span> + <span class="k">for</span> <span class="n">ext</span> <span class="ow">in</span> <span class="n">extensions</span><span class="p">:</span> + <span class="k">if</span> <span class="n">fileext</span> <span class="o">==</span> <span class="n">ext</span><span class="o">.</span><span class="n">lower</span><span class="p">():</span> + <span class="k">if</span> <span class="n">gzip</span><span class="p">:</span> + <span class="k">return</span> <span class="n">os</span><span class="o">.</span><span class="n">path</span><span class="o">.</span><span class="n">basename</span><span class="p">(</span><span class="n">pfilename</span><span class="p">),</span> <span class="n">fileext</span><span class="p">,</span> <span class="n">is_gz</span> + <span class="k">else</span><span class="p">:</span> + <span class="k">return</span> <span class="n">os</span><span class="o">.</span><span class="n">path</span><span class="o">.</span><span class="n">basename</span><span class="p">(</span><span class="n">pfilename</span><span class="p">),</span> <span class="n">fileext</span> + <span class="n">extension_string</span> <span class="o">=</span> <span class="s">', '</span><span class="o">.</span><span class="n">join</span><span class="p">(</span><span class="n">extensions</span><span class="p">)</span> + <span class="k">if</span> <span class="n">gzip</span><span class="p">:</span> + <span class="n">extension_string</span> <span class="o">+=</span> <span class="s">', '</span> <span class="o">+</span> <span class="s">'.gz, '</span><span class="o">.</span><span class="n">join</span><span class="p">(</span><span class="n">extensions</span><span class="p">)</span> <span class="o">+</span> <span class="s">'.gz'</span> + <span class="n">MsgErrorAndExit</span><span class="p">(</span><span class="s">'</span><span class="si">%s</span><span class="s"> file extension not supported: </span><span class="si">%s</span><span class="s">. '</span> <span class="o">%</span> <span class="p">(</span><span class="n">prefix</span><span class="p">,</span> + <span class="n">filename</span><span class="p">)</span><span class="o">+</span> + <span class="s">'Allowed extensions are: </span><span class="si">%s</span><span class="se">\n</span><span class="s">'</span> <span class="o">%</span> <span class="n">extension_string</span><span class="p">,</span> + <span class="n">exit_status</span><span class="p">)</span> </div> <span class="n">__all__</span> <span class="o">=</span> <span class="p">(</span> - <span class="s">'MsgErrorAndExit'</span><span class="p">,</span> + <span class="s">'MsgErrorAndExit'</span><span class="p">,</span> + <span class="s">'FileExists'</span><span class="p">,</span> + <span class="s">'FileExtension'</span><span class="p">,</span> <span class="p">)</span> + +<span class="c"># LocalWords: gzipped gz param str gzip bool</span> </pre></div> </div> </div> </div> - <div class="sphinxsidebar"> + <div class="sphinxsidebar" role="navigation" aria-label="main navigation"> <div class="sphinxsidebarwrapper"> -<div id="searchbox" style="display: none"> +<div id="searchbox" style="display: none" role="search"> <h3>Quick search</h3> <form class="search" action="../../../search.html" method="get"> <input type="text" name="q" /> @@ -99,24 +235,17 @@ </div> <div class="clearer"></div> </div> - <div class="related"> - <h3>Navigation</h3> - <ul> - <li class="right" style="margin-right: 10px"> - <a href="../../../genindex.html" title="General Index" - >index</a></li> - <li class="right" > - <a href="../../../py-modindex.html" title="Python Module Index" - >modules</a> |</li> - <li><a href="../../../index.html">ProMod3 0 documentation</a> »</li> - <li><a href="../../index.html" >Module code</a> »</li> - <li><a href="../../promod3.html" >promod3</a> »</li> - </ul> - </div> <div class="footer"> - © Copyright 2014, Bienchen. - Last updated on Mar 24 17:42, 2015. - Created using <a href="http://sphinx-doc.org/">Sphinx</a> 1.2.3. + ©2015, Bienchen. + + | + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.3</a> + </div> + + + + </body> </html> \ No newline at end of file diff --git a/doc/html/_modules/promod3/core/pm3argparse.html b/doc/html/_modules/promod3/core/pm3argparse.html new file mode 100644 index 0000000000000000000000000000000000000000..01998d8b3af979496130c526ccfb522fe7b1ebd1 --- /dev/null +++ b/doc/html/_modules/promod3/core/pm3argparse.html @@ -0,0 +1,390 @@ +<!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" + "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> + + +<html xmlns="http://www.w3.org/1999/xhtml"> + <head> + <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> + + <title>promod3.core.pm3argparse — ProMod3 0 documentation</title> + + <link rel="stylesheet" href="../../../_static/alabaster.css" type="text/css" /> + <link rel="stylesheet" href="../../../_static/pygments.css" type="text/css" /> + + <script type="text/javascript"> + var DOCUMENTATION_OPTIONS = { + URL_ROOT: '../../../', + VERSION: '0', + COLLAPSE_INDEX: false, + FILE_SUFFIX: '.html', + HAS_SOURCE: true + }; + </script> + <script type="text/javascript" src="../../../_static/jquery.js"></script> + <script type="text/javascript" src="../../../_static/underscore.js"></script> + <script type="text/javascript" src="../../../_static/doctools.js"></script> + <link rel="top" title="ProMod3 0 documentation" href="../../../index.html" /> + <link rel="up" title="promod3" href="../../promod3.html" /> + + + <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9"> + + </head> + <body role="document"> + <div class="related" role="navigation" aria-label="related navigation"> + <h3>Navigation</h3> + <ul> + <li class="right" style="margin-right: 10px"> + <a href="../../../genindex.html" title="General Index" + accesskey="I">index</a></li> + <li class="right" > + <a href="../../../py-modindex.html" title="Python Module Index" + >modules</a> |</li> + <li class="nav-item nav-item-0"><a href="../../../index.html">ProMod3 0 documentation</a> »</li> + <li class="nav-item nav-item-1"><a href="../../index.html" >Module code</a> »</li> + <li class="nav-item nav-item-2"><a href="../../promod3.html" accesskey="U">promod3</a> »</li> + </ul> + </div> + + <div class="document"> + <div class="documentwrapper"> + <div class="bodywrapper"> + <div class="body" role="main"> + + <h1>Source code for promod3.core.pm3argparse</h1><div class="highlight"><pre> +<span class="sd">"""</span> +<span class="sd">Extensions for the argparse module.</span> +<span class="sd">"""</span> + +<span class="kn">import</span> <span class="nn">argparse</span> +<span class="kn">import</span> <span class="nn">sys</span> +<span class="kn">import</span> <span class="nn">os</span> +<span class="kn">import</span> <span class="nn">gzip</span> +<span class="kn">import</span> <span class="nn">tempfile</span> + +<span class="kn">import</span> <span class="nn">ost</span> +<span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">seq</span> + +<span class="kn">from</span> <span class="nn">promod3.core</span> <span class="kn">import</span> <span class="n">helper</span> + +<span class="k">def</span> <span class="nf">_AssembleTrgTplAln</span><span class="p">(</span><span class="n">target</span><span class="p">,</span> <span class="n">template</span><span class="p">):</span> + <span class="sd">"""</span> +<span class="sd"> Internal function: Assemble a target-template alignment without leading/</span> +<span class="sd"> final gaps in the target sequence. Set the offset for the template sequence.</span> +<span class="sd"> """</span> + <span class="c"># count leading gaps to get the start position</span> + <span class="n">start</span> <span class="o">=</span> <span class="mi">0</span> + <span class="k">for</span> <span class="n">i</span> <span class="ow">in</span> <span class="nb">range</span><span class="p">(</span><span class="mi">0</span><span class="p">,</span> <span class="n">target</span><span class="o">.</span><span class="n">length</span><span class="p">):</span> + <span class="k">if</span> <span class="n">target</span><span class="p">[</span><span class="n">i</span><span class="p">]</span> <span class="o">!=</span> <span class="s">'-'</span><span class="p">:</span> + <span class="n">start</span> <span class="o">=</span> <span class="n">i</span> + <span class="k">break</span> + <span class="c"># get rid of closing gaps at the end</span> + <span class="n">end</span> <span class="o">=</span> <span class="n">target</span><span class="o">.</span><span class="n">length</span> + <span class="k">for</span> <span class="n">i</span> <span class="ow">in</span> <span class="nb">range</span><span class="p">(</span><span class="n">target</span><span class="o">.</span><span class="n">length</span><span class="p">,</span> <span class="mi">1</span><span class="p">,</span> <span class="o">-</span><span class="mi">1</span><span class="p">):</span> + <span class="k">if</span> <span class="n">target</span><span class="p">[</span><span class="n">i</span><span class="o">-</span><span class="mi">1</span><span class="p">]</span> <span class="o">!=</span> <span class="s">'-'</span><span class="p">:</span> + <span class="n">end</span> <span class="o">=</span> <span class="n">i</span> + <span class="k">break</span> + <span class="c"># assemble template sequence</span> + <span class="n">tpl_str</span> <span class="o">=</span> <span class="s">''</span> + <span class="k">for</span> <span class="n">i</span> <span class="ow">in</span> <span class="nb">range</span><span class="p">(</span><span class="n">start</span><span class="p">,</span> <span class="n">end</span><span class="p">):</span> + <span class="n">tpl_str</span> <span class="o">+=</span> <span class="n">template</span><span class="p">[</span><span class="n">i</span><span class="p">]</span> + <span class="n">new_aln</span> <span class="o">=</span> <span class="n">seq</span><span class="o">.</span><span class="n">CreateAlignment</span><span class="p">(</span><span class="n">seq</span><span class="o">.</span><span class="n">CreateSequence</span><span class="p">(</span><span class="n">target</span><span class="o">.</span><span class="n">name</span><span class="o">.</span><span class="n">strip</span><span class="p">(),</span> + <span class="nb">str</span><span class="p">(</span><span class="n">target</span><span class="p">)[</span><span class="n">start</span><span class="p">:</span><span class="n">end</span><span class="p">]),</span> + <span class="n">seq</span><span class="o">.</span><span class="n">CreateSequence</span><span class="p">(</span><span class="n">template</span><span class="o">.</span><span class="n">name</span><span class="o">.</span><span class="n">strip</span><span class="p">(),</span> + <span class="n">tpl_str</span><span class="p">))</span> + <span class="n">new_aln</span><span class="o">.</span><span class="n">SetSequenceOffset</span><span class="p">(</span><span class="mi">1</span><span class="p">,</span> <span class="n">start</span><span class="p">)</span> + <span class="k">return</span> <span class="n">new_aln</span> + +<div class="viewcode-block" id="PM3ArgumentParser"><a class="viewcode-back" href="../../../core/pm3argparse.html#promod3.core.pm3argparse.PM3ArgumentParser">[docs]</a><span class="k">class</span> <span class="nc">PM3ArgumentParser</span><span class="p">(</span><span class="n">argparse</span><span class="o">.</span><span class="n">ArgumentParser</span><span class="p">):</span> + <span class="sd">"""</span> +<span class="sd"> This class is a child of :class:`argparse.ArgumentParser`. It provides a</span> +<span class="sd"> set of standard arguments which can be activated, rather than added via the</span> +<span class="sd"> traditional way. This helps keeping up a common naming scheme throughout</span> +<span class="sd"> all |project| actions. As a real extension, this subclass provides checking</span> +<span class="sd"> of input parameters on :meth:`Parse`. Beside</span> +<span class="sd"> this, everything you can do with a 'real' :class:`~argparse.ArgumentParser`</span> +<span class="sd"> instance is possible here.</span> + +<span class="sd"> A note on exit codes: if :meth:`~pm3argparse.PM3ArgumentParser.Parse` is</span> +<span class="sd"> called on unrecognised arguments, the script exits with a code 2 by</span> +<span class="sd"> :class:`argparse.ArgumentParser.parse_args()`.</span> + +<span class="sd"> Attributes beyond :class:`argparse.ArgumentParser`:</span> + +<span class="sd"> .. attribute:: action</span> + +<span class="sd"> Indicates if the calling script is a |project| action.</span> + +<span class="sd"> :type: :class:`bool`</span> +<span class="sd"> """</span> +<div class="viewcode-block" id="PM3ArgumentParser.__init__"><a class="viewcode-back" href="../../../core/pm3argparse.html#promod3.core.pm3argparse.PM3ArgumentParser.__init__">[docs]</a> <span class="k">def</span> <span class="nf">__init__</span><span class="p">(</span><span class="bp">self</span><span class="p">,</span> <span class="n">description</span><span class="p">,</span> <span class="n">action</span><span class="o">=</span><span class="bp">True</span><span class="p">):</span> + <span class="sd">"""</span> +<span class="sd"> Create a new instance of :class:`~pm3argparse.PM3ArgumentParser`.</span> + +<span class="sd"> :param description: Help text for this script, handed down to</span> +<span class="sd"> |descattr|_ of |argpinit|_.</span> +<span class="sd"> :type description: :class:`str`</span> + +<span class="sd"> :param action: Indicates if the calling script is a |project| action.</span> +<span class="sd"> This influences |progattr|_ of</span> +<span class="sd"> :class:`~argparse.ArgumentParser` by clipping of the</span> +<span class="sd"> first 3 characters of the file name of the script. If</span> +<span class="sd"> ``False``, default behaviour of</span> +<span class="sd"> :class:`~argparse.ArgumentParser` kicks in.</span> +<span class="sd"> :type action: :class:`bool`</span> + +<span class="sd"> :returns: :class:`argparse.ArgumentParser`.</span> +<span class="sd"> """</span> + <span class="n">prog</span> <span class="o">=</span> <span class="bp">None</span> + <span class="k">if</span> <span class="n">action</span><span class="p">:</span> + <span class="n">prog</span> <span class="o">=</span> <span class="n">os</span><span class="o">.</span><span class="n">path</span><span class="o">.</span><span class="n">basename</span><span class="p">(</span><span class="n">sys</span><span class="o">.</span><span class="n">argv</span><span class="p">[</span><span class="mi">0</span><span class="p">])[</span><span class="mi">3</span><span class="p">:]</span> + <span class="n">argparse</span><span class="o">.</span><span class="n">ArgumentParser</span><span class="o">.</span><span class="n">__init__</span><span class="p">(</span><span class="bp">self</span><span class="p">,</span> <span class="n">prog</span><span class="o">=</span><span class="n">prog</span><span class="p">,</span> + <span class="n">description</span><span class="o">=</span><span class="n">description</span><span class="p">,</span> + <span class="n">formatter_class</span><span class="o">=</span>\ + <span class="n">argparse</span><span class="o">.</span><span class="n">ArgumentDefaultsHelpFormatter</span><span class="p">)</span> + <span class="bp">self</span><span class="o">.</span><span class="n">action</span> <span class="o">=</span> <span class="n">action</span> + <span class="bp">self</span><span class="o">.</span><span class="n">activate</span> <span class="o">=</span> <span class="nb">dict</span><span class="p">()</span> +</div> + <span class="k">def</span> <span class="nf">_print_message</span><span class="p">(</span><span class="bp">self</span><span class="p">,</span> <span class="n">message</span><span class="p">,</span> <span class="nb">file</span><span class="o">=</span><span class="bp">None</span><span class="p">):</span> + <span class="c">#pylint: disable=redefined-builtin</span> + <span class="sd">"""</span> +<span class="sd"> This is like a welcome message to the "country of bad style"... we are</span> +<span class="sd"> overwriting a "_" function from the parent-class. Those guys should not</span> +<span class="sd"> be used outside of the housing module, never... but here it is a single</span> +<span class="sd"> function to bend :mod:`argparse` to use :class:`ost.Logger`.</span> +<span class="sd"> """</span> + <span class="k">if</span> <span class="n">message</span><span class="p">:</span> + <span class="n">no_nl_msg</span> <span class="o">=</span> <span class="n">message</span> + <span class="k">if</span> <span class="n">message</span><span class="p">[</span><span class="o">-</span><span class="mi">1</span><span class="p">]</span> <span class="o">==</span> <span class="s">'</span><span class="se">\n</span><span class="s">'</span><span class="p">:</span> + <span class="n">no_nl_msg</span> <span class="o">=</span> <span class="n">message</span><span class="p">[:</span><span class="o">-</span><span class="mi">1</span><span class="p">]</span> + <span class="k">if</span> <span class="nb">file</span> <span class="ow">is</span> <span class="bp">None</span> <span class="ow">or</span> <span class="nb">file</span> <span class="ow">is</span> <span class="n">sys</span><span class="o">.</span><span class="n">stderr</span><span class="p">:</span> + <span class="n">ost</span><span class="o">.</span><span class="n">LogError</span><span class="p">(</span><span class="n">no_nl_msg</span><span class="p">)</span> + <span class="k">else</span><span class="p">:</span> + <span class="n">ost</span><span class="o">.</span><span class="n">LogScript</span><span class="p">(</span><span class="n">no_nl_msg</span><span class="p">)</span> + +<div class="viewcode-block" id="PM3ArgumentParser.Parse"><a class="viewcode-back" href="../../../core/pm3argparse.html#promod3.core.pm3argparse.PM3ArgumentParser.Parse">[docs]</a> <span class="k">def</span> <span class="nf">Parse</span><span class="p">(</span><span class="bp">self</span><span class="p">,</span> <span class="n">args</span><span class="o">=</span><span class="bp">None</span><span class="p">):</span> + <span class="sd">"""</span> +<span class="sd"> Parse an argument string.</span> + +<span class="sd"> :param args: The argument string. As default |sysargv|_ is used.</span> +<span class="sd"> :type args: :class:`list`</span> + +<span class="sd"> :returns: :class:`promod3.cor.pm3argparse.PM3OptionsNamespace`.</span> +<span class="sd"> """</span> + <span class="n">opts</span> <span class="o">=</span> <span class="n">PM3OptionsNamespace</span><span class="p">()</span> + <span class="bp">self</span><span class="o">.</span><span class="n">parse_args</span><span class="p">(</span><span class="n">args</span><span class="o">=</span><span class="n">args</span><span class="p">,</span> <span class="n">namespace</span><span class="o">=</span><span class="n">opts</span><span class="p">)</span> + + <span class="n">opts</span><span class="o">.</span><span class="n">PostProcess</span><span class="p">(</span><span class="bp">self</span><span class="o">.</span><span class="n">activate</span><span class="o">.</span><span class="n">keys</span><span class="p">())</span> + <span class="k">return</span> <span class="n">opts</span> +</div> +<div class="viewcode-block" id="PM3ArgumentParser.AssembleParser"><a class="viewcode-back" href="../../../core/pm3argparse.html#promod3.core.pm3argparse.PM3ArgumentParser.AssembleParser">[docs]</a> <span class="k">def</span> <span class="nf">AssembleParser</span><span class="p">(</span><span class="bp">self</span><span class="p">):</span> + <span class="sd">"""</span> +<span class="sd"> When adding options via the :meth:`Add*` methods, call this after you</span> +<span class="sd"> are done. Everything before just tells the parser that it should</span> +<span class="sd"> contain those option sets but does not actually add anything.</span> +<span class="sd"> :meth:`AssembleParser` will put everything in place, in the right order</span> +<span class="sd"> and with the right constraints.</span> +<span class="sd"> """</span> + <span class="k">if</span> <span class="s">'ALIGNMENT'</span> <span class="ow">in</span> <span class="bp">self</span><span class="o">.</span><span class="n">activate</span><span class="o">.</span><span class="n">keys</span><span class="p">():</span> + <span class="bp">self</span><span class="o">.</span><span class="n">_AssembleAlignment</span><span class="p">()</span> +</div> +<div class="viewcode-block" id="PM3ArgumentParser.AddAlignment"><a class="viewcode-back" href="../../../core/pm3argparse.html#promod3.core.pm3argparse.PM3ArgumentParser.AddAlignment">[docs]</a> <span class="k">def</span> <span class="nf">AddAlignment</span><span class="p">(</span><span class="bp">self</span><span class="p">):</span> + <span class="sd">"""</span> +<span class="sd"> Add everything needed to load alignments to the argument parser. Creates</span> +<span class="sd"> several options/ arguments and adds some checks for post processing.</span> +<span class="sd"> This method only adds a flag to the parser to add alignment options on</span> +<span class="sd"> :meth:`AssembleParser`. Depending on which options you activate, things</span> +<span class="sd"> need to be added in a different order or have other constraints.</span> + +<span class="sd"> Options/ arguments added:</span> + +<span class="sd"> * ``--fasta trg:<NAME> <FILE>`` - describing a target-template alignment</span> +<span class="sd"> with ``trg:`` marking the target sequence inside :file:`<FILE>`</span> + +<span class="sd"> Exit codes related to alignment input:</span> + +<span class="sd"> * 11 - no prefix ``trg:`` found for an argument to '--fasta'</span> + +<span class="sd"> * 12 - a given alignment file does not exist</span> + +<span class="sd"> * 13 - never raised (parameter for checking gzip files)</span> + +<span class="sd"> * 14 - empty target name found (``trg:``)</span> + +<span class="sd"> * 15 - found an empty alignment file</span> + +<span class="sd"> * 16 - alignment with more than 2 sequences found</span> + +<span class="sd"> * 17 - target sequence name not found in alignment</span> + +<span class="sd"> * 18 - sequences in the alignment have different length</span> + +<span class="sd"> Attributes added to the namespace returned by</span> +<span class="sd"> :meth:`Parse`:</span> + +<span class="sd"> * :attr:`fasta` - filled with the input of the '--fasta' argument, a</span> +<span class="sd"> :class:`list` with multiple :class:`list` objects</span> + +<span class="sd"> * :attr:`alignments` - :class:`ost.AlignmentList`, same order as</span> +<span class="sd"> :attr:`fasta`</span> + +<span class="sd"> * :attr:`aln_sources` - the original source of the alignment, may be</span> +<span class="sd"> filename(s) or a string in JSON format,</span> +<span class="sd"> :class:`list` of all sources</span> +<span class="sd"> """</span> + <span class="bp">self</span><span class="o">.</span><span class="n">activate</span><span class="p">[</span><span class="s">'ALIGNMENT'</span><span class="p">]</span> <span class="o">=</span> <span class="mi">1</span> +</div> + <span class="k">def</span> <span class="nf">_AssembleAlignment</span><span class="p">(</span><span class="bp">self</span><span class="p">):</span> + <span class="sd">"""</span> +<span class="sd"> Actually add alignment arguments/ options</span> +<span class="sd"> """</span> + <span class="c"># FastA input: - always pairwise alignments</span> + <span class="c"># - callable multiple times</span> + <span class="c"># - goes by 'trg:<SEQNAME> <FILE>'</span> + <span class="c"># - excludes JSON file/ object</span> + <span class="c"># - leading whitespaces will be deleted</span> + <span class="bp">self</span><span class="o">.</span><span class="n">add_argument</span><span class="p">(</span><span class="s">'-f'</span><span class="p">,</span> <span class="s">'--fasta'</span><span class="p">,</span> <span class="n">nargs</span><span class="o">=</span><span class="mi">2</span><span class="p">,</span> <span class="n">action</span><span class="o">=</span><span class="s">'append'</span><span class="p">,</span> + <span class="n">metavar</span><span class="o">=</span><span class="p">(</span><span class="s">'trg:<NAME>'</span><span class="p">,</span> <span class="s">'<FILE>'</span><span class="p">),</span> + <span class="n">help</span><span class="o">=</span><span class="s">'Pairwise alignment in FastA format, needs to '</span><span class="o">+</span> + <span class="s">'declare what is the target sequence.'</span><span class="p">)</span> + <span class="c"># input: FastA/ JSON</span> + <span class="c"># determined by extension: if we are wrong, the whole loading fails</span> + <span class="c"># possibility to add JSON: mention limitation!</span> +</div> +<span class="k">class</span> <span class="nc">PM3OptionsNamespace</span><span class="p">(</span><span class="nb">object</span><span class="p">):</span> + <span class="sd">"""</span> +<span class="sd"> This one is mainly for internal use. You can use it like everything that</span> +<span class="sd"> comes out of :meth:`argparse.ArgumentParser.parse_args`. Attributes are</span> +<span class="sd"> added regarding how you assembled your argument parser.</span> +<span class="sd"> """</span> + <span class="k">def</span> <span class="nf">__init__</span><span class="p">(</span><span class="bp">self</span><span class="p">):</span> + <span class="k">pass</span> + + <span class="k">def</span> <span class="nf">PostProcess</span><span class="p">(</span><span class="bp">self</span><span class="p">,</span> <span class="n">activated</span><span class="p">):</span> + <span class="sd">"""</span> +<span class="sd"> Post processing of activated option packs.</span> +<span class="sd"> """</span> + <span class="k">if</span> <span class="s">'ALIGNMENT'</span> <span class="ow">in</span> <span class="n">activated</span><span class="p">:</span> + <span class="bp">self</span><span class="o">.</span><span class="n">_PostProcessAlignment</span><span class="p">()</span> + + <span class="k">def</span> <span class="nf">_PostProcessAlignment</span><span class="p">(</span><span class="bp">self</span><span class="p">):</span> + <span class="c">#pylint: disable=no-member</span> + <span class="c">#pylint: disable=attribute-defined-outside-init</span> + <span class="sd">"""</span> +<span class="sd"> Doing some extra work after parsing.</span> +<span class="sd"> """</span> + <span class="bp">self</span><span class="o">.</span><span class="n">aln_sources</span> <span class="o">=</span> <span class="nb">list</span><span class="p">()</span> + <span class="bp">self</span><span class="o">.</span><span class="n">alignments</span> <span class="o">=</span> <span class="n">seq</span><span class="o">.</span><span class="n">AlignmentList</span><span class="p">()</span> + <span class="k">if</span> <span class="bp">self</span><span class="o">.</span><span class="n">fasta</span><span class="p">:</span> + <span class="k">for</span> <span class="n">src</span> <span class="ow">in</span> <span class="bp">self</span><span class="o">.</span><span class="n">fasta</span><span class="p">:</span> + <span class="k">if</span> <span class="n">src</span><span class="p">[</span><span class="mi">0</span><span class="p">]</span><span class="o">.</span><span class="n">startswith</span><span class="p">(</span><span class="s">'trg:'</span><span class="p">):</span> + <span class="n">trgname</span> <span class="o">=</span> <span class="n">src</span><span class="p">[</span><span class="mi">0</span><span class="p">][</span><span class="mi">4</span><span class="p">:]</span> + <span class="n">seqfile</span> <span class="o">=</span> <span class="n">src</span><span class="p">[</span><span class="mi">1</span><span class="p">]</span> + <span class="k">elif</span> <span class="n">src</span><span class="p">[</span><span class="mi">1</span><span class="p">]</span><span class="o">.</span><span class="n">startswith</span><span class="p">(</span><span class="s">'trg:'</span><span class="p">):</span> + <span class="n">trgname</span> <span class="o">=</span> <span class="n">src</span><span class="p">[</span><span class="mi">1</span><span class="p">][</span><span class="mi">4</span><span class="p">:]</span> + <span class="n">seqfile</span> <span class="o">=</span> <span class="n">src</span><span class="p">[</span><span class="mi">0</span><span class="p">]</span> + <span class="k">else</span><span class="p">:</span> + <span class="n">helper</span><span class="o">.</span><span class="n">MsgErrorAndExit</span><span class="p">(</span><span class="s">"'--fasta' requires one argument "</span><span class="o">+</span> + <span class="s">"prefixed with 'trg:' marking the "</span><span class="o">+</span> + <span class="s">"target sequence name"</span><span class="p">,</span> <span class="mi">11</span><span class="p">)</span> + <span class="k">if</span> <span class="ow">not</span> <span class="nb">len</span><span class="p">(</span><span class="n">trgname</span><span class="p">):</span> + <span class="n">helper</span><span class="o">.</span><span class="n">MsgErrorAndExit</span><span class="p">(</span><span class="s">"'--fasta' requires argument "</span><span class="o">+</span> + <span class="s">"'trg:' defining the "</span><span class="o">+</span> + <span class="s">"target sequence name, empty one "</span><span class="o">+</span> + <span class="s">"found: '</span><span class="si">%s</span><span class="s">'"</span> <span class="o">%</span> <span class="s">' '</span><span class="o">.</span><span class="n">join</span><span class="p">(</span><span class="n">src</span><span class="p">),</span> <span class="mi">14</span><span class="p">)</span> + <span class="n">helper</span><span class="o">.</span><span class="n">FileExists</span><span class="p">(</span><span class="s">"Alignment"</span><span class="p">,</span> <span class="mi">12</span><span class="p">,</span> <span class="n">seqfile</span><span class="p">)</span> + <span class="n">is_gz</span> <span class="o">=</span> <span class="n">helper</span><span class="o">.</span><span class="n">FileGzip</span><span class="p">(</span><span class="s">"Alignment"</span><span class="p">,</span> <span class="mi">13</span><span class="p">,</span> <span class="n">seqfile</span><span class="p">)</span> + <span class="n">readfile</span> <span class="o">=</span> <span class="n">seqfile</span> + <span class="k">if</span> <span class="n">is_gz</span><span class="p">:</span> + <span class="n">zip_fh</span> <span class="o">=</span> <span class="n">gzip</span><span class="o">.</span><span class="n">open</span><span class="p">(</span><span class="n">seqfile</span><span class="p">)</span> + <span class="n">unzip_str</span> <span class="o">=</span> <span class="n">zip_fh</span><span class="o">.</span><span class="n">read</span><span class="p">()</span> + <span class="n">zip_fh</span><span class="o">.</span><span class="n">close</span><span class="p">()</span> + <span class="n">unzip_file</span> <span class="o">=</span> <span class="n">tempfile</span><span class="o">.</span><span class="n">NamedTemporaryFile</span><span class="p">(</span><span class="n">mode</span><span class="o">=</span><span class="s">'w'</span><span class="p">,</span> + <span class="n">suffix</span><span class="o">=</span><span class="s">'.fas'</span><span class="p">)</span> + <span class="n">unzip_file</span><span class="o">.</span><span class="n">write</span><span class="p">(</span><span class="n">unzip_str</span><span class="p">)</span> + <span class="n">unzip_file</span><span class="o">.</span><span class="n">flush</span><span class="p">()</span> + <span class="n">readfile</span> <span class="o">=</span> <span class="n">unzip_file</span><span class="o">.</span><span class="n">name</span> + <span class="k">try</span><span class="p">:</span> + <span class="n">aln</span> <span class="o">=</span> <span class="n">io</span><span class="o">.</span><span class="n">LoadAlignment</span><span class="p">(</span><span class="n">readfile</span><span class="p">,</span> <span class="n">format</span><span class="o">=</span><span class="s">"fasta"</span><span class="p">)</span> + <span class="k">except</span> <span class="ne">Exception</span><span class="p">,</span> <span class="n">exc</span><span class="p">:</span> <span class="c">#pylint: disable=broad-except</span> + <span class="k">if</span> <span class="n">exc</span><span class="o">.</span><span class="n">message</span> <span class="o">==</span> <span class="s">'Bad FASTA file: File is empty'</span><span class="p">:</span> + <span class="n">helper</span><span class="o">.</span><span class="n">MsgErrorAndExit</span><span class="p">(</span><span class="s">"'--fasta' refers to an empty "</span><span class="o">+</span>\ + <span class="s">"file or its in the wrong "</span><span class="o">+</span> + <span class="s">"format: </span><span class="si">%s</span><span class="s">"</span> <span class="o">%</span> <span class="n">seqfile</span><span class="p">,</span> <span class="mi">15</span><span class="p">)</span> + <span class="k">elif</span> <span class="n">exc</span><span class="o">.</span><span class="n">message</span> <span class="o">==</span> <span class="s">'sequences have different lengths'</span><span class="p">:</span> + <span class="n">helper</span><span class="o">.</span><span class="n">MsgErrorAndExit</span><span class="p">(</span><span class="s">"'--fasta </span><span class="si">%s</span><span class="s">': "</span> <span class="o">%</span> <span class="s">' '</span><span class="o">.</span><span class="n">join</span><span class="p">(</span><span class="n">src</span><span class="p">)</span><span class="o">+</span> + <span class="s">"sequences in the alignment "</span><span class="o">+</span> + <span class="s">"have different length."</span><span class="p">,</span> <span class="mi">18</span><span class="p">)</span> + <span class="k">else</span><span class="p">:</span> + <span class="k">raise</span> + <span class="k">finally</span><span class="p">:</span> + <span class="k">if</span> <span class="n">is_gz</span><span class="p">:</span> + <span class="n">unzip_file</span><span class="o">.</span><span class="n">close</span><span class="p">()</span> + <span class="c"># check alignment</span> + <span class="n">nos</span> <span class="o">=</span> <span class="n">aln</span><span class="o">.</span><span class="n">GetCount</span><span class="p">()</span> + <span class="k">if</span> <span class="n">nos</span> <span class="o">></span> <span class="mi">2</span><span class="p">:</span> + <span class="n">helper</span><span class="o">.</span><span class="n">MsgErrorAndExit</span><span class="p">(</span><span class="s">"'--fasta </span><span class="si">%s</span><span class="s">' "</span> <span class="o">%</span> <span class="s">' '</span><span class="o">.</span><span class="n">join</span><span class="p">(</span><span class="n">src</span><span class="p">)</span><span class="o">+</span> + <span class="s">"points to an alignment with "</span><span class="o">+</span> + <span class="s">"more than 2 sequences."</span><span class="p">,</span> <span class="mi">16</span><span class="p">)</span> + <span class="n">fst_seq</span> <span class="o">=</span> <span class="n">aln</span><span class="o">.</span><span class="n">GetSequence</span><span class="p">(</span><span class="mi">0</span><span class="p">)</span> + <span class="n">snd_seq</span> <span class="o">=</span> <span class="n">aln</span><span class="o">.</span><span class="n">GetSequence</span><span class="p">(</span><span class="mi">1</span><span class="p">)</span> + <span class="k">if</span> <span class="n">fst_seq</span><span class="o">.</span><span class="n">name</span><span class="o">.</span><span class="n">strip</span><span class="p">()</span> <span class="o">==</span> <span class="n">trgname</span><span class="p">:</span> + <span class="n">new_aln</span> <span class="o">=</span> <span class="n">_AssembleTrgTplAln</span><span class="p">(</span><span class="n">fst_seq</span><span class="p">,</span> <span class="n">snd_seq</span><span class="p">)</span> + <span class="k">elif</span> <span class="n">snd_seq</span><span class="o">.</span><span class="n">name</span><span class="o">.</span><span class="n">strip</span><span class="p">()</span> <span class="o">==</span> <span class="n">trgname</span><span class="p">:</span> + <span class="n">new_aln</span> <span class="o">=</span> <span class="n">_AssembleTrgTplAln</span><span class="p">(</span><span class="n">snd_seq</span><span class="p">,</span> <span class="n">fst_seq</span><span class="p">)</span> + <span class="k">else</span><span class="p">:</span> + <span class="n">helper</span><span class="o">.</span><span class="n">MsgErrorAndExit</span><span class="p">(</span><span class="s">"'--fasta </span><span class="si">%s</span><span class="s">' "</span> <span class="o">%</span> <span class="s">' '</span><span class="o">.</span><span class="n">join</span><span class="p">(</span><span class="n">src</span><span class="p">)</span><span class="o">+</span> + <span class="s">"does not define a target name "</span><span class="o">+</span> + <span class="s">"found in the alignment."</span><span class="p">,</span> <span class="mi">17</span><span class="p">)</span> + + <span class="bp">self</span><span class="o">.</span><span class="n">alignments</span><span class="o">.</span><span class="n">append</span><span class="p">(</span><span class="n">new_aln</span><span class="p">)</span> + <span class="bp">self</span><span class="o">.</span><span class="n">aln_sources</span><span class="o">.</span><span class="n">append</span><span class="p">(</span><span class="n">seqfile</span><span class="p">)</span> + +<span class="c"># LocalWords: param attr prog argparse ArgumentParser bool sys os init str</span> +<span class="c"># LocalWords: progattr descattr argpinit argv formatter meth args namespace</span> +<span class="c"># LocalWords: ArgumentDefaultsHelpFormatter sysargv AssembleParser fasta io</span> +<span class="c"># LocalWords: metavar trg tpl FastA gzip tempfile ost promod aln stderr src</span> +<span class="c"># LocalWords: AssembleTrgTplAln CreateSequence SetSequenceOffset LogError</span> +<span class="c"># LocalWords: LogScript OptionsNamespace PostProcess AssembleAlignment JSON</span> +<span class="c"># LocalWords: AddAlignment AlignmentList SEQNAME whitespaces nargs trgname</span> +<span class="c"># LocalWords: PostProcessAlignment startswith seqfile elif MsgErrorAndExit</span> +<span class="c"># LocalWords: len FileExists gz FileGzip readfile fh NamedTemporaryFile fas</span> +<span class="c"># LocalWords: LoadAlignment exc GetCount fst GetSequence snd</span> +</pre></div> + + </div> + </div> + </div> + <div class="sphinxsidebar" role="navigation" aria-label="main navigation"> + <div class="sphinxsidebarwrapper"> +<div id="searchbox" style="display: none" role="search"> + <h3>Quick search</h3> + <form class="search" action="../../../search.html" method="get"> + <input type="text" name="q" /> + <input type="submit" value="Go" /> + <input type="hidden" name="check_keywords" value="yes" /> + <input type="hidden" name="area" value="default" /> + </form> + <p class="searchtip" style="font-size: 90%"> + Enter search terms or a module, class or function name. + </p> +</div> +<script type="text/javascript">$('#searchbox').show(0);</script> + </div> + </div> + <div class="clearer"></div> + </div> + <div class="footer"> + ©2015, Bienchen. + + | + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.3</a> + + </div> + + + + + </body> +</html> \ No newline at end of file diff --git a/doc/html/_modules/promod3/rawmodel.html b/doc/html/_modules/promod3/rawmodel.html deleted file mode 100644 index bb31ef7e0325f5f841581be0e7943eb61ec37a49..0000000000000000000000000000000000000000 --- a/doc/html/_modules/promod3/rawmodel.html +++ /dev/null @@ -1,99 +0,0 @@ -<!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" - "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> - - -<html xmlns="http://www.w3.org/1999/xhtml"> - <head> - <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - - <title>promod3.rawmodel — ProMod3 0 documentation</title> - - <link rel="stylesheet" href="../../_static/default.css" type="text/css" /> - <link rel="stylesheet" href="../../_static/pygments.css" type="text/css" /> - - <script type="text/javascript"> - var DOCUMENTATION_OPTIONS = { - URL_ROOT: '../../', - VERSION: '0', - COLLAPSE_INDEX: false, - FILE_SUFFIX: '.html', - HAS_SOURCE: true - }; - </script> - <script type="text/javascript" src="../../_static/jquery.js"></script> - <script type="text/javascript" src="../../_static/underscore.js"></script> - <script type="text/javascript" src="../../_static/doctools.js"></script> - <link rel="top" title="ProMod3 0 documentation" href="../../index.html" /> - <link rel="up" title="promod3" href="../promod3.html" /> - </head> - <body> - <div class="related"> - <h3>Navigation</h3> - <ul> - <li class="right" style="margin-right: 10px"> - <a href="../../genindex.html" title="General Index" - accesskey="I">index</a></li> - <li class="right" > - <a href="../../py-modindex.html" title="Python Module Index" - >modules</a> |</li> - <li><a href="../../index.html">ProMod3 0 documentation</a> »</li> - <li><a href="../index.html" >Module code</a> »</li> - <li><a href="../promod3.html" accesskey="U">promod3</a> »</li> - </ul> - </div> - - <div class="document"> - <div class="documentwrapper"> - <div class="bodywrapper"> - <div class="body"> - - <h1>Source code for promod3.rawmodel</h1><div class="highlight"><pre> -<span class="sd">"""</span> -<span class="sd">Initialise the rawmodel module.</span> -<span class="sd">"""</span> -<span class="kn">from</span> <span class="nn">_rawmodel</span> <span class="kn">import</span> <span class="n">BuildRawModel</span><span class="p">,</span> <span class="n">StructuralGap</span><span class="p">,</span> <span class="n">GapExtender</span> -</pre></div> - - </div> - </div> - </div> - <div class="sphinxsidebar"> - <div class="sphinxsidebarwrapper"> -<div id="searchbox" style="display: none"> - <h3>Quick search</h3> - <form class="search" action="../../search.html" method="get"> - <input type="text" name="q" /> - <input type="submit" value="Go" /> - <input type="hidden" name="check_keywords" value="yes" /> - <input type="hidden" name="area" value="default" /> - </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> -</div> -<script type="text/javascript">$('#searchbox').show(0);</script> - </div> - </div> - <div class="clearer"></div> - </div> - <div class="related"> - <h3>Navigation</h3> - <ul> - <li class="right" style="margin-right: 10px"> - <a href="../../genindex.html" title="General Index" - >index</a></li> - <li class="right" > - <a href="../../py-modindex.html" title="Python Module Index" - >modules</a> |</li> - <li><a href="../../index.html">ProMod3 0 documentation</a> »</li> - <li><a href="../index.html" >Module code</a> »</li> - <li><a href="../promod3.html" >promod3</a> »</li> - </ul> - </div> - <div class="footer"> - © Copyright 2014, Bienchen. - Last updated on Mar 24 17:42, 2015. - Created using <a href="http://sphinx-doc.org/">Sphinx</a> 1.2.3. - </div> - </body> -</html> \ No newline at end of file diff --git a/doc/html/_modules/test_actions.html b/doc/html/_modules/test_actions.html new file mode 100644 index 0000000000000000000000000000000000000000..d4ba959b6bb3ddb3fa7c78a596866caf98cab419 --- /dev/null +++ b/doc/html/_modules/test_actions.html @@ -0,0 +1,219 @@ +<!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" + "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> + + +<html xmlns="http://www.w3.org/1999/xhtml"> + <head> + <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> + + <title>test_actions — ProMod3 0 documentation</title> + + <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> + <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> + + <script type="text/javascript"> + var DOCUMENTATION_OPTIONS = { + URL_ROOT: '../', + VERSION: '0', + COLLAPSE_INDEX: false, + FILE_SUFFIX: '.html', + HAS_SOURCE: true + }; + </script> + <script type="text/javascript" src="../_static/jquery.js"></script> + <script type="text/javascript" src="../_static/underscore.js"></script> + <script type="text/javascript" src="../_static/doctools.js"></script> + <link rel="top" title="ProMod3 0 documentation" href="../index.html" /> + <link rel="up" title="Module code" href="index.html" /> + + + <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9"> + + </head> + <body role="document"> + <div class="related" role="navigation" aria-label="related navigation"> + <h3>Navigation</h3> + <ul> + <li class="right" style="margin-right: 10px"> + <a href="../genindex.html" title="General Index" + accesskey="I">index</a></li> + <li class="right" > + <a href="../py-modindex.html" title="Python Module Index" + >modules</a> |</li> + <li class="nav-item nav-item-0"><a href="../index.html">ProMod3 0 documentation</a> »</li> + <li class="nav-item nav-item-1"><a href="index.html" accesskey="U">Module code</a> »</li> + </ul> + </div> + + <div class="document"> + <div class="documentwrapper"> + <div class="bodywrapper"> + <div class="body" role="main"> + + <h1>Source code for test_actions</h1><div class="highlight"><pre> +<span class="sd">"""</span> +<span class="sd">unittest.TestCase class providing common functionality for testing actions.</span> +<span class="sd">"""</span> +<span class="kn">import</span> <span class="nn">unittest</span> +<span class="kn">import</span> <span class="nn">os</span> +<span class="kn">import</span> <span class="nn">subprocess</span> +<span class="kn">import</span> <span class="nn">ost</span> + +<span class="c"># set verbosity level here, is propagated to all others</span> +<span class="n">ost</span><span class="o">.</span><span class="n">PushVerbosityLevel</span><span class="p">(</span><span class="mi">2</span><span class="p">)</span> + +<div class="viewcode-block" id="ActionTestCase"><a class="viewcode-back" href="../actions/index_dev.html#test_actions.ActionTestCase">[docs]</a><span class="k">class</span> <span class="nc">ActionTestCase</span><span class="p">(</span><span class="n">unittest</span><span class="o">.</span><span class="n">TestCase</span><span class="p">):</span> + <span class="sd">"""</span> +<span class="sd"> Class to help developing actions. Comes with a lot of convenience wrappers</span> +<span class="sd"> around what should be tested and serves as a recorder for test calls...</span> +<span class="sd"> just for in two years when you come back to rewrite the whole action...</span> + +<span class="sd"> While inheriting this class, :attr:`pm_action` needs to be defined.</span> +<span class="sd"> Otherwise the whole idea does not work.</span> + +<span class="sd"> .. attribute:: pm_bin</span> + +<span class="sd"> This is the path of the ``pm`` binary. Automatically set by calling</span> +<span class="sd"> :meth:`~ActionTestCase.__init__` inside the initialisation of your class.</span> + +<span class="sd"> :type: :class:`str`</span> + +<span class="sd"> .. attribute:: pm_action</span> + +<span class="sd"> The action to be tested. Needs to be set by your initialisation routine,</span> +<span class="sd"> **after** calling :meth:`~ActionTestCase.__init__` from here. Skip the</span> +<span class="sd"> "pm-" in front of the action name.</span> + +<span class="sd"> :type: :class:`str`</span> +<span class="sd"> """</span> + <span class="k">def</span> <span class="nf">__init__</span><span class="p">(</span><span class="bp">self</span><span class="p">,</span> <span class="o">*</span><span class="n">args</span><span class="p">,</span> <span class="o">**</span><span class="n">kwargs</span><span class="p">):</span> + <span class="sd">"""</span> +<span class="sd"> Convenience stuff for action testing.</span> +<span class="sd"> """</span> + <span class="c"># Determining the pm binary to be called. Going hard-coded is a bad</span> + <span class="c"># thing. But this is a unit test and we now where we are. Also be</span> + <span class="c"># putting it into the 'setUp' function, we only need to change it once,</span> + <span class="c"># if so. The other idea would be to use a config file which</span> + <span class="n">bld_dir</span> <span class="o">=</span> <span class="n">os</span><span class="o">.</span><span class="n">path</span><span class="o">.</span><span class="n">abspath</span><span class="p">(</span><span class="n">os</span><span class="o">.</span><span class="n">path</span><span class="o">.</span><span class="n">dirname</span><span class="p">(</span><span class="n">os</span><span class="o">.</span><span class="n">path</span><span class="o">.</span><span class="n">dirname</span><span class="p">(</span><span class="n">os</span><span class="o">.</span><span class="n">getcwd</span><span class="p">())))</span> + <span class="bp">self</span><span class="o">.</span><span class="n">pm_bin</span> <span class="o">=</span> <span class="n">os</span><span class="o">.</span><span class="n">path</span><span class="o">.</span><span class="n">join</span><span class="p">(</span><span class="n">bld_dir</span><span class="p">,</span> <span class="s">'stage'</span><span class="p">,</span> <span class="s">'bin'</span><span class="p">,</span> <span class="s">'pm'</span><span class="p">)</span> + <span class="bp">self</span><span class="o">.</span><span class="n">pm_action</span> <span class="o">=</span> <span class="bp">None</span> + <span class="n">unittest</span><span class="o">.</span><span class="n">TestCase</span><span class="o">.</span><span class="n">__init__</span><span class="p">(</span><span class="bp">self</span><span class="p">,</span> <span class="o">*</span><span class="n">args</span><span class="p">,</span> <span class="o">**</span><span class="n">kwargs</span><span class="p">)</span> + +<div class="viewcode-block" id="ActionTestCase.RunAction"><a class="viewcode-back" href="../actions/index_dev.html#test_actions.ActionTestCase.RunAction">[docs]</a> <span class="k">def</span> <span class="nf">RunAction</span><span class="p">(</span><span class="bp">self</span><span class="p">,</span> <span class="n">arguments</span><span class="p">,</span> <span class="n">verbose</span><span class="o">=</span><span class="bp">False</span><span class="p">):</span> + <span class="sd">"""</span> +<span class="sd"> Call an action, return the exit status (``$?`` shell variable). May be</span> +<span class="sd"> set to ``verbose`` to print the actions terminal output. The action to</span> +<span class="sd"> be executed needs to be stored in :attr:`pm_action` first.</span> + +<span class="sd"> If in verbose mode, output to :file:`stdout` of the action will be</span> +<span class="sd"> printed first followed by :file:`stderr`.</span> + +<span class="sd"> :param arguments: A list of arguments for the call.</span> +<span class="sd"> :type arguments: :class:`list`</span> + +<span class="sd"> :param verbose: If ``True``, report output of the action.</span> +<span class="sd"> :type verbose: :class:`bool`</span> + +<span class="sd"> :returns: The exit code of the action (:class:`int`).</span> +<span class="sd"> """</span> + <span class="k">if</span> <span class="ow">not</span> <span class="bp">self</span><span class="o">.</span><span class="n">pm_action</span><span class="p">:</span> + <span class="k">raise</span> <span class="ne">RuntimeError</span><span class="p">(</span><span class="s">"A 'pm_action' attribute has to be defined by "</span><span class="o">+</span> + <span class="s">"each subclass of 'test_actions.ActionTestCase'"</span><span class="p">)</span> + + <span class="c"># run the action with arguments, wait for the job to finish and capture</span> + <span class="c"># output</span> + <span class="n">cmd</span> <span class="o">=</span> <span class="p">[</span><span class="bp">self</span><span class="o">.</span><span class="n">pm_bin</span><span class="p">,</span> <span class="bp">self</span><span class="o">.</span><span class="n">pm_action</span><span class="p">]</span> <span class="o">+</span> <span class="n">arguments</span> + <span class="n">job</span> <span class="o">=</span> <span class="n">subprocess</span><span class="o">.</span><span class="n">Popen</span><span class="p">(</span><span class="n">cmd</span><span class="p">,</span> + <span class="n">stdout</span><span class="o">=</span><span class="n">subprocess</span><span class="o">.</span><span class="n">PIPE</span><span class="p">,</span> <span class="n">stderr</span><span class="o">=</span><span class="n">subprocess</span><span class="o">.</span><span class="n">PIPE</span><span class="p">)</span> + <span class="n">sout</span><span class="p">,</span> <span class="n">serr</span> <span class="o">=</span> <span class="n">job</span><span class="o">.</span><span class="n">communicate</span><span class="p">()</span> + <span class="k">if</span> <span class="n">verbose</span><span class="p">:</span> + <span class="n">ost</span><span class="o">.</span><span class="n">LogScript</span><span class="p">(</span><span class="s">"stdout of '</span><span class="si">%s</span><span class="s">'"</span> <span class="o">%</span> <span class="s">' '</span><span class="o">.</span><span class="n">join</span><span class="p">(</span><span class="n">cmd</span><span class="p">))</span> + <span class="n">ost</span><span class="o">.</span><span class="n">LogScript</span><span class="p">(</span><span class="s">"------"</span><span class="p">)</span> + <span class="n">lines</span> <span class="o">=</span> <span class="n">sout</span><span class="o">.</span><span class="n">splitlines</span><span class="p">()</span> + <span class="k">for</span> <span class="n">out_l</span> <span class="ow">in</span> <span class="n">lines</span><span class="p">:</span> + <span class="n">ost</span><span class="o">.</span><span class="n">LogScript</span><span class="p">(</span><span class="n">out_l</span><span class="p">)</span> + <span class="n">ost</span><span class="o">.</span><span class="n">LogScript</span><span class="p">(</span><span class="s">"------"</span><span class="p">)</span> + <span class="n">ost</span><span class="o">.</span><span class="n">LogError</span><span class="p">(</span><span class="s">"stderr of '</span><span class="si">%s</span><span class="s">'"</span> <span class="o">%</span> <span class="s">' '</span><span class="o">.</span><span class="n">join</span><span class="p">(</span><span class="n">cmd</span><span class="p">))</span> + <span class="n">ost</span><span class="o">.</span><span class="n">LogError</span><span class="p">(</span><span class="s">"------"</span><span class="p">)</span> + <span class="n">lines</span> <span class="o">=</span> <span class="n">serr</span><span class="o">.</span><span class="n">splitlines</span><span class="p">()</span> + <span class="k">for</span> <span class="n">err_l</span> <span class="ow">in</span> <span class="n">lines</span><span class="p">:</span> + <span class="n">ost</span><span class="o">.</span><span class="n">LogError</span><span class="p">(</span><span class="n">err_l</span><span class="p">)</span> + <span class="n">ost</span><span class="o">.</span><span class="n">LogError</span><span class="p">(</span><span class="s">"------"</span><span class="p">)</span> + <span class="k">return</span> <span class="n">job</span><span class="o">.</span><span class="n">returncode</span> +</div> +<div class="viewcode-block" id="ActionTestCase.RunExitStatusTest"><a class="viewcode-back" href="../actions/index_dev.html#test_actions.ActionTestCase.RunExitStatusTest">[docs]</a> <span class="k">def</span> <span class="nf">RunExitStatusTest</span><span class="p">(</span><span class="bp">self</span><span class="p">,</span> <span class="n">exit_code</span><span class="p">,</span> <span class="n">arguments</span><span class="p">,</span> <span class="n">verbose</span><span class="o">=</span><span class="bp">False</span><span class="p">):</span> + <span class="sd">"""</span> +<span class="sd"> Run the action with given arguments and check the exit code.</span> + +<span class="sd"> :param exit_code: The expected return code, ``$?`` in a shell.</span> +<span class="sd"> :type exit_code: :class:`int`</span> + +<span class="sd"> :param arguments: A list of arguments for the call.</span> +<span class="sd"> :type arguments: :class:`list`</span> + +<span class="sd"> :param verbose: If ``True``, report output of the action.</span> +<span class="sd"> :type verbose: :class:`bool`</span> +<span class="sd"> """</span> + <span class="n">exit_code_run</span> <span class="o">=</span> <span class="bp">self</span><span class="o">.</span><span class="n">RunAction</span><span class="p">(</span><span class="n">arguments</span><span class="p">,</span> <span class="n">verbose</span><span class="o">=</span><span class="n">verbose</span><span class="p">)</span> + <span class="bp">self</span><span class="o">.</span><span class="n">assertEqual</span><span class="p">(</span><span class="n">exit_code</span><span class="p">,</span> <span class="n">exit_code_run</span><span class="p">,</span> + <span class="n">msg</span><span class="o">=</span><span class="s">"Exit code of '</span><span class="si">%s</span><span class="s">' "</span> <span class="o">%</span> <span class="s">' '</span><span class="o">.</span><span class="n">join</span><span class="p">([</span><span class="bp">self</span><span class="o">.</span><span class="n">pm_bin</span><span class="p">,</span> + <span class="bp">self</span><span class="o">.</span><span class="n">pm_action</span><span class="p">]</span><span class="o">+</span> + <span class="n">arguments</span><span class="p">)</span><span class="o">+</span> + <span class="s">"is supposed to be '</span><span class="si">%d</span><span class="s">' "</span> <span class="o">%</span> <span class="n">exit_code</span><span class="o">+</span> + <span class="s">"but returned as '</span><span class="si">%d</span><span class="s">'."</span> <span class="o">%</span> <span class="n">exit_code_run</span><span class="p">)</span> +</div> +<div class="viewcode-block" id="ActionTestCase.testPMExists"><a class="viewcode-back" href="../actions/index_dev.html#test_actions.ActionTestCase.testPMExists">[docs]</a> <span class="k">def</span> <span class="nf">testPMExists</span><span class="p">(</span><span class="bp">self</span><span class="p">):</span> + <span class="sd">"""</span> +<span class="sd"> This is an internal test, executed when the source code of the test</span> +<span class="sd"> class is run as unit test. Verifies that :attr:`pm_bin` is an existing</span> +<span class="sd"> file (also complains if a directory is found instead).</span> +<span class="sd"> """</span> + <span class="bp">self</span><span class="o">.</span><span class="n">assertEqual</span><span class="p">(</span><span class="n">os</span><span class="o">.</span><span class="n">path</span><span class="o">.</span><span class="n">isfile</span><span class="p">(</span><span class="bp">self</span><span class="o">.</span><span class="n">pm_bin</span><span class="p">),</span> <span class="bp">True</span><span class="p">,</span> + <span class="n">msg</span><span class="o">=</span><span class="s">"Could not find 'pm' bin at '</span><span class="si">%s</span><span class="s">', "</span> <span class="o">%</span> <span class="bp">self</span><span class="o">.</span><span class="n">pm_bin</span><span class="o">+</span> + <span class="s">"cannot proceed unit tests."</span><span class="p">)</span> +</div></div> +<span class="k">if</span> <span class="n">__name__</span> <span class="o">==</span> <span class="s">"__main__"</span><span class="p">:</span> + <span class="kn">import</span> <span class="nn">sys</span> + <span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">testutils</span> + <span class="n">sys</span><span class="o">.</span><span class="n">dont_write_bytecode</span> <span class="o">=</span> <span class="bp">True</span> + <span class="n">testutils</span><span class="o">.</span><span class="n">RunTests</span><span class="p">()</span> + +<span class="c"># LocalWords: attr meth ActionTestCase init str stdout stderr param bool</span> +</pre></div> + + </div> + </div> + </div> + <div class="sphinxsidebar" role="navigation" aria-label="main navigation"> + <div class="sphinxsidebarwrapper"> +<div id="searchbox" style="display: none" role="search"> + <h3>Quick search</h3> + <form class="search" action="../search.html" method="get"> + <input type="text" name="q" /> + <input type="submit" value="Go" /> + <input type="hidden" name="check_keywords" value="yes" /> + <input type="hidden" name="area" value="default" /> + </form> + <p class="searchtip" style="font-size: 90%"> + Enter search terms or a module, class or function name. + </p> +</div> +<script type="text/javascript">$('#searchbox').show(0);</script> + </div> + </div> + <div class="clearer"></div> + </div> + <div class="footer"> + ©2015, Bienchen. + + | + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.3</a> + + </div> + + + + + </body> +</html> \ No newline at end of file diff --git a/doc/html/_sources/actions/index_dev.txt b/doc/html/_sources/actions/index_dev.txt new file mode 100644 index 0000000000000000000000000000000000000000..8594a9dd4480a51680093fbc15db84995fc9d2ef --- /dev/null +++ b/doc/html/_sources/actions/index_dev.txt @@ -0,0 +1,365 @@ +:mod:`test_actions.ActionTestCase` - Testing Actions +================================================================================ + +.. module:: test_actions + +.. currentmodule:: test_actions + +This module is **not** part of the |project| binary distribution. That is the +productive bit running to produce models. It is only part of the source +distribution intended to help developing |project|. Basically it supports you +creating new actions along immediate tests, which will be stored as unit tests +and stay available to monitor later changes. + +.. note:: + + A couple of different paths will be mentioned in the following. To make + things easier to tell apart, a prefix :file:`<SOURCE>` refers to the code + repository, :file:`<BUILD>` to the build directory tree. + +Inside the development environment, the module is only available to unit tests +in the :file:`<SOURCE>/actions/tests` directory. There is one special thing +about using it in your tests for an action, emerging from the way ``make`` runs +unit tests as set up via |cmake|. |python| modules are imported from the source +directory, here this is :file:`<SOURCE>/actions/tests`, while the tests run +inside :file:`<BUILD>/tests`, here this is :file:`<BUILD>/tests/actions`. When +|python| imports a module, its usually compiled into bytecode. This new file +would clutter up the source repository, it would always show up as untracked +file on ``git status``. To prevent this, tell |python| to stop producing +bytecode right at the beginning of your test-script: + +.. testcode:: nobytecode + :hide: + + import sys + sys.dont_write_bytecode = True + +.. code-block:: python + :emphasize-lines: 5 + :linenos: + + import sys + + # this is needed so there will be no test_actions.pyc created in the source + # directory + sys.dont_write_bytecode = True + +Line 5 does the trick. This needs to be set by you in every action unit test +file since |python| only recognises it **before** the module is imported. +Otherwise a module could disable bytecoding for all other modules loaded. + +Testing actions, basically those are commands run in a shell, is very similar +across various actions. Additionally, there are some things that should be +tested for all actions like exit codes. That is why this module exists. + +When developing an action, you will try it in the shell during the process. You +have to check that its doing what you intend, that it delivers the right +output, that it just behaves right on various kinds of input. This module +supports you by providing functionality to run scripts out of |python|. The +goal is to not trigger test runs manually in a shell but have a script that +does it for you. From there, you do not need to remember all the calls you +punched into the command line a year ago, when you come back to change +something, add new functionality, etc.. + +-------------------------------------------------------------------------------- +Creating an Action Unit Test Script +-------------------------------------------------------------------------------- +In the next couple of paragraphs, we will walk through setting up a new unit +test script for an imaginary action. We will continuously extend the file +started above, so keep an eye on line numbers. Lets just assume your action is +called ``do-awesome`` for the rest of this section. + +The Test Script +-------------------------------------------------------------------------------- +The script to supervise your action needs to be placed in +:file:`<SOURCE>/actions/tests` and follow the naming convention +:file:`test_action_<NAME>.py`, where :file:`<NAME>` is the name for your +action. So here we create a file :file:`test_action_do_awesome.py` (recognise +the underscore between ``do`` and ``awesome`` instead of a hyphen, that's +|pep8|_). + +.. code-block:: console + + $ touch <SOURCE>/actions/tests/test_action_do_awesome.py + $ + +As a starter, we disable bytecode compilation in the script: + +.. testsetup:: actiontest + :hide: + + import sys + sys.dont_write_bytecode = True + +.. code-block:: python + :linenos: + + import sys + + # this is needed so there will be no test_actions.pyc created in the source + # directory + sys.dont_write_bytecode = True + +|cmake| Integration +-------------------------------------------------------------------------------- +As always, when introducing new material to |project|, it has to be announced +to the |cmake| build system. For action unit tests, fire up +:file:`<SOURCE>/actions/tests/CMakeLists.txt` in your favourite text editor and +add your new script: + +.. code-block:: cmake + :emphasize-lines: 3 + :linenos: + + set(ACTION_UNIT_TESTS + test_action_help.py + test_action_do_awesome.py + test_actions.py # leave this as last item so it will be executed first! + ) + + promod3_unittest(MODULE actions SOURCES "${ACTION_UNIT_TESTS}" TARGET actions) + +The important thing is to leave :file:`test_actions.py` as last item in the +list. This script contains the tests around the +:class:`test_actions.ActionTestCase` class, which is the foundation of the +tests for your action. If this class is broken, we are lost. Putting it as the +last element in the list, |cmake| will execute this script first, before any +other action test script is run. + +Creating a Test Subclass +-------------------------------------------------------------------------------- +:class:`test_actions.ActionTestCase` is sort of a template class for your +tests. By spawning off from this you inherit a bunch of useful methods for your +testing. To make it work, the childclass needs to be set up properly. But +first, :file:`test_actions.py` has to be loaded as a module: + +.. testcode:: actiontest + :hide: + + import test_actions + +.. code-block:: python + :linenos: + :lineno-start: 6 + + import test_actions + +Now create the childclass for your action. Go for :class:`<NAME>ActionTests` as +a naming scheme: + +.. testcode:: actiontest + :hide: + + class DoAwesomeActionTests(test_actions.ActionTestCase): + def __init__(self, *args, **kwargs): + test_actions.ActionTestCase.__init__(self, *args, **kwargs) + self.pm_action = 'do-awesome' + +.. code-block:: python + :linenos: + :lineno-start: 7 + + class DoAwesomeActionTests(test_actions.ActionTestCase): + def __init__(self, *args, **kwargs): + test_actions.ActionTestCase.__init__(self, *args, **kwargs) + self.pm_action = 'do-awesome' + +Pay attention that in your own class, you must set :attr:`pm_action` to make +everything work. Also :meth:`__init__` needs certain parameters, as everything +is derived from the :class:`unittest.TestCase` class. + +Must Have Tests +-------------------------------------------------------------------------------- +What needs testing without exclusion are the exit codes of actions. Those +states will be placed in the userlevel documentation. This topic is already +covered in :class:`test_actions.ActionTestCase` by :meth:`RunExitStatusTest`. +As an example, testing for ``$?=0`` could work like this: + +.. testcode:: actiontest + :hide: + + class DoAwesomeActionTests(test_actions.ActionTestCase): + def __init__(self, *args, **kwargs): + test_actions.ActionTestCase.__init__(self, *args, **kwargs) + self.pm_action = 'do-awesome' + + def testExit0(self): + self.RunExitStatusTest(0, list()) + +.. code-block:: python + :linenos: + :lineno-start: 11 + + def testExit0(self): + self.RunExitStatusTest(0, list()) + +That will call the action stored in :attr:`pm_action` with the provided list of +parameters and check that ``0`` is returned on the command line. + +In a more general way, you need to test that your action is working as +intended. Do not forget some negative testing, with the idea in mind what +happens if a user throws dirty input data in. + +Making the Script Executable +-------------------------------------------------------------------------------- +In |project|, unit tests are run via |ost_s|_ and |python|'s +:class:`unittest.TestCase`. Those are called when the test module is executed +as a script: + +.. testcode:: actiontest + :hide: + + import unittest + + class DoAwesomeActionTests(test_actions.ActionTestCase): + def __init__(self, *args, **kwargs): + test_actions.ActionTestCase.__init__(self, *args, **kwargs) + self.pm_bin = os.path.join(os.getcwd(), os.pardir, 'stage', 'bin', + 'pm') + self.pm_action = 'help' + + def testExit0(self): + self.RunExitStatusTest(0, list()) + + if __name__ == "__builtin__": + import os + suite = unittest.TestLoader().loadTestsFromTestCase(DoAwesomeActionTests) + unittest.TextTestRunner().run(suite) + +.. code-block:: python + :linenos: + :lineno-start: 13 + + if __name__ == "__main__": + from ost import testutils + testutils.RunTests() + +These three lines should be the same for all unit tests. + +Running the Test Script +-------------------------------------------------------------------------------- +Unit tests are executed via ``make check`` and so are |project| action tests. +But for every test script, we also provide a private ``make`` target, ending +with :file:`_run`. To solely run the tests for the awesome action, hit + +.. code-block:: console + + $ make test_action_do_awesome.py_run + +Output Of :class:`test_actions.ActionTestCase` +-------------------------------------------------------------------------------- +When running the test script you will notice that its not really talkative. +Basically you do not see output to :file:`stdout`/ :file:`stderr` of your +action, while the test script fires it a couple of times. That is by design. +When running the full unit test suite, usually nobody wants to see the output +of **everything** tested and working. The interesting bits are where we fail. +But for developing a new application you certainly need all the output you can +get. For this, some functions in :class:`test_actions.ActionTestCase` have a +parameter :attr:`verbose`. That triggers specific functions to flush captured +output onto the command line. The idea is to turn it on for development, but +once done, disable it to keep output of unit tests low. + +To get the test for exit code ``0`` talking to you, just do + +.. testcode:: actiontest + :hide: + + import unittest + + class DoAwesomeActionTests(test_actions.ActionTestCase): + def __init__(self, *args, **kwargs): + test_actions.ActionTestCase.__init__(self, *args, **kwargs) + self.pm_bin = os.path.join(os.getcwd(), os.pardir, 'stage', 'bin', + 'pm') + self.pm_action = 'help' + + def testExit0(self): + self.RunExitStatusTest(0, list(), verbose=True) + + if __name__ == "__builtin__": + import os + suite = unittest.TestLoader().loadTestsFromTestCase(DoAwesomeActionTests) + unittest.TextTestRunner().run(suite) + +.. testoutput:: actiontest + :hide: + :options: +NORMALIZE_WHITESPACE +ELLIPSIS + + stdout of '.../doc/../stage/bin/pm help' + ------ + Following actions are available: + build-rawmodel + help + Each action should respond to "--help". + ------ + stderr of '.../doc/../stage/bin/pm help' + ------ + ------ + +.. code-block:: python + :linenos: + :lineno-start: 11 + + def testExit0(self): + self.RunExitStatusTest(0, list(), verbose=True) + +and + +.. testcode:: actiontest + :hide: + + import unittest + + class DoAwesomeActionTests(test_actions.ActionTestCase): + def __init__(self, *args, **kwargs): + test_actions.ActionTestCase.__init__(self, *args, **kwargs) + self.pm_bin = os.path.join(os.getcwd(), os.pardir, 'stage', 'bin', + 'pm') + self.pm_action = 'help' + + def testExit0(self): + self.RunExitStatusTest(0, list()) + + if __name__ == "__builtin__": + import os + suite = unittest.TestLoader().loadTestsFromTestCase(DoAwesomeActionTests) + unittest.TextTestRunner().run(suite) + +.. code-block:: python + :linenos: + :lineno-start: 11 + + def testExit0(self): + self.RunExitStatusTest(0, list()) + +keeps it silent (:attr:`verbose` is set to ``False`` by default). If enabled, +output will be separated into :file:`stdout` and :file:`stderr`: + +.. code-block:: console + + $ make test_action_do_awesome.py_run + <Lots of output from the build process> + [100%] running checks test_action_do_awesome.py + stdout of '<BUILD>/stage/bin/pm do-awesome' + ------ + <Output to stdout> + ------ + stderr of '<BUILD>/stage/bin/pm do-awesome' + ------ + <Output to stderr> + ------ + +-------------------------------------------------------------------------------- +Unit Test Actions API +-------------------------------------------------------------------------------- + +.. autoclass:: test_actions.ActionTestCase + :members: + +.. LocalWords: ActionTestCase currentmodule cmake bytecode emphasize sys py +.. LocalWords: linenos pyc dont promod unittest childclass lineno init args +.. LocalWords: ActionTests DoAwesomeActionTests kwargs attr meth TestCase +.. LocalWords: userlevel RunExitStatusTest testExit ost testutils RunTests +.. LocalWords: stdout stderr testcode nobytecode testsetup actiontest os +.. LocalWords: getcwd pardir builtin testoutput NORMALIZE WHITESPACE API +.. LocalWords: rawmodel autoclass diff --git a/doc/html/_sources/changelog.txt b/doc/html/_sources/changelog.txt index d0336bb6c605f6eef99d72f5a79aa195e1731ba1..9c9ba86de73c69b98b8e46e93abced278a4a3f8a 100644 --- a/doc/html/_sources/changelog.txt +++ b/doc/html/_sources/changelog.txt @@ -16,4 +16,8 @@ Changes in Release 0.2 * added html documentation to repository * meld renamed to rawmodel +Changes in Release 0.3 (to be released) +------------------------------------------------------------------------------- + * merged argcheck into the helper module + .. LocalWords: Changelog reStructuredText changelog txt diff --git a/doc/html/_sources/cmake/index.txt b/doc/html/_sources/cmake/index.txt index 368f4b1c8656de76896f27a6ff0e509add08ae03..ea65a5c067d967303f0b7707915b48f695c69290 100644 --- a/doc/html/_sources/cmake/index.txt +++ b/doc/html/_sources/cmake/index.txt @@ -57,7 +57,7 @@ Unit Tests needs to be a single word. Ends up in ``make help`` as a prefix, nothing will break if it does not match the name of any existing module. - ``Sources`` + ``SOURCES`` Describe a set of files hosting unit test code here. If its a wild mix of |C++| and |python| files does not matter, |cmake| will sort this out for you. But the programming language makes a difference for the ``make`` @@ -79,7 +79,59 @@ Unit Tests build directory. ``TARGET`` - This defines an additional dependency for the unit test. + This defines an additional dependency for the unit test. That is, before + running this unit test, this target will be built. + +Documentation +^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ +.. cmake:command:: add_doc_source + + .. code-block:: cmake + + add_doc_source(NAME name + RST rst1 [rst2...]) + + Add reStructuredText sources for the doc build system. This is most preferable + used in :file:`doc` directories for keeping the documentation sorted per + module. This does not create any ``make`` targets. Lists filled here will all + be evaluated in the :file:`doc/CMakeLists.txt` of the repository root. + + The parameters are: + + ``NAME`` + Specify the name of the module this branch of documentation belongs to. + Needs to be set, needs to be a single word. Using module names is best + practice, while nothing will break if it does not refer to an existing one. + You will find a directory in :file:`doc/source` with that name in the build + root. + + ``RST`` + Describe a set of files containing the documentation. Feed it a single file + name or a |cmake| list. + +.. cmake:command:: add_doc_dependency + + .. code-block:: cmake + + add_doc_source(NAME name + DEP dependency1 [dependency2...]) + + Add a dependency to the doc build system. For an existing name, add some + dependencies when it comes to building documentation. Mostly for internal use. + + The parameters are: + + ``NAME`` + Specify a name the dependencies belong to. This name needs to be already + known in the doc build system. Names of |python| modules are good, otherwise + names introduced by :cmake:command:`add_doc_source` work well. Dependencies + will be create for all reStructuredText files listed by + :cmake:command:`add_doc_source` under this name and for all ``make`` + targets related to the documentation. + + ``DEP`` + Hand over a dependency here or a |cmake| list. Files work, if given with + absolute path. Actions ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ @@ -99,8 +151,9 @@ Actions The parameters are: ``ACTION`` - Name of the action to be added. Should start with ``pm-``. Needs to be an - existing file in the same directory as the invoking :file:`CMakeLists.txt`. + Name of the action to be added. Should start with :file:`pm-`. Needs to be + an existing file in the same directory as the invoking + :file:`CMakeLists.txt`. ``TARGET`` Provide a ``make`` target to trigger copying the action's script file. The @@ -113,4 +166,4 @@ Actions .. ----------------- .. LocalWords: cmake PROMOD CMakeLists txt promod unittest codetest xml py -.. LocalWords: libexec +.. LocalWords: libexec reStructuredText RST subtree rst DEP diff --git a/doc/html/_sources/contributing.txt b/doc/html/_sources/contributing.txt index e2f9ce22d0ac7275956500c542c40215c7239088..f9cdb6d7d62a2cd76625bc5d8a661341d49c10e3 100644 --- a/doc/html/_sources/contributing.txt +++ b/doc/html/_sources/contributing.txt @@ -270,6 +270,8 @@ http://sphinx-doc.org/markup/inline.html If you write new functionality for |project|, or fix bugs, feel free to extend the Changelog. It will be automatically pulled into the documentation. +.. _how-to-start-your-own-module: + -------------------------------------------------------------------------------- How To Start Your Own Module -------------------------------------------------------------------------------- @@ -641,6 +643,142 @@ you. Now tests should be available by ``make check``, ``make codetest`` and ``make test_something.py_run``. +-------------------------------------------------------------------------------- +How To Start Your Own Action +-------------------------------------------------------------------------------- +In |project| we call scripts/ programs 'actions'. They are started by a +launcher found in your staging directory at :file:`stage/bin/pm`. This little +guy helps keeping the shell environment in the right mood to carry out your +job. So usually you will start an action by + +.. code-block:: console + + $ stage/bin/pm help + +To start your own action, follow :ref:`how-to-start-your-own-module` until +creating a directory structure for a new module. Also **do** go for a dedicated +branch for action-development. There you can produce intermediate commits while +other branches stay clean in case you have to do some work there which needs to +get public. + +After preparing your repository its time to create a file for the action. That +is a bit different than for modules. Assuming we are sitting in the +repository's root: + +.. code-block:: console + + $ touch action/pm-awesome-action + $ chmod +x action/pm-awesome-action + +Two things are important here: actions are prefixed with :file:`pm-`, so they +are recognised by the :file:`pm` launcher. Secondly, action files need to be +executable, which does not propagate if you do it **after** the first call to +``make``. + +To get the new action recognised by ``make`` to be placed in +:file:`stage/libexec/promod3`, it has to be registered with |cmake| in +:file:`actions/CMakeLists.txt`: + +.. code-block:: cmake + :linenos: + + add_custom_target(actions ALL) + add_subdirectory(tests) + + pm_action_init() + pm_action(pm-build-rawmodel actions) + pm_action(pm-help actions) + pm_action(pm-awesome-action actions) + +Just add your action with its full filename with a call to +:cmake:command:`pm_action` at the end of the file. + +Before coding your action, lets set up unit tests for it. Usually when adding +features, you will immediately try them, check that everything works as +intended, etc.. |project| helps you automatising those tests so its rather easy +to check later, if code changes break anything. Start with a file +:file:`actions/tests/test_action_awesome.py`: + +.. testcode:: contribute_action + :hide: + + import sys + sys.dont_write_bytecode = True + + import test_actions + import unittest + + class DoAwesomeActionTests(test_actions.ActionTestCase): + def __init__(self, *args, **kwargs): + test_actions.ActionTestCase.__init__(self, *args, **kwargs) + self.pm_bin = os.path.join(os.getcwd(), os.pardir, 'stage', 'bin', + 'pm') + self.pm_action = 'help' + + def testExit0(self): + self.RunExitStatusTest(0, list()) + + if __name__ == "__builtin__": + import os + suite = unittest.TestLoader().loadTestsFromTestCase(DoAwesomeActionTests) + unittest.TextTestRunner().run(suite) + +.. code-block:: python + :linenos: + + import sys + + # this is needed so there will be no test_actions.pyc created in the source + # directory + sys.dont_write_bytecode = True + + import test_actions + + class AwesomeActionTests(test_actions.ActionTestCase): + def __init__(self, *args, **kwargs): + test_actions.ActionTestCase.__init__(self, *args, **kwargs) + self.pm_action = 'awesome' + + def testExit0(self): + self.RunExitStatusTest(0, list()) + + if __name__ == "__main__": + from ost import testutils + testutils.RunTests() + +Please note that for actions we are using +:class:`test_actions.ActionTestCase <test_actions>` instead of +:class:`unittest.TestCase`. Since testing has a lot in common for different +actions, we decided to put up a little wrapper around this subject. See the +documentation of :class:`ActionTestCase <test_actions>` for more information. + +Now its time to fill your action with code. Instead of reading a lot more of +explanations, it should be easy to go by examples from the :file:`actions` +directory. There are only two really important points: + +* No shebang line (``#! /usr/bin/python``) in your action! Also no + ``#! /usr/bin/env python`` or anything like this. This may lead to funny side + effects, like calling a |python| interpreter from outside a virtual + environment or a different version |ost_s|. Basically it may mess up the + environment your action is running in. Actions are called by :file:`pm`, + that's enough to get everything just right. + +* The action of your action happens in the |mainattr|_ branch of the script. + Your action will have own function definitions, variables and all the bells + and whistles. Hiding behind |mainattr|_ keeps everything separated and makes + things easier when it gets to debugging. So just after + + .. code-block:: python + + import alot + + def functions_specific_to_your_action(...): + + if __name__ == "__main__": + <put together what your action should do here> + + start putting your action together. + -------------------------------------------------------------------------------- Third Party Contributions (License Issues) -------------------------------------------------------------------------------- @@ -675,10 +813,9 @@ contributions to web pages using |project|. .. |fedora| replace:: Fedora .. |nameattr| replace:: :attr:`__name__` +.. |mainattr| replace:: :attr:`__main__` .. |pylint| replace:: Pylint .. _pylint: http://www.pylint.org -.. |pep8| replace:: PEP 8 -.. _pep8: https://www.python.org/dev/peps/pep-0008/ .. LocalWords: cmake hotfix doctest linkcheck rebase BRANCHNAME rebasing py .. LocalWords: CMakeLists txt rst pymod init submodule src restructuredtext .. LocalWords: makefiles formatters Changelog codetest promod sidechains io @@ -687,6 +824,8 @@ contributions to web pages using |project|. .. LocalWords: changelog Optimized DOPTIMIZE gitignore cd conf subtree attr .. LocalWords: unittest TestCase nameattr testcode staticmethod builtin cp .. LocalWords: SomethingTests testFileExistsFalse testutils RunTests DQMEAN -.. LocalWords: pre API inline CMake hh ProMod Bienchen OST OPENSTRUCTURE +.. LocalWords: pre API inline CMake hh ProMod Bienchen OST OPENSTRUCTURE os .. LocalWords: mol alg conop QMEAN KIC eigen eigenvectors Lapack rawmodel -.. LocalWords: OpenStructure ost pylint +.. LocalWords: OpenStructure ost pylint chmod sys pyc dont bytecode args +.. LocalWords: AwesomeActionTests ActionTestCase kwargs testExit getcwd +.. LocalWords: RunExitStatusTest DoAwesomeActionTests pardir mainattr alot diff --git a/doc/html/_sources/core/argcheck.txt b/doc/html/_sources/core/argcheck.txt deleted file mode 100644 index 53f517f1c77a98f14edaf19f8065563c194a8ed4..0000000000000000000000000000000000000000 --- a/doc/html/_sources/core/argcheck.txt +++ /dev/null @@ -1,66 +0,0 @@ -:mod:`~promod3.core.argcheck` - Standard Tests For Command Line Arguments -================================================================================ - -.. currentmodule:: promod3.core.argcheck - -Introduction --------------------------------------------------------------------------------- - -For parsing command line arguments - -:py_docs:`optional <howto/argparse.html#introducing-optional-arguments>` and -:py_docs:`positional <howto/argparse.html#introducing-positional-arguments>` - -|project| tools should utilise Pythons own -:py_docs:`argparse <library/argparse.html>` module. While this comes with a lot -of functionality to fetch values from the command line comfortably, it has no -means in checking/ verifying input. Some of the most common tests are covered -here. All tests are designed to exit a script on failure. - -.. testcode:: argcheck - :hide: - - import os - import argparse - import tempfile - from promod3.core import argcheck - - (fh, fn) = tempfile.mkstemp(suffix='.pdb') - os.close(fh) - - p = argparse.ArgumentParser() - p.add_argument('file', type=str) - opts = p.parse_args([fn]) - - argcheck.FileExists('Test file', 1, opts.file) - - opts.name, opts.ext, opts.gz = argcheck.FileExtension('Test file', 2, - opts.file, - ('pdb', 'mmcif'), - gz=True) - - os.remove(fn) - -.. doctest:: argcheck - - import argparse - from promod3.core import argcheck - - p = argparse.ArgumentParser() - p.add_argument('file', type=str) - opts = p.parse_args() - - argcheck.FileExists('Test file', 1, opts.file) - - opts.name, opts.ext, opts.gz = argcheck.FileExtension('Test file', 2, - opts.file, - ('pdb', 'mmcif'), - gz=True) - - -File Tests --------------------------------------------------------------------------------- - -.. autofunction:: FileExists - -.. autofunction:: FileExtension - -.. LocalWords: currentmodule py howto argparse diff --git a/doc/html/_sources/core/helper.txt b/doc/html/_sources/core/helper.txt index 3d9413f97bc22b455aca6a9bf7f9dd45a22bf19e..93ea65eba08e08234f2080564a8f113ab107dc71 100644 --- a/doc/html/_sources/core/helper.txt +++ b/doc/html/_sources/core/helper.txt @@ -39,3 +39,52 @@ Messages .. autofunction:: MsgErrorAndExit +File Tests +-------------------------------------------------------------------------------- + +.. testcode:: helper + :hide: + + import os + import tempfile + from promod3.core import helper + from promod3.core import pm3argparse + + (fh, fn) = tempfile.mkstemp(suffix='.pdb') + os.close(fh) + + p = pm3argparse.PM3ArgumentParser('Dummy') + p.add_argument('file', type=str) + opts = p.Parse([fn]) + + helper.FileExists('Test file', 1, opts.file) + + opts.name, opts.ext, opts.gz = helper.FileExtension('Test file', 2, + opts.file, + ('pdb', 'mmcif'), + gzip=True) + + os.remove(fn) + +.. doctest:: helper + + from promod3.core import helper + from promod3.core import pm3argparse + + p = pm3argparse.PM3ArgumentParser(__doc__) + p.add_argument('file', type=str) + opts = p.Parse() + + helper.FileExists('Test file', 1, opts.file) + + opts.name, opts.ext, opts.gz = helper.FileExtension('Test file', 2, + opts.file, + ('pdb', 'mmcif'), + gzip=True) + + +.. autofunction:: FileExists + +.. autofunction:: FileExtension + +.. autofunction:: FileGzip diff --git a/doc/html/_sources/core/index.txt b/doc/html/_sources/core/index.txt index 1e2eccafc89bbb443c29d0b55bf9fc0eeec8aaac..904e46a8b44899eccf980857b40fde819be59a33 100644 --- a/doc/html/_sources/core/index.txt +++ b/doc/html/_sources/core/index.txt @@ -9,8 +9,8 @@ modeling per se but cover standard programming issues. .. toctree:: :maxdepth: 2 - - argcheck + + pm3argparse helper diff --git a/doc/html/_sources/core/pm3argparse.txt b/doc/html/_sources/core/pm3argparse.txt new file mode 100644 index 0000000000000000000000000000000000000000..b787f1144335b62a4c102dab7464675678d1242e --- /dev/null +++ b/doc/html/_sources/core/pm3argparse.txt @@ -0,0 +1,37 @@ +:mod:`~promod3.core.pm3argparse` - Parsing Command Lines +================================================================================ + +.. currentmodule:: promod3.core.pm3argparse + +.. module:: promod3.core.pm3argparse + +Introduction +-------------------------------------------------------------------------------- + +A lot of the actions in |project| have a bunch of command line parameters/ +arguments in common. For example we need an input alignment quite often and +usually for an alignment we need information on what is the target sequence, +what identifies a template sequence and eventually a hint on the format. That +means we need the same functionality on the command line in several actions. +There :class:`~promod3.core.pm3argparse.PM3ArgumentParser` serves as a +simplification. It provides a set of standard arguments you just need to +activate for your action plus it comes with some verification functionality for +input. + +.. synopsis/ example + +Argument Parser +-------------------------------------------------------------------------------- + +.. autoclass:: PM3ArgumentParser + :members: + + .. automethod:: __init__ + +.. |descattr| replace:: :attr:`description` +.. |argpinit| replace:: :meth:`argparse.ArgumentParser.__init__` +.. |progattr| replace:: :attr:`prog` +.. |sysargv| replace:: :attr:`sys.argv` + +.. LocalWords: currentmodule argparse ArgumentParser autoclass automethod +.. LocalWords: init descattr attr argpinit meth progattr prog diff --git a/doc/html/_sources/developers.txt b/doc/html/_sources/developers.txt index a750240d77b63b5c476fcc12b03d2c08874e425d..84b8f7022d642da56710f574abb8139f6cd15ce2 100644 --- a/doc/html/_sources/developers.txt +++ b/doc/html/_sources/developers.txt @@ -12,6 +12,7 @@ Contents: core/setcompoundschemlib core/index rawmodel/index + actions/index_dev buildsystem contributing cmake/index diff --git a/doc/html/_static/alabaster.css b/doc/html/_static/alabaster.css new file mode 100644 index 0000000000000000000000000000000000000000..0857c04b30f3125e7c405fe149e2abeff21577bd --- /dev/null +++ b/doc/html/_static/alabaster.css @@ -0,0 +1,591 @@ + + + + + + + + + + + + + + + + + + + + +@import url("basic.css"); + +/* -- page layout ----------------------------------------------------------- */ + +body { + font-family: 'goudy old style', 'minion pro', 'bell mt', Georgia, 'Hiragino Mincho Pro', serif; + font-size: 17px; + background-color: white; + color: #000; + margin: 0; + padding: 0; +} + +div.document { + width: 940px; + margin: 30px auto 0 auto; +} + +div.documentwrapper { + float: left; + width: 100%; +} + +div.bodywrapper { + margin: 0 0 0 220px; +} + +div.sphinxsidebar { + width: 220px; +} + +hr { + border: 1px solid #B1B4B6; +} + +div.body { + background-color: #ffffff; + color: #3E4349; + padding: 0 30px 0 30px; +} + +div.footer { + width: 940px; + margin: 20px auto 30px auto; + font-size: 14px; + color: #888; + text-align: right; +} + +div.footer a { + color: #888; +} + +div.related { + display: none; +} + +div.sphinxsidebar a { + color: #444; + text-decoration: none; + border-bottom: 1px dotted #999; +} + +div.sphinxsidebar a:hover { + border-bottom: 1px solid #999; +} + +div.sphinxsidebar { + font-size: 14px; + line-height: 1.5; +} + +div.sphinxsidebarwrapper { + padding: 18px 10px; +} + +div.sphinxsidebarwrapper p.logo { + padding: 0; + margin: -10px 0 0 0px; + text-align: center; +} + +div.sphinxsidebarwrapper h1.logo { + margin-top: -10px; + text-align: center; + margin-bottom: 5px; + text-align: left; +} + +div.sphinxsidebarwrapper h1.logo-name { + margin-top: 0px; +} + +div.sphinxsidebarwrapper p.blurb { + margin-top: 0; + font-style: normal; +} + +div.sphinxsidebar h3, +div.sphinxsidebar h4 { + font-family: 'Garamond', 'Georgia', serif; + color: #444; + font-size: 24px; + font-weight: normal; + margin: 0 0 5px 0; + padding: 0; +} + +div.sphinxsidebar h4 { + font-size: 20px; +} + +div.sphinxsidebar h3 a { + color: #444; +} + +div.sphinxsidebar p.logo a, +div.sphinxsidebar h3 a, +div.sphinxsidebar p.logo a:hover, +div.sphinxsidebar h3 a:hover { + border: none; +} + +div.sphinxsidebar p { + color: #555; + margin: 10px 0; +} + +div.sphinxsidebar ul { + margin: 10px 0; + padding: 0; + color: #000; +} + +div.sphinxsidebar ul li.toctree-l1 > a { + font-size: 120%; +} + +div.sphinxsidebar ul li.toctree-l2 > a { + font-size: 110%; +} + +div.sphinxsidebar input { + border: 1px solid #CCC; + font-family: 'goudy old style', 'minion pro', 'bell mt', Georgia, 'Hiragino Mincho Pro', serif; + font-size: 1em; +} + +div.sphinxsidebar hr { + border: none; + height: 1px; + color: #999; + background: #999; + + text-align: left; + margin-left: 0; + width: 50%; +} + +/* -- body styles ----------------------------------------------------------- */ + +a { + color: #004B6B; + text-decoration: underline; +} + +a:hover { + color: #6D4100; + text-decoration: underline; +} + +div.body h1, +div.body h2, +div.body h3, +div.body h4, +div.body h5, +div.body h6 { + font-family: 'Garamond', 'Georgia', serif; + font-weight: normal; + margin: 30px 0px 10px 0px; + padding: 0; +} + +div.body h1 { margin-top: 0; padding-top: 0; font-size: 240%; } +div.body h2 { font-size: 180%; } +div.body h3 { font-size: 150%; } +div.body h4 { font-size: 130%; } +div.body h5 { font-size: 100%; } +div.body h6 { font-size: 100%; } + +a.headerlink { + color: #DDD; + padding: 0 4px; + text-decoration: none; +} + +a.headerlink:hover { + color: #444; + background: #EAEAEA; +} + +div.body p, div.body dd, div.body li { + line-height: 1.4em; +} + +div.admonition { + margin: 20px 0px; + padding: 10px 30px; + background-color: #FCC; + border: 1px solid #FAA; +} + +div.admonition tt.xref, div.admonition a tt { + border-bottom: 1px solid #fafafa; +} + +dd div.admonition { + margin-left: -60px; + padding-left: 60px; +} + +div.admonition p.admonition-title { + font-family: 'Garamond', 'Georgia', serif; + font-weight: normal; + font-size: 24px; + margin: 0 0 10px 0; + padding: 0; + line-height: 1; +} + +div.admonition p.last { + margin-bottom: 0; +} + +div.highlight { + background-color: white; +} + +dt:target, .highlight { + background: #FAF3E8; +} + +div.note { + background-color: #EEE; + border: 1px solid #CCC; +} + +div.seealso { + background-color: #EEE; + border: 1px solid #CCC; +} + +div.topic { + background-color: #eee; +} + +p.admonition-title { + display: inline; +} + +p.admonition-title:after { + content: ":"; +} + +pre, tt, code { + font-family: 'Consolas', 'Menlo', 'Deja Vu Sans Mono', 'Bitstream Vera Sans Mono', monospace; + font-size: 0.9em; +} + +img.screenshot { +} + +tt.descname, tt.descclassname, code.descname, code.descclassname { + font-size: 0.95em; +} + +tt.descname, code.descname { + padding-right: 0.08em; +} + +img.screenshot { + -moz-box-shadow: 2px 2px 4px #eee; + -webkit-box-shadow: 2px 2px 4px #eee; + box-shadow: 2px 2px 4px #eee; +} + +table.docutils { + border: 1px solid #888; + -moz-box-shadow: 2px 2px 4px #eee; + -webkit-box-shadow: 2px 2px 4px #eee; + box-shadow: 2px 2px 4px #eee; +} + +table.docutils td, table.docutils th { + border: 1px solid #888; + padding: 0.25em 0.7em; +} + +table.field-list, table.footnote { + border: none; + -moz-box-shadow: none; + -webkit-box-shadow: none; + box-shadow: none; +} + +table.footnote { + margin: 15px 0; + width: 100%; + border: 1px solid #EEE; + background: #FDFDFD; + font-size: 0.9em; +} + +table.footnote + table.footnote { + margin-top: -15px; + border-top: none; +} + +table.field-list th { + padding: 0 0.8em 0 0; +} + +table.field-list td { + padding: 0; +} + +table.footnote td.label { + width: 0px; + padding: 0.3em 0 0.3em 0.5em; +} + +table.footnote td { + padding: 0.3em 0.5em; +} + +dl { + margin: 0; + padding: 0; +} + +dl dd { + margin-left: 30px; +} + +blockquote { + margin: 0 0 0 30px; + padding: 0; +} + +ul, ol { + margin: 10px 0 10px 30px; + padding: 0; +} + +pre { + background: #EEE; + padding: 7px 30px; + margin: 15px 0px; + line-height: 1.3em; +} + +dl pre, blockquote pre, li pre { + margin-left: -60px; + padding-left: 60px; +} + +dl dl pre { + margin-left: -90px; + padding-left: 90px; +} + +tt, code { + background-color: #ecf0f3; + color: #222; + /* padding: 1px 2px; */ +} + +tt.xref, code.xref, a tt { + background-color: #FBFBFB; + border-bottom: 1px solid white; +} + +a.reference { + text-decoration: none; + border-bottom: 1px dotted #004B6B; +} + +a.reference:hover { + border-bottom: 1px solid #6D4100; +} + +a.footnote-reference { + text-decoration: none; + font-size: 0.7em; + vertical-align: top; + border-bottom: 1px dotted #004B6B; +} + +a.footnote-reference:hover { + border-bottom: 1px solid #6D4100; +} + +a:hover tt, a:hover code { + background: #EEE; +} + + +@media screen and (max-width: 870px) { + + div.sphinxsidebar { + display: none; + } + + div.document { + width: 100%; + + } + + div.documentwrapper { + margin-left: 0; + margin-top: 0; + margin-right: 0; + margin-bottom: 0; + } + + div.bodywrapper { + margin-top: 0; + margin-right: 0; + margin-bottom: 0; + margin-left: 0; + } + + ul { + margin-left: 0; + } + + .document { + width: auto; + } + + .footer { + width: auto; + } + + .bodywrapper { + margin: 0; + } + + .footer { + width: auto; + } + + .github { + display: none; + } + + + +} + + + +@media screen and (max-width: 875px) { + + body { + margin: 0; + padding: 20px 30px; + } + + div.documentwrapper { + float: none; + background: white; + } + + div.sphinxsidebar { + display: block; + float: none; + width: 102.5%; + margin: 50px -30px -20px -30px; + padding: 10px 20px; + background: #333; + color: #FFF; + } + + div.sphinxsidebar h3, div.sphinxsidebar h4, div.sphinxsidebar p, + div.sphinxsidebar h3 a { + color: white; + } + + div.sphinxsidebar a { + color: #AAA; + } + + div.sphinxsidebar p.logo { + display: none; + } + + div.document { + width: 100%; + margin: 0; + } + + div.related { + display: block; + margin: 0; + padding: 10px 0 20px 0; + } + + div.related ul, + div.related ul li { + margin: 0; + padding: 0; + } + + div.footer { + display: none; + } + + div.bodywrapper { + margin: 0; + } + + div.body { + min-height: 0; + padding: 0; + } + + .rtd_doc_footer { + display: none; + } + + .document { + width: auto; + } + + .footer { + width: auto; + } + + .footer { + width: auto; + } + + .github { + display: none; + } +} + + +/* misc. */ + +.revsys-inline { + display: none!important; +} + +/* Make nested-list/multi-paragraph items look better in Releases changelog + * pages. Without this, docutils' magical list fuckery causes inconsistent + * formatting between different release sub-lists. + */ +div#changelog > div.section > ul > li > p:only-child { + margin-bottom: 0; +} + +/* Hide fugly table cell borders in ..bibliography:: directive output */ +table.docutils.citation, table.docutils.citation td, table.docutils.citation th { + border: none; + /* Below needed in some edge cases; if not applied, bottom shadows appear */ + -moz-box-shadow: none; + -webkit-box-shadow: none; + box-shadow: none; +} \ No newline at end of file diff --git a/doc/html/_static/basic.css b/doc/html/_static/basic.css index 967e36ce05f3933b61037c1ddbf5bffcf23d2176..9fa77d886d4f09c635c781bc3fadf10c8036c59e 100644 --- a/doc/html/_static/basic.css +++ b/doc/html/_static/basic.css @@ -4,7 +4,7 @@ * * Sphinx stylesheet -- basic theme. * - * :copyright: Copyright 2007-2014 by the Sphinx team, see AUTHORS. + * :copyright: Copyright 2007-2015 by the Sphinx team, see AUTHORS. * :license: BSD, see LICENSE for details. * */ @@ -197,7 +197,10 @@ h3:hover > a.headerlink, h4:hover > a.headerlink, h5:hover > a.headerlink, h6:hover > a.headerlink, -dt:hover > a.headerlink { +dt:hover > a.headerlink, +caption:hover > a.headerlink, +p.caption:hover > a.headerlink, +div.code-block-caption:hover > a.headerlink { visibility: visible; } @@ -314,6 +317,13 @@ table.docutils { border-collapse: collapse; } +table caption span.caption-number { + font-style: italic; +} + +table caption span.caption-text { +} + table.docutils td, table.docutils th { padding: 1px 8px 1px 5px; border-top: 0; @@ -344,6 +354,25 @@ table.citation td { border-bottom: none; } +/* -- figures --------------------------------------------------------------- */ + +div.figure { + margin: 0.5em; + padding: 0.5em; +} + +div.figure p.caption { + padding: 0.3em; +} + +div.figure p.caption span.caption-number { + font-style: italic; +} + +div.figure p.caption span.caption-text { +} + + /* -- other body styles ----------------------------------------------------- */ ol.arabic { @@ -406,6 +435,10 @@ dl.glossary dt { font-size: 1.3em; } +.sig-paren { + font-size: larger; +} + .versionmodified { font-style: italic; } @@ -471,22 +504,51 @@ table.highlighttable td { padding: 0 0.5em 0 0.5em; } -tt.descname { +div.code-block-caption { + padding: 2px 5px; + font-size: small; +} + +div.code-block-caption code { + background-color: transparent; +} + +div.code-block-caption + div > div.highlight > pre { + margin-top: 0; +} + +div.code-block-caption span.caption-number { + padding: 0.1em 0.3em; + font-style: italic; +} + +div.code-block-caption span.caption-text { +} + +div.literal-block-wrapper { + padding: 1em 1em 0; +} + +div.literal-block-wrapper div.highlight { + margin: 0; +} + +code.descname { background-color: transparent; font-weight: bold; font-size: 1.2em; } -tt.descclassname { +code.descclassname { background-color: transparent; } -tt.xref, a tt { +code.xref, a code { background-color: transparent; font-weight: bold; } -h1 tt, h2 tt, h3 tt, h4 tt, h5 tt, h6 tt { +h1 code, h2 code, h3 code, h4 code, h5 code, h6 code { background-color: transparent; } diff --git a/doc/html/_static/default.css b/doc/html/_static/default.css deleted file mode 100644 index 5f1399abd5d85bc2519ad8f3a0c266cfa51fd2a4..0000000000000000000000000000000000000000 --- a/doc/html/_static/default.css +++ /dev/null @@ -1,256 +0,0 @@ -/* - * default.css_t - * ~~~~~~~~~~~~~ - * - * Sphinx stylesheet -- default theme. - * - * :copyright: Copyright 2007-2014 by the Sphinx team, see AUTHORS. - * :license: BSD, see LICENSE for details. - * - */ - -@import url("basic.css"); - -/* -- page layout ----------------------------------------------------------- */ - -body { - font-family: sans-serif; - font-size: 100%; - background-color: #11303d; - color: #000; - margin: 0; - padding: 0; -} - -div.document { - background-color: #1c4e63; -} - -div.documentwrapper { - float: left; - width: 100%; -} - -div.bodywrapper { - margin: 0 0 0 230px; -} - -div.body { - background-color: #ffffff; - color: #000000; - padding: 0 20px 30px 20px; -} - -div.footer { - color: #ffffff; - width: 100%; - padding: 9px 0 9px 0; - text-align: center; - font-size: 75%; -} - -div.footer a { - color: #ffffff; - text-decoration: underline; -} - -div.related { - background-color: #133f52; - line-height: 30px; - color: #ffffff; -} - -div.related a { - color: #ffffff; -} - -div.sphinxsidebar { -} - -div.sphinxsidebar h3 { - font-family: 'Trebuchet MS', sans-serif; - color: #ffffff; - font-size: 1.4em; - font-weight: normal; - margin: 0; - padding: 0; -} - -div.sphinxsidebar h3 a { - color: #ffffff; -} - -div.sphinxsidebar h4 { - font-family: 'Trebuchet MS', sans-serif; - color: #ffffff; - font-size: 1.3em; - font-weight: normal; - margin: 5px 0 0 0; - padding: 0; -} - -div.sphinxsidebar p { - color: #ffffff; -} - -div.sphinxsidebar p.topless { - margin: 5px 10px 10px 10px; -} - -div.sphinxsidebar ul { - margin: 10px; - padding: 0; - color: #ffffff; -} - -div.sphinxsidebar a { - color: #98dbcc; -} - -div.sphinxsidebar input { - border: 1px solid #98dbcc; - font-family: sans-serif; - font-size: 1em; -} - - - -/* -- hyperlink styles ------------------------------------------------------ */ - -a { - color: #355f7c; - text-decoration: none; -} - -a:visited { - color: #355f7c; - text-decoration: none; -} - -a:hover { - text-decoration: underline; -} - - - -/* -- body styles ----------------------------------------------------------- */ - -div.body h1, -div.body h2, -div.body h3, -div.body h4, -div.body h5, -div.body h6 { - font-family: 'Trebuchet MS', sans-serif; - background-color: #f2f2f2; - font-weight: normal; - color: #20435c; - border-bottom: 1px solid #ccc; - margin: 20px -20px 10px -20px; - padding: 3px 0 3px 10px; -} - -div.body h1 { margin-top: 0; font-size: 200%; } -div.body h2 { font-size: 160%; } -div.body h3 { font-size: 140%; } -div.body h4 { font-size: 120%; } -div.body h5 { font-size: 110%; } -div.body h6 { font-size: 100%; } - -a.headerlink { - color: #c60f0f; - font-size: 0.8em; - padding: 0 4px 0 4px; - text-decoration: none; -} - -a.headerlink:hover { - background-color: #c60f0f; - color: white; -} - -div.body p, div.body dd, div.body li { - text-align: justify; - line-height: 130%; -} - -div.admonition p.admonition-title + p { - display: inline; -} - -div.admonition p { - margin-bottom: 5px; -} - -div.admonition pre { - margin-bottom: 5px; -} - -div.admonition ul, div.admonition ol { - margin-bottom: 5px; -} - -div.note { - background-color: #eee; - border: 1px solid #ccc; -} - -div.seealso { - background-color: #ffc; - border: 1px solid #ff6; -} - -div.topic { - background-color: #eee; -} - -div.warning { - background-color: #ffe4e4; - border: 1px solid #f66; -} - -p.admonition-title { - display: inline; -} - -p.admonition-title:after { - content: ":"; -} - -pre { - padding: 5px; - background-color: #eeffcc; - color: #333333; - line-height: 120%; - border: 1px solid #ac9; - border-left: none; - border-right: none; -} - -tt { - background-color: #ecf0f3; - padding: 0 1px 0 1px; - font-size: 0.95em; -} - -th { - background-color: #ede; -} - -.warning tt { - background: #efc2c2; -} - -.note tt { - background: #d6d6d6; -} - -.viewcode-back { - font-family: sans-serif; -} - -div.viewcode-block:target { - background-color: #f4debf; - border-top: 1px solid #ac9; - border-bottom: 1px solid #ac9; -} \ No newline at end of file diff --git a/doc/html/_static/doctools.js b/doc/html/_static/doctools.js index c5455c905dcf5323dc6bd0ac8b93c3851daeeecd..c7bfe760aa8b32cfa5676be000a43f465531ac0c 100644 --- a/doc/html/_static/doctools.js +++ b/doc/html/_static/doctools.js @@ -4,7 +4,7 @@ * * Sphinx JavaScript utilities for all documentation. * - * :copyright: Copyright 2007-2014 by the Sphinx team, see AUTHORS. + * :copyright: Copyright 2007-2015 by the Sphinx team, see AUTHORS. * :license: BSD, see LICENSE for details. * */ @@ -91,6 +91,30 @@ jQuery.fn.highlightText = function(text, className) { }); }; +/* + * backward compatibility for jQuery.browser + * This will be supported until firefox bug is fixed. + */ +if (!jQuery.browser) { + jQuery.uaMatch = function(ua) { + ua = ua.toLowerCase(); + + var match = /(chrome)[ \/]([\w.]+)/.exec(ua) || + /(webkit)[ \/]([\w.]+)/.exec(ua) || + /(opera)(?:.*version|)[ \/]([\w.]+)/.exec(ua) || + /(msie) ([\w.]+)/.exec(ua) || + ua.indexOf("compatible") < 0 && /(mozilla)(?:.*? rv:([\w.]+)|)/.exec(ua) || + []; + + return { + browser: match[ 1 ] || "", + version: match[ 2 ] || "0" + }; + }; + jQuery.browser = {}; + jQuery.browser[jQuery.uaMatch(navigator.userAgent).browser] = true; +} + /** * Small JavaScript module for the documentation. */ @@ -152,9 +176,10 @@ var Documentation = { /** * workaround a firefox stupidity + * see: https://bugzilla.mozilla.org/show_bug.cgi?id=645075 */ fixFirefoxAnchorBug : function() { - if (document.location.hash && $.browser.mozilla) + if (document.location.hash) window.setTimeout(function() { document.location.href += ''; }, 10); diff --git a/doc/html/_static/down-pressed.png b/doc/html/_static/down-pressed.png index 6f7ad782782e4f8e39b0c6e15c7344700cdd2527..7c30d004b71b32bb2fc06b3bd4dc8278baab0946 100644 Binary files a/doc/html/_static/down-pressed.png and b/doc/html/_static/down-pressed.png differ diff --git a/doc/html/_static/down.png b/doc/html/_static/down.png index 3003a88770de3977d47a2ba69893436a2860f9e7..f48098a43b0c36342db9e1a9a7372e79b2484a59 100644 Binary files a/doc/html/_static/down.png and b/doc/html/_static/down.png differ diff --git a/doc/html/_static/file.png b/doc/html/_static/file.png index d18082e397e7e54f20721af768c4c2983258f1b4..254c60bfbe2715ae2edca48ebccfd074deb8031d 100644 Binary files a/doc/html/_static/file.png and b/doc/html/_static/file.png differ diff --git a/doc/html/_static/jquery-1.11.1.js b/doc/html/_static/jquery-1.11.1.js new file mode 100644 index 0000000000000000000000000000000000000000..d4b67f7e6c1a94df167f31657769717a71581066 --- /dev/null +++ b/doc/html/_static/jquery-1.11.1.js @@ -0,0 +1,10308 @@ +/*! + * jQuery JavaScript Library v1.11.1 + * http://jquery.com/ + * + * Includes Sizzle.js + * http://sizzlejs.com/ + * + * Copyright 2005, 2014 jQuery Foundation, Inc. and other contributors + * Released under the MIT license + * http://jquery.org/license + * + * Date: 2014-05-01T17:42Z + */ + +(function( global, factory ) { + + if ( typeof module === "object" && typeof module.exports === "object" ) { + // For CommonJS and CommonJS-like environments where a proper window is present, + // execute the factory and get jQuery + // For environments that do not inherently posses a window with a document + // (such as Node.js), expose a jQuery-making factory as module.exports + // This accentuates the need for the creation of a real window + // e.g. var jQuery = require("jquery")(window); + // See ticket #14549 for more info + module.exports = global.document ? + factory( global, true ) : + function( w ) { + if ( !w.document ) { + throw new Error( "jQuery requires a window with a document" ); + } + return factory( w ); + }; + } else { + factory( global ); + } + +// Pass this if window is not defined yet +}(typeof window !== "undefined" ? window : this, function( window, noGlobal ) { + +// Can't do this because several apps including ASP.NET trace +// the stack via arguments.caller.callee and Firefox dies if +// you try to trace through "use strict" call chains. (#13335) +// Support: Firefox 18+ +// + +var deletedIds = []; + +var slice = deletedIds.slice; + +var concat = deletedIds.concat; + +var push = deletedIds.push; + +var indexOf = deletedIds.indexOf; + +var class2type = {}; + +var toString = class2type.toString; + +var hasOwn = class2type.hasOwnProperty; + +var support = {}; + + + +var + version = "1.11.1", + + // Define a local copy of jQuery + jQuery = function( selector, context ) { + // The jQuery object is actually just the init constructor 'enhanced' + // Need init if jQuery is called (just allow error to be thrown if not included) + return new jQuery.fn.init( selector, context ); + }, + + // Support: Android<4.1, IE<9 + // Make sure we trim BOM and NBSP + rtrim = /^[\s\uFEFF\xA0]+|[\s\uFEFF\xA0]+$/g, + + // Matches dashed string for camelizing + rmsPrefix = /^-ms-/, + rdashAlpha = /-([\da-z])/gi, + + // Used by jQuery.camelCase as callback to replace() + fcamelCase = function( all, letter ) { + return letter.toUpperCase(); + }; + +jQuery.fn = jQuery.prototype = { + // The current version of jQuery being used + jquery: version, + + constructor: jQuery, + + // Start with an empty selector + selector: "", + + // The default length of a jQuery object is 0 + length: 0, + + toArray: function() { + return slice.call( this ); + }, + + // Get the Nth element in the matched element set OR + // Get the whole matched element set as a clean array + get: function( num ) { + return num != null ? + + // Return just the one element from the set + ( num < 0 ? this[ num + this.length ] : this[ num ] ) : + + // Return all the elements in a clean array + slice.call( this ); + }, + + // Take an array of elements and push it onto the stack + // (returning the new matched element set) + pushStack: function( elems ) { + + // Build a new jQuery matched element set + var ret = jQuery.merge( this.constructor(), elems ); + + // Add the old object onto the stack (as a reference) + ret.prevObject = this; + ret.context = this.context; + + // Return the newly-formed element set + return ret; + }, + + // Execute a callback for every element in the matched set. + // (You can seed the arguments with an array of args, but this is + // only used internally.) + each: function( callback, args ) { + return jQuery.each( this, callback, args ); + }, + + map: function( callback ) { + return this.pushStack( jQuery.map(this, function( elem, i ) { + return callback.call( elem, i, elem ); + })); + }, + + slice: function() { + return this.pushStack( slice.apply( this, arguments ) ); + }, + + first: function() { + return this.eq( 0 ); + }, + + last: function() { + return this.eq( -1 ); + }, + + eq: function( i ) { + var len = this.length, + j = +i + ( i < 0 ? len : 0 ); + return this.pushStack( j >= 0 && j < len ? [ this[j] ] : [] ); + }, + + end: function() { + return this.prevObject || this.constructor(null); + }, + + // For internal use only. + // Behaves like an Array's method, not like a jQuery method. + push: push, + sort: deletedIds.sort, + splice: deletedIds.splice +}; + +jQuery.extend = jQuery.fn.extend = function() { + var src, copyIsArray, copy, name, options, clone, + target = arguments[0] || {}, + i = 1, + length = arguments.length, + deep = false; + + // Handle a deep copy situation + if ( typeof target === "boolean" ) { + deep = target; + + // skip the boolean and the target + target = arguments[ i ] || {}; + i++; + } + + // Handle case when target is a string or something (possible in deep copy) + if ( typeof target !== "object" && !jQuery.isFunction(target) ) { + target = {}; + } + + // extend jQuery itself if only one argument is passed + if ( i === length ) { + target = this; + i--; + } + + for ( ; i < length; i++ ) { + // Only deal with non-null/undefined values + if ( (options = arguments[ i ]) != null ) { + // Extend the base object + for ( name in options ) { + src = target[ name ]; + copy = options[ name ]; + + // Prevent never-ending loop + if ( target === copy ) { + continue; + } + + // Recurse if we're merging plain objects or arrays + if ( deep && copy && ( jQuery.isPlainObject(copy) || (copyIsArray = jQuery.isArray(copy)) ) ) { + if ( copyIsArray ) { + copyIsArray = false; + clone = src && jQuery.isArray(src) ? src : []; + + } else { + clone = src && jQuery.isPlainObject(src) ? src : {}; + } + + // Never move original objects, clone them + target[ name ] = jQuery.extend( deep, clone, copy ); + + // Don't bring in undefined values + } else if ( copy !== undefined ) { + target[ name ] = copy; + } + } + } + } + + // Return the modified object + return target; +}; + +jQuery.extend({ + // Unique for each copy of jQuery on the page + expando: "jQuery" + ( version + Math.random() ).replace( /\D/g, "" ), + + // Assume jQuery is ready without the ready module + isReady: true, + + error: function( msg ) { + throw new Error( msg ); + }, + + noop: function() {}, + + // See test/unit/core.js for details concerning isFunction. + // Since version 1.3, DOM methods and functions like alert + // aren't supported. They return false on IE (#2968). + isFunction: function( obj ) { + return jQuery.type(obj) === "function"; + }, + + isArray: Array.isArray || function( obj ) { + return jQuery.type(obj) === "array"; + }, + + isWindow: function( obj ) { + /* jshint eqeqeq: false */ + return obj != null && obj == obj.window; + }, + + isNumeric: function( obj ) { + // parseFloat NaNs numeric-cast false positives (null|true|false|"") + // ...but misinterprets leading-number strings, particularly hex literals ("0x...") + // subtraction forces infinities to NaN + return !jQuery.isArray( obj ) && obj - parseFloat( obj ) >= 0; + }, + + isEmptyObject: function( obj ) { + var name; + for ( name in obj ) { + return false; + } + return true; + }, + + isPlainObject: function( obj ) { + var key; + + // Must be an Object. + // Because of IE, we also have to check the presence of the constructor property. + // Make sure that DOM nodes and window objects don't pass through, as well + if ( !obj || jQuery.type(obj) !== "object" || obj.nodeType || jQuery.isWindow( obj ) ) { + return false; + } + + try { + // Not own constructor property must be Object + if ( obj.constructor && + !hasOwn.call(obj, "constructor") && + !hasOwn.call(obj.constructor.prototype, "isPrototypeOf") ) { + return false; + } + } catch ( e ) { + // IE8,9 Will throw exceptions on certain host objects #9897 + return false; + } + + // Support: IE<9 + // Handle iteration over inherited properties before own properties. + if ( support.ownLast ) { + for ( key in obj ) { + return hasOwn.call( obj, key ); + } + } + + // Own properties are enumerated firstly, so to speed up, + // if last one is own, then all properties are own. + for ( key in obj ) {} + + return key === undefined || hasOwn.call( obj, key ); + }, + + type: function( obj ) { + if ( obj == null ) { + return obj + ""; + } + return typeof obj === "object" || typeof obj === "function" ? + class2type[ toString.call(obj) ] || "object" : + typeof obj; + }, + + // Evaluates a script in a global context + // Workarounds based on findings by Jim Driscoll + // http://weblogs.java.net/blog/driscoll/archive/2009/09/08/eval-javascript-global-context + globalEval: function( data ) { + if ( data && jQuery.trim( data ) ) { + // We use execScript on Internet Explorer + // We use an anonymous function so that context is window + // rather than jQuery in Firefox + ( window.execScript || function( data ) { + window[ "eval" ].call( window, data ); + } )( data ); + } + }, + + // Convert dashed to camelCase; used by the css and data modules + // Microsoft forgot to hump their vendor prefix (#9572) + camelCase: function( string ) { + return string.replace( rmsPrefix, "ms-" ).replace( rdashAlpha, fcamelCase ); + }, + + nodeName: function( elem, name ) { + return elem.nodeName && elem.nodeName.toLowerCase() === name.toLowerCase(); + }, + + // args is for internal usage only + each: function( obj, callback, args ) { + var value, + i = 0, + length = obj.length, + isArray = isArraylike( obj ); + + if ( args ) { + if ( isArray ) { + for ( ; i < length; i++ ) { + value = callback.apply( obj[ i ], args ); + + if ( value === false ) { + break; + } + } + } else { + for ( i in obj ) { + value = callback.apply( obj[ i ], args ); + + if ( value === false ) { + break; + } + } + } + + // A special, fast, case for the most common use of each + } else { + if ( isArray ) { + for ( ; i < length; i++ ) { + value = callback.call( obj[ i ], i, obj[ i ] ); + + if ( value === false ) { + break; + } + } + } else { + for ( i in obj ) { + value = callback.call( obj[ i ], i, obj[ i ] ); + + if ( value === false ) { + break; + } + } + } + } + + return obj; + }, + + // Support: Android<4.1, IE<9 + trim: function( text ) { + return text == null ? + "" : + ( text + "" ).replace( rtrim, "" ); + }, + + // results is for internal usage only + makeArray: function( arr, results ) { + var ret = results || []; + + if ( arr != null ) { + if ( isArraylike( Object(arr) ) ) { + jQuery.merge( ret, + typeof arr === "string" ? + [ arr ] : arr + ); + } else { + push.call( ret, arr ); + } + } + + return ret; + }, + + inArray: function( elem, arr, i ) { + var len; + + if ( arr ) { + if ( indexOf ) { + return indexOf.call( arr, elem, i ); + } + + len = arr.length; + i = i ? i < 0 ? Math.max( 0, len + i ) : i : 0; + + for ( ; i < len; i++ ) { + // Skip accessing in sparse arrays + if ( i in arr && arr[ i ] === elem ) { + return i; + } + } + } + + return -1; + }, + + merge: function( first, second ) { + var len = +second.length, + j = 0, + i = first.length; + + while ( j < len ) { + first[ i++ ] = second[ j++ ]; + } + + // Support: IE<9 + // Workaround casting of .length to NaN on otherwise arraylike objects (e.g., NodeLists) + if ( len !== len ) { + while ( second[j] !== undefined ) { + first[ i++ ] = second[ j++ ]; + } + } + + first.length = i; + + return first; + }, + + grep: function( elems, callback, invert ) { + var callbackInverse, + matches = [], + i = 0, + length = elems.length, + callbackExpect = !invert; + + // Go through the array, only saving the items + // that pass the validator function + for ( ; i < length; i++ ) { + callbackInverse = !callback( elems[ i ], i ); + if ( callbackInverse !== callbackExpect ) { + matches.push( elems[ i ] ); + } + } + + return matches; + }, + + // arg is for internal usage only + map: function( elems, callback, arg ) { + var value, + i = 0, + length = elems.length, + isArray = isArraylike( elems ), + ret = []; + + // Go through the array, translating each of the items to their new values + if ( isArray ) { + for ( ; i < length; i++ ) { + value = callback( elems[ i ], i, arg ); + + if ( value != null ) { + ret.push( value ); + } + } + + // Go through every key on the object, + } else { + for ( i in elems ) { + value = callback( elems[ i ], i, arg ); + + if ( value != null ) { + ret.push( value ); + } + } + } + + // Flatten any nested arrays + return concat.apply( [], ret ); + }, + + // A global GUID counter for objects + guid: 1, + + // Bind a function to a context, optionally partially applying any + // arguments. + proxy: function( fn, context ) { + var args, proxy, tmp; + + if ( typeof context === "string" ) { + tmp = fn[ context ]; + context = fn; + fn = tmp; + } + + // Quick check to determine if target is callable, in the spec + // this throws a TypeError, but we will just return undefined. + if ( !jQuery.isFunction( fn ) ) { + return undefined; + } + + // Simulated bind + args = slice.call( arguments, 2 ); + proxy = function() { + return fn.apply( context || this, args.concat( slice.call( arguments ) ) ); + }; + + // Set the guid of unique handler to the same of original handler, so it can be removed + proxy.guid = fn.guid = fn.guid || jQuery.guid++; + + return proxy; + }, + + now: function() { + return +( new Date() ); + }, + + // jQuery.support is not used in Core but other projects attach their + // properties to it so it needs to exist. + support: support +}); + +// Populate the class2type map +jQuery.each("Boolean Number String Function Array Date RegExp Object Error".split(" "), function(i, name) { + class2type[ "[object " + name + "]" ] = name.toLowerCase(); +}); + +function isArraylike( obj ) { + var length = obj.length, + type = jQuery.type( obj ); + + if ( type === "function" || jQuery.isWindow( obj ) ) { + return false; + } + + if ( obj.nodeType === 1 && length ) { + return true; + } + + return type === "array" || length === 0 || + typeof length === "number" && length > 0 && ( length - 1 ) in obj; +} +var Sizzle = +/*! + * Sizzle CSS Selector Engine v1.10.19 + * http://sizzlejs.com/ + * + * Copyright 2013 jQuery Foundation, Inc. and other contributors + * Released under the MIT license + * http://jquery.org/license + * + * Date: 2014-04-18 + */ +(function( window ) { + +var i, + support, + Expr, + getText, + isXML, + tokenize, + compile, + select, + outermostContext, + sortInput, + hasDuplicate, + + // Local document vars + setDocument, + document, + docElem, + documentIsHTML, + rbuggyQSA, + rbuggyMatches, + matches, + contains, + + // Instance-specific data + expando = "sizzle" + -(new Date()), + preferredDoc = window.document, + dirruns = 0, + done = 0, + classCache = createCache(), + tokenCache = createCache(), + compilerCache = createCache(), + sortOrder = function( a, b ) { + if ( a === b ) { + hasDuplicate = true; + } + return 0; + }, + + // General-purpose constants + strundefined = typeof undefined, + MAX_NEGATIVE = 1 << 31, + + // Instance methods + hasOwn = ({}).hasOwnProperty, + arr = [], + pop = arr.pop, + push_native = arr.push, + push = arr.push, + slice = arr.slice, + // Use a stripped-down indexOf if we can't use a native one + indexOf = arr.indexOf || function( elem ) { + var i = 0, + len = this.length; + for ( ; i < len; i++ ) { + if ( this[i] === elem ) { + return i; + } + } + return -1; + }, + + booleans = "checked|selected|async|autofocus|autoplay|controls|defer|disabled|hidden|ismap|loop|multiple|open|readonly|required|scoped", + + // Regular expressions + + // Whitespace characters http://www.w3.org/TR/css3-selectors/#whitespace + whitespace = "[\\x20\\t\\r\\n\\f]", + // http://www.w3.org/TR/css3-syntax/#characters + characterEncoding = "(?:\\\\.|[\\w-]|[^\\x00-\\xa0])+", + + // Loosely modeled on CSS identifier characters + // An unquoted value should be a CSS identifier http://www.w3.org/TR/css3-selectors/#attribute-selectors + // Proper syntax: http://www.w3.org/TR/CSS21/syndata.html#value-def-identifier + identifier = characterEncoding.replace( "w", "w#" ), + + // Attribute selectors: http://www.w3.org/TR/selectors/#attribute-selectors + attributes = "\\[" + whitespace + "*(" + characterEncoding + ")(?:" + whitespace + + // Operator (capture 2) + "*([*^$|!~]?=)" + whitespace + + // "Attribute values must be CSS identifiers [capture 5] or strings [capture 3 or capture 4]" + "*(?:'((?:\\\\.|[^\\\\'])*)'|\"((?:\\\\.|[^\\\\\"])*)\"|(" + identifier + "))|)" + whitespace + + "*\\]", + + pseudos = ":(" + characterEncoding + ")(?:\\((" + + // To reduce the number of selectors needing tokenize in the preFilter, prefer arguments: + // 1. quoted (capture 3; capture 4 or capture 5) + "('((?:\\\\.|[^\\\\'])*)'|\"((?:\\\\.|[^\\\\\"])*)\")|" + + // 2. simple (capture 6) + "((?:\\\\.|[^\\\\()[\\]]|" + attributes + ")*)|" + + // 3. anything else (capture 2) + ".*" + + ")\\)|)", + + // Leading and non-escaped trailing whitespace, capturing some non-whitespace characters preceding the latter + rtrim = new RegExp( "^" + whitespace + "+|((?:^|[^\\\\])(?:\\\\.)*)" + whitespace + "+$", "g" ), + + rcomma = new RegExp( "^" + whitespace + "*," + whitespace + "*" ), + rcombinators = new RegExp( "^" + whitespace + "*([>+~]|" + whitespace + ")" + whitespace + "*" ), + + rattributeQuotes = new RegExp( "=" + whitespace + "*([^\\]'\"]*?)" + whitespace + "*\\]", "g" ), + + rpseudo = new RegExp( pseudos ), + ridentifier = new RegExp( "^" + identifier + "$" ), + + matchExpr = { + "ID": new RegExp( "^#(" + characterEncoding + ")" ), + "CLASS": new RegExp( "^\\.(" + characterEncoding + ")" ), + "TAG": new RegExp( "^(" + characterEncoding.replace( "w", "w*" ) + ")" ), + "ATTR": new RegExp( "^" + attributes ), + "PSEUDO": new RegExp( "^" + pseudos ), + "CHILD": new RegExp( "^:(only|first|last|nth|nth-last)-(child|of-type)(?:\\(" + whitespace + + "*(even|odd|(([+-]|)(\\d*)n|)" + whitespace + "*(?:([+-]|)" + whitespace + + "*(\\d+)|))" + whitespace + "*\\)|)", "i" ), + "bool": new RegExp( "^(?:" + booleans + ")$", "i" ), + // For use in libraries implementing .is() + // We use this for POS matching in `select` + "needsContext": new RegExp( "^" + whitespace + "*[>+~]|:(even|odd|eq|gt|lt|nth|first|last)(?:\\(" + + whitespace + "*((?:-\\d)?\\d*)" + whitespace + "*\\)|)(?=[^-]|$)", "i" ) + }, + + rinputs = /^(?:input|select|textarea|button)$/i, + rheader = /^h\d$/i, + + rnative = /^[^{]+\{\s*\[native \w/, + + // Easily-parseable/retrievable ID or TAG or CLASS selectors + rquickExpr = /^(?:#([\w-]+)|(\w+)|\.([\w-]+))$/, + + rsibling = /[+~]/, + rescape = /'|\\/g, + + // CSS escapes http://www.w3.org/TR/CSS21/syndata.html#escaped-characters + runescape = new RegExp( "\\\\([\\da-f]{1,6}" + whitespace + "?|(" + whitespace + ")|.)", "ig" ), + funescape = function( _, escaped, escapedWhitespace ) { + var high = "0x" + escaped - 0x10000; + // NaN means non-codepoint + // Support: Firefox<24 + // Workaround erroneous numeric interpretation of +"0x" + return high !== high || escapedWhitespace ? + escaped : + high < 0 ? + // BMP codepoint + String.fromCharCode( high + 0x10000 ) : + // Supplemental Plane codepoint (surrogate pair) + String.fromCharCode( high >> 10 | 0xD800, high & 0x3FF | 0xDC00 ); + }; + +// Optimize for push.apply( _, NodeList ) +try { + push.apply( + (arr = slice.call( preferredDoc.childNodes )), + preferredDoc.childNodes + ); + // Support: Android<4.0 + // Detect silently failing push.apply + arr[ preferredDoc.childNodes.length ].nodeType; +} catch ( e ) { + push = { apply: arr.length ? + + // Leverage slice if possible + function( target, els ) { + push_native.apply( target, slice.call(els) ); + } : + + // Support: IE<9 + // Otherwise append directly + function( target, els ) { + var j = target.length, + i = 0; + // Can't trust NodeList.length + while ( (target[j++] = els[i++]) ) {} + target.length = j - 1; + } + }; +} + +function Sizzle( selector, context, results, seed ) { + var match, elem, m, nodeType, + // QSA vars + i, groups, old, nid, newContext, newSelector; + + if ( ( context ? context.ownerDocument || context : preferredDoc ) !== document ) { + setDocument( context ); + } + + context = context || document; + results = results || []; + + if ( !selector || typeof selector !== "string" ) { + return results; + } + + if ( (nodeType = context.nodeType) !== 1 && nodeType !== 9 ) { + return []; + } + + if ( documentIsHTML && !seed ) { + + // Shortcuts + if ( (match = rquickExpr.exec( selector )) ) { + // Speed-up: Sizzle("#ID") + if ( (m = match[1]) ) { + if ( nodeType === 9 ) { + elem = context.getElementById( m ); + // Check parentNode to catch when Blackberry 4.6 returns + // nodes that are no longer in the document (jQuery #6963) + if ( elem && elem.parentNode ) { + // Handle the case where IE, Opera, and Webkit return items + // by name instead of ID + if ( elem.id === m ) { + results.push( elem ); + return results; + } + } else { + return results; + } + } else { + // Context is not a document + if ( context.ownerDocument && (elem = context.ownerDocument.getElementById( m )) && + contains( context, elem ) && elem.id === m ) { + results.push( elem ); + return results; + } + } + + // Speed-up: Sizzle("TAG") + } else if ( match[2] ) { + push.apply( results, context.getElementsByTagName( selector ) ); + return results; + + // Speed-up: Sizzle(".CLASS") + } else if ( (m = match[3]) && support.getElementsByClassName && context.getElementsByClassName ) { + push.apply( results, context.getElementsByClassName( m ) ); + return results; + } + } + + // QSA path + if ( support.qsa && (!rbuggyQSA || !rbuggyQSA.test( selector )) ) { + nid = old = expando; + newContext = context; + newSelector = nodeType === 9 && selector; + + // qSA works strangely on Element-rooted queries + // We can work around this by specifying an extra ID on the root + // and working up from there (Thanks to Andrew Dupont for the technique) + // IE 8 doesn't work on object elements + if ( nodeType === 1 && context.nodeName.toLowerCase() !== "object" ) { + groups = tokenize( selector ); + + if ( (old = context.getAttribute("id")) ) { + nid = old.replace( rescape, "\\$&" ); + } else { + context.setAttribute( "id", nid ); + } + nid = "[id='" + nid + "'] "; + + i = groups.length; + while ( i-- ) { + groups[i] = nid + toSelector( groups[i] ); + } + newContext = rsibling.test( selector ) && testContext( context.parentNode ) || context; + newSelector = groups.join(","); + } + + if ( newSelector ) { + try { + push.apply( results, + newContext.querySelectorAll( newSelector ) + ); + return results; + } catch(qsaError) { + } finally { + if ( !old ) { + context.removeAttribute("id"); + } + } + } + } + } + + // All others + return select( selector.replace( rtrim, "$1" ), context, results, seed ); +} + +/** + * Create key-value caches of limited size + * @returns {Function(string, Object)} Returns the Object data after storing it on itself with + * property name the (space-suffixed) string and (if the cache is larger than Expr.cacheLength) + * deleting the oldest entry + */ +function createCache() { + var keys = []; + + function cache( key, value ) { + // Use (key + " ") to avoid collision with native prototype properties (see Issue #157) + if ( keys.push( key + " " ) > Expr.cacheLength ) { + // Only keep the most recent entries + delete cache[ keys.shift() ]; + } + return (cache[ key + " " ] = value); + } + return cache; +} + +/** + * Mark a function for special use by Sizzle + * @param {Function} fn The function to mark + */ +function markFunction( fn ) { + fn[ expando ] = true; + return fn; +} + +/** + * Support testing using an element + * @param {Function} fn Passed the created div and expects a boolean result + */ +function assert( fn ) { + var div = document.createElement("div"); + + try { + return !!fn( div ); + } catch (e) { + return false; + } finally { + // Remove from its parent by default + if ( div.parentNode ) { + div.parentNode.removeChild( div ); + } + // release memory in IE + div = null; + } +} + +/** + * Adds the same handler for all of the specified attrs + * @param {String} attrs Pipe-separated list of attributes + * @param {Function} handler The method that will be applied + */ +function addHandle( attrs, handler ) { + var arr = attrs.split("|"), + i = attrs.length; + + while ( i-- ) { + Expr.attrHandle[ arr[i] ] = handler; + } +} + +/** + * Checks document order of two siblings + * @param {Element} a + * @param {Element} b + * @returns {Number} Returns less than 0 if a precedes b, greater than 0 if a follows b + */ +function siblingCheck( a, b ) { + var cur = b && a, + diff = cur && a.nodeType === 1 && b.nodeType === 1 && + ( ~b.sourceIndex || MAX_NEGATIVE ) - + ( ~a.sourceIndex || MAX_NEGATIVE ); + + // Use IE sourceIndex if available on both nodes + if ( diff ) { + return diff; + } + + // Check if b follows a + if ( cur ) { + while ( (cur = cur.nextSibling) ) { + if ( cur === b ) { + return -1; + } + } + } + + return a ? 1 : -1; +} + +/** + * Returns a function to use in pseudos for input types + * @param {String} type + */ +function createInputPseudo( type ) { + return function( elem ) { + var name = elem.nodeName.toLowerCase(); + return name === "input" && elem.type === type; + }; +} + +/** + * Returns a function to use in pseudos for buttons + * @param {String} type + */ +function createButtonPseudo( type ) { + return function( elem ) { + var name = elem.nodeName.toLowerCase(); + return (name === "input" || name === "button") && elem.type === type; + }; +} + +/** + * Returns a function to use in pseudos for positionals + * @param {Function} fn + */ +function createPositionalPseudo( fn ) { + return markFunction(function( argument ) { + argument = +argument; + return markFunction(function( seed, matches ) { + var j, + matchIndexes = fn( [], seed.length, argument ), + i = matchIndexes.length; + + // Match elements found at the specified indexes + while ( i-- ) { + if ( seed[ (j = matchIndexes[i]) ] ) { + seed[j] = !(matches[j] = seed[j]); + } + } + }); + }); +} + +/** + * Checks a node for validity as a Sizzle context + * @param {Element|Object=} context + * @returns {Element|Object|Boolean} The input node if acceptable, otherwise a falsy value + */ +function testContext( context ) { + return context && typeof context.getElementsByTagName !== strundefined && context; +} + +// Expose support vars for convenience +support = Sizzle.support = {}; + +/** + * Detects XML nodes + * @param {Element|Object} elem An element or a document + * @returns {Boolean} True iff elem is a non-HTML XML node + */ +isXML = Sizzle.isXML = function( elem ) { + // documentElement is verified for cases where it doesn't yet exist + // (such as loading iframes in IE - #4833) + var documentElement = elem && (elem.ownerDocument || elem).documentElement; + return documentElement ? documentElement.nodeName !== "HTML" : false; +}; + +/** + * Sets document-related variables once based on the current document + * @param {Element|Object} [doc] An element or document object to use to set the document + * @returns {Object} Returns the current document + */ +setDocument = Sizzle.setDocument = function( node ) { + var hasCompare, + doc = node ? node.ownerDocument || node : preferredDoc, + parent = doc.defaultView; + + // If no document and documentElement is available, return + if ( doc === document || doc.nodeType !== 9 || !doc.documentElement ) { + return document; + } + + // Set our document + document = doc; + docElem = doc.documentElement; + + // Support tests + documentIsHTML = !isXML( doc ); + + // Support: IE>8 + // If iframe document is assigned to "document" variable and if iframe has been reloaded, + // IE will throw "permission denied" error when accessing "document" variable, see jQuery #13936 + // IE6-8 do not support the defaultView property so parent will be undefined + if ( parent && parent !== parent.top ) { + // IE11 does not have attachEvent, so all must suffer + if ( parent.addEventListener ) { + parent.addEventListener( "unload", function() { + setDocument(); + }, false ); + } else if ( parent.attachEvent ) { + parent.attachEvent( "onunload", function() { + setDocument(); + }); + } + } + + /* Attributes + ---------------------------------------------------------------------- */ + + // Support: IE<8 + // Verify that getAttribute really returns attributes and not properties (excepting IE8 booleans) + support.attributes = assert(function( div ) { + div.className = "i"; + return !div.getAttribute("className"); + }); + + /* getElement(s)By* + ---------------------------------------------------------------------- */ + + // Check if getElementsByTagName("*") returns only elements + support.getElementsByTagName = assert(function( div ) { + div.appendChild( doc.createComment("") ); + return !div.getElementsByTagName("*").length; + }); + + // Check if getElementsByClassName can be trusted + support.getElementsByClassName = rnative.test( doc.getElementsByClassName ) && assert(function( div ) { + div.innerHTML = "<div class='a'></div><div class='a i'></div>"; + + // Support: Safari<4 + // Catch class over-caching + div.firstChild.className = "i"; + // Support: Opera<10 + // Catch gEBCN failure to find non-leading classes + return div.getElementsByClassName("i").length === 2; + }); + + // Support: IE<10 + // Check if getElementById returns elements by name + // The broken getElementById methods don't pick up programatically-set names, + // so use a roundabout getElementsByName test + support.getById = assert(function( div ) { + docElem.appendChild( div ).id = expando; + return !doc.getElementsByName || !doc.getElementsByName( expando ).length; + }); + + // ID find and filter + if ( support.getById ) { + Expr.find["ID"] = function( id, context ) { + if ( typeof context.getElementById !== strundefined && documentIsHTML ) { + var m = context.getElementById( id ); + // Check parentNode to catch when Blackberry 4.6 returns + // nodes that are no longer in the document #6963 + return m && m.parentNode ? [ m ] : []; + } + }; + Expr.filter["ID"] = function( id ) { + var attrId = id.replace( runescape, funescape ); + return function( elem ) { + return elem.getAttribute("id") === attrId; + }; + }; + } else { + // Support: IE6/7 + // getElementById is not reliable as a find shortcut + delete Expr.find["ID"]; + + Expr.filter["ID"] = function( id ) { + var attrId = id.replace( runescape, funescape ); + return function( elem ) { + var node = typeof elem.getAttributeNode !== strundefined && elem.getAttributeNode("id"); + return node && node.value === attrId; + }; + }; + } + + // Tag + Expr.find["TAG"] = support.getElementsByTagName ? + function( tag, context ) { + if ( typeof context.getElementsByTagName !== strundefined ) { + return context.getElementsByTagName( tag ); + } + } : + function( tag, context ) { + var elem, + tmp = [], + i = 0, + results = context.getElementsByTagName( tag ); + + // Filter out possible comments + if ( tag === "*" ) { + while ( (elem = results[i++]) ) { + if ( elem.nodeType === 1 ) { + tmp.push( elem ); + } + } + + return tmp; + } + return results; + }; + + // Class + Expr.find["CLASS"] = support.getElementsByClassName && function( className, context ) { + if ( typeof context.getElementsByClassName !== strundefined && documentIsHTML ) { + return context.getElementsByClassName( className ); + } + }; + + /* QSA/matchesSelector + ---------------------------------------------------------------------- */ + + // QSA and matchesSelector support + + // matchesSelector(:active) reports false when true (IE9/Opera 11.5) + rbuggyMatches = []; + + // qSa(:focus) reports false when true (Chrome 21) + // We allow this because of a bug in IE8/9 that throws an error + // whenever `document.activeElement` is accessed on an iframe + // So, we allow :focus to pass through QSA all the time to avoid the IE error + // See http://bugs.jquery.com/ticket/13378 + rbuggyQSA = []; + + if ( (support.qsa = rnative.test( doc.querySelectorAll )) ) { + // Build QSA regex + // Regex strategy adopted from Diego Perini + assert(function( div ) { + // Select is set to empty string on purpose + // This is to test IE's treatment of not explicitly + // setting a boolean content attribute, + // since its presence should be enough + // http://bugs.jquery.com/ticket/12359 + div.innerHTML = "<select msallowclip=''><option selected=''></option></select>"; + + // Support: IE8, Opera 11-12.16 + // Nothing should be selected when empty strings follow ^= or $= or *= + // The test attribute must be unknown in Opera but "safe" for WinRT + // http://msdn.microsoft.com/en-us/library/ie/hh465388.aspx#attribute_section + if ( div.querySelectorAll("[msallowclip^='']").length ) { + rbuggyQSA.push( "[*^$]=" + whitespace + "*(?:''|\"\")" ); + } + + // Support: IE8 + // Boolean attributes and "value" are not treated correctly + if ( !div.querySelectorAll("[selected]").length ) { + rbuggyQSA.push( "\\[" + whitespace + "*(?:value|" + booleans + ")" ); + } + + // Webkit/Opera - :checked should return selected option elements + // http://www.w3.org/TR/2011/REC-css3-selectors-20110929/#checked + // IE8 throws error here and will not see later tests + if ( !div.querySelectorAll(":checked").length ) { + rbuggyQSA.push(":checked"); + } + }); + + assert(function( div ) { + // Support: Windows 8 Native Apps + // The type and name attributes are restricted during .innerHTML assignment + var input = doc.createElement("input"); + input.setAttribute( "type", "hidden" ); + div.appendChild( input ).setAttribute( "name", "D" ); + + // Support: IE8 + // Enforce case-sensitivity of name attribute + if ( div.querySelectorAll("[name=d]").length ) { + rbuggyQSA.push( "name" + whitespace + "*[*^$|!~]?=" ); + } + + // FF 3.5 - :enabled/:disabled and hidden elements (hidden elements are still enabled) + // IE8 throws error here and will not see later tests + if ( !div.querySelectorAll(":enabled").length ) { + rbuggyQSA.push( ":enabled", ":disabled" ); + } + + // Opera 10-11 does not throw on post-comma invalid pseudos + div.querySelectorAll("*,:x"); + rbuggyQSA.push(",.*:"); + }); + } + + if ( (support.matchesSelector = rnative.test( (matches = docElem.matches || + docElem.webkitMatchesSelector || + docElem.mozMatchesSelector || + docElem.oMatchesSelector || + docElem.msMatchesSelector) )) ) { + + assert(function( div ) { + // Check to see if it's possible to do matchesSelector + // on a disconnected node (IE 9) + support.disconnectedMatch = matches.call( div, "div" ); + + // This should fail with an exception + // Gecko does not error, returns false instead + matches.call( div, "[s!='']:x" ); + rbuggyMatches.push( "!=", pseudos ); + }); + } + + rbuggyQSA = rbuggyQSA.length && new RegExp( rbuggyQSA.join("|") ); + rbuggyMatches = rbuggyMatches.length && new RegExp( rbuggyMatches.join("|") ); + + /* Contains + ---------------------------------------------------------------------- */ + hasCompare = rnative.test( docElem.compareDocumentPosition ); + + // Element contains another + // Purposefully does not implement inclusive descendent + // As in, an element does not contain itself + contains = hasCompare || rnative.test( docElem.contains ) ? + function( a, b ) { + var adown = a.nodeType === 9 ? a.documentElement : a, + bup = b && b.parentNode; + return a === bup || !!( bup && bup.nodeType === 1 && ( + adown.contains ? + adown.contains( bup ) : + a.compareDocumentPosition && a.compareDocumentPosition( bup ) & 16 + )); + } : + function( a, b ) { + if ( b ) { + while ( (b = b.parentNode) ) { + if ( b === a ) { + return true; + } + } + } + return false; + }; + + /* Sorting + ---------------------------------------------------------------------- */ + + // Document order sorting + sortOrder = hasCompare ? + function( a, b ) { + + // Flag for duplicate removal + if ( a === b ) { + hasDuplicate = true; + return 0; + } + + // Sort on method existence if only one input has compareDocumentPosition + var compare = !a.compareDocumentPosition - !b.compareDocumentPosition; + if ( compare ) { + return compare; + } + + // Calculate position if both inputs belong to the same document + compare = ( a.ownerDocument || a ) === ( b.ownerDocument || b ) ? + a.compareDocumentPosition( b ) : + + // Otherwise we know they are disconnected + 1; + + // Disconnected nodes + if ( compare & 1 || + (!support.sortDetached && b.compareDocumentPosition( a ) === compare) ) { + + // Choose the first element that is related to our preferred document + if ( a === doc || a.ownerDocument === preferredDoc && contains(preferredDoc, a) ) { + return -1; + } + if ( b === doc || b.ownerDocument === preferredDoc && contains(preferredDoc, b) ) { + return 1; + } + + // Maintain original order + return sortInput ? + ( indexOf.call( sortInput, a ) - indexOf.call( sortInput, b ) ) : + 0; + } + + return compare & 4 ? -1 : 1; + } : + function( a, b ) { + // Exit early if the nodes are identical + if ( a === b ) { + hasDuplicate = true; + return 0; + } + + var cur, + i = 0, + aup = a.parentNode, + bup = b.parentNode, + ap = [ a ], + bp = [ b ]; + + // Parentless nodes are either documents or disconnected + if ( !aup || !bup ) { + return a === doc ? -1 : + b === doc ? 1 : + aup ? -1 : + bup ? 1 : + sortInput ? + ( indexOf.call( sortInput, a ) - indexOf.call( sortInput, b ) ) : + 0; + + // If the nodes are siblings, we can do a quick check + } else if ( aup === bup ) { + return siblingCheck( a, b ); + } + + // Otherwise we need full lists of their ancestors for comparison + cur = a; + while ( (cur = cur.parentNode) ) { + ap.unshift( cur ); + } + cur = b; + while ( (cur = cur.parentNode) ) { + bp.unshift( cur ); + } + + // Walk down the tree looking for a discrepancy + while ( ap[i] === bp[i] ) { + i++; + } + + return i ? + // Do a sibling check if the nodes have a common ancestor + siblingCheck( ap[i], bp[i] ) : + + // Otherwise nodes in our document sort first + ap[i] === preferredDoc ? -1 : + bp[i] === preferredDoc ? 1 : + 0; + }; + + return doc; +}; + +Sizzle.matches = function( expr, elements ) { + return Sizzle( expr, null, null, elements ); +}; + +Sizzle.matchesSelector = function( elem, expr ) { + // Set document vars if needed + if ( ( elem.ownerDocument || elem ) !== document ) { + setDocument( elem ); + } + + // Make sure that attribute selectors are quoted + expr = expr.replace( rattributeQuotes, "='$1']" ); + + if ( support.matchesSelector && documentIsHTML && + ( !rbuggyMatches || !rbuggyMatches.test( expr ) ) && + ( !rbuggyQSA || !rbuggyQSA.test( expr ) ) ) { + + try { + var ret = matches.call( elem, expr ); + + // IE 9's matchesSelector returns false on disconnected nodes + if ( ret || support.disconnectedMatch || + // As well, disconnected nodes are said to be in a document + // fragment in IE 9 + elem.document && elem.document.nodeType !== 11 ) { + return ret; + } + } catch(e) {} + } + + return Sizzle( expr, document, null, [ elem ] ).length > 0; +}; + +Sizzle.contains = function( context, elem ) { + // Set document vars if needed + if ( ( context.ownerDocument || context ) !== document ) { + setDocument( context ); + } + return contains( context, elem ); +}; + +Sizzle.attr = function( elem, name ) { + // Set document vars if needed + if ( ( elem.ownerDocument || elem ) !== document ) { + setDocument( elem ); + } + + var fn = Expr.attrHandle[ name.toLowerCase() ], + // Don't get fooled by Object.prototype properties (jQuery #13807) + val = fn && hasOwn.call( Expr.attrHandle, name.toLowerCase() ) ? + fn( elem, name, !documentIsHTML ) : + undefined; + + return val !== undefined ? + val : + support.attributes || !documentIsHTML ? + elem.getAttribute( name ) : + (val = elem.getAttributeNode(name)) && val.specified ? + val.value : + null; +}; + +Sizzle.error = function( msg ) { + throw new Error( "Syntax error, unrecognized expression: " + msg ); +}; + +/** + * Document sorting and removing duplicates + * @param {ArrayLike} results + */ +Sizzle.uniqueSort = function( results ) { + var elem, + duplicates = [], + j = 0, + i = 0; + + // Unless we *know* we can detect duplicates, assume their presence + hasDuplicate = !support.detectDuplicates; + sortInput = !support.sortStable && results.slice( 0 ); + results.sort( sortOrder ); + + if ( hasDuplicate ) { + while ( (elem = results[i++]) ) { + if ( elem === results[ i ] ) { + j = duplicates.push( i ); + } + } + while ( j-- ) { + results.splice( duplicates[ j ], 1 ); + } + } + + // Clear input after sorting to release objects + // See https://github.com/jquery/sizzle/pull/225 + sortInput = null; + + return results; +}; + +/** + * Utility function for retrieving the text value of an array of DOM nodes + * @param {Array|Element} elem + */ +getText = Sizzle.getText = function( elem ) { + var node, + ret = "", + i = 0, + nodeType = elem.nodeType; + + if ( !nodeType ) { + // If no nodeType, this is expected to be an array + while ( (node = elem[i++]) ) { + // Do not traverse comment nodes + ret += getText( node ); + } + } else if ( nodeType === 1 || nodeType === 9 || nodeType === 11 ) { + // Use textContent for elements + // innerText usage removed for consistency of new lines (jQuery #11153) + if ( typeof elem.textContent === "string" ) { + return elem.textContent; + } else { + // Traverse its children + for ( elem = elem.firstChild; elem; elem = elem.nextSibling ) { + ret += getText( elem ); + } + } + } else if ( nodeType === 3 || nodeType === 4 ) { + return elem.nodeValue; + } + // Do not include comment or processing instruction nodes + + return ret; +}; + +Expr = Sizzle.selectors = { + + // Can be adjusted by the user + cacheLength: 50, + + createPseudo: markFunction, + + match: matchExpr, + + attrHandle: {}, + + find: {}, + + relative: { + ">": { dir: "parentNode", first: true }, + " ": { dir: "parentNode" }, + "+": { dir: "previousSibling", first: true }, + "~": { dir: "previousSibling" } + }, + + preFilter: { + "ATTR": function( match ) { + match[1] = match[1].replace( runescape, funescape ); + + // Move the given value to match[3] whether quoted or unquoted + match[3] = ( match[3] || match[4] || match[5] || "" ).replace( runescape, funescape ); + + if ( match[2] === "~=" ) { + match[3] = " " + match[3] + " "; + } + + return match.slice( 0, 4 ); + }, + + "CHILD": function( match ) { + /* matches from matchExpr["CHILD"] + 1 type (only|nth|...) + 2 what (child|of-type) + 3 argument (even|odd|\d*|\d*n([+-]\d+)?|...) + 4 xn-component of xn+y argument ([+-]?\d*n|) + 5 sign of xn-component + 6 x of xn-component + 7 sign of y-component + 8 y of y-component + */ + match[1] = match[1].toLowerCase(); + + if ( match[1].slice( 0, 3 ) === "nth" ) { + // nth-* requires argument + if ( !match[3] ) { + Sizzle.error( match[0] ); + } + + // numeric x and y parameters for Expr.filter.CHILD + // remember that false/true cast respectively to 0/1 + match[4] = +( match[4] ? match[5] + (match[6] || 1) : 2 * ( match[3] === "even" || match[3] === "odd" ) ); + match[5] = +( ( match[7] + match[8] ) || match[3] === "odd" ); + + // other types prohibit arguments + } else if ( match[3] ) { + Sizzle.error( match[0] ); + } + + return match; + }, + + "PSEUDO": function( match ) { + var excess, + unquoted = !match[6] && match[2]; + + if ( matchExpr["CHILD"].test( match[0] ) ) { + return null; + } + + // Accept quoted arguments as-is + if ( match[3] ) { + match[2] = match[4] || match[5] || ""; + + // Strip excess characters from unquoted arguments + } else if ( unquoted && rpseudo.test( unquoted ) && + // Get excess from tokenize (recursively) + (excess = tokenize( unquoted, true )) && + // advance to the next closing parenthesis + (excess = unquoted.indexOf( ")", unquoted.length - excess ) - unquoted.length) ) { + + // excess is a negative index + match[0] = match[0].slice( 0, excess ); + match[2] = unquoted.slice( 0, excess ); + } + + // Return only captures needed by the pseudo filter method (type and argument) + return match.slice( 0, 3 ); + } + }, + + filter: { + + "TAG": function( nodeNameSelector ) { + var nodeName = nodeNameSelector.replace( runescape, funescape ).toLowerCase(); + return nodeNameSelector === "*" ? + function() { return true; } : + function( elem ) { + return elem.nodeName && elem.nodeName.toLowerCase() === nodeName; + }; + }, + + "CLASS": function( className ) { + var pattern = classCache[ className + " " ]; + + return pattern || + (pattern = new RegExp( "(^|" + whitespace + ")" + className + "(" + whitespace + "|$)" )) && + classCache( className, function( elem ) { + return pattern.test( typeof elem.className === "string" && elem.className || typeof elem.getAttribute !== strundefined && elem.getAttribute("class") || "" ); + }); + }, + + "ATTR": function( name, operator, check ) { + return function( elem ) { + var result = Sizzle.attr( elem, name ); + + if ( result == null ) { + return operator === "!="; + } + if ( !operator ) { + return true; + } + + result += ""; + + return operator === "=" ? result === check : + operator === "!=" ? result !== check : + operator === "^=" ? check && result.indexOf( check ) === 0 : + operator === "*=" ? check && result.indexOf( check ) > -1 : + operator === "$=" ? check && result.slice( -check.length ) === check : + operator === "~=" ? ( " " + result + " " ).indexOf( check ) > -1 : + operator === "|=" ? result === check || result.slice( 0, check.length + 1 ) === check + "-" : + false; + }; + }, + + "CHILD": function( type, what, argument, first, last ) { + var simple = type.slice( 0, 3 ) !== "nth", + forward = type.slice( -4 ) !== "last", + ofType = what === "of-type"; + + return first === 1 && last === 0 ? + + // Shortcut for :nth-*(n) + function( elem ) { + return !!elem.parentNode; + } : + + function( elem, context, xml ) { + var cache, outerCache, node, diff, nodeIndex, start, + dir = simple !== forward ? "nextSibling" : "previousSibling", + parent = elem.parentNode, + name = ofType && elem.nodeName.toLowerCase(), + useCache = !xml && !ofType; + + if ( parent ) { + + // :(first|last|only)-(child|of-type) + if ( simple ) { + while ( dir ) { + node = elem; + while ( (node = node[ dir ]) ) { + if ( ofType ? node.nodeName.toLowerCase() === name : node.nodeType === 1 ) { + return false; + } + } + // Reverse direction for :only-* (if we haven't yet done so) + start = dir = type === "only" && !start && "nextSibling"; + } + return true; + } + + start = [ forward ? parent.firstChild : parent.lastChild ]; + + // non-xml :nth-child(...) stores cache data on `parent` + if ( forward && useCache ) { + // Seek `elem` from a previously-cached index + outerCache = parent[ expando ] || (parent[ expando ] = {}); + cache = outerCache[ type ] || []; + nodeIndex = cache[0] === dirruns && cache[1]; + diff = cache[0] === dirruns && cache[2]; + node = nodeIndex && parent.childNodes[ nodeIndex ]; + + while ( (node = ++nodeIndex && node && node[ dir ] || + + // Fallback to seeking `elem` from the start + (diff = nodeIndex = 0) || start.pop()) ) { + + // When found, cache indexes on `parent` and break + if ( node.nodeType === 1 && ++diff && node === elem ) { + outerCache[ type ] = [ dirruns, nodeIndex, diff ]; + break; + } + } + + // Use previously-cached element index if available + } else if ( useCache && (cache = (elem[ expando ] || (elem[ expando ] = {}))[ type ]) && cache[0] === dirruns ) { + diff = cache[1]; + + // xml :nth-child(...) or :nth-last-child(...) or :nth(-last)?-of-type(...) + } else { + // Use the same loop as above to seek `elem` from the start + while ( (node = ++nodeIndex && node && node[ dir ] || + (diff = nodeIndex = 0) || start.pop()) ) { + + if ( ( ofType ? node.nodeName.toLowerCase() === name : node.nodeType === 1 ) && ++diff ) { + // Cache the index of each encountered element + if ( useCache ) { + (node[ expando ] || (node[ expando ] = {}))[ type ] = [ dirruns, diff ]; + } + + if ( node === elem ) { + break; + } + } + } + } + + // Incorporate the offset, then check against cycle size + diff -= last; + return diff === first || ( diff % first === 0 && diff / first >= 0 ); + } + }; + }, + + "PSEUDO": function( pseudo, argument ) { + // pseudo-class names are case-insensitive + // http://www.w3.org/TR/selectors/#pseudo-classes + // Prioritize by case sensitivity in case custom pseudos are added with uppercase letters + // Remember that setFilters inherits from pseudos + var args, + fn = Expr.pseudos[ pseudo ] || Expr.setFilters[ pseudo.toLowerCase() ] || + Sizzle.error( "unsupported pseudo: " + pseudo ); + + // The user may use createPseudo to indicate that + // arguments are needed to create the filter function + // just as Sizzle does + if ( fn[ expando ] ) { + return fn( argument ); + } + + // But maintain support for old signatures + if ( fn.length > 1 ) { + args = [ pseudo, pseudo, "", argument ]; + return Expr.setFilters.hasOwnProperty( pseudo.toLowerCase() ) ? + markFunction(function( seed, matches ) { + var idx, + matched = fn( seed, argument ), + i = matched.length; + while ( i-- ) { + idx = indexOf.call( seed, matched[i] ); + seed[ idx ] = !( matches[ idx ] = matched[i] ); + } + }) : + function( elem ) { + return fn( elem, 0, args ); + }; + } + + return fn; + } + }, + + pseudos: { + // Potentially complex pseudos + "not": markFunction(function( selector ) { + // Trim the selector passed to compile + // to avoid treating leading and trailing + // spaces as combinators + var input = [], + results = [], + matcher = compile( selector.replace( rtrim, "$1" ) ); + + return matcher[ expando ] ? + markFunction(function( seed, matches, context, xml ) { + var elem, + unmatched = matcher( seed, null, xml, [] ), + i = seed.length; + + // Match elements unmatched by `matcher` + while ( i-- ) { + if ( (elem = unmatched[i]) ) { + seed[i] = !(matches[i] = elem); + } + } + }) : + function( elem, context, xml ) { + input[0] = elem; + matcher( input, null, xml, results ); + return !results.pop(); + }; + }), + + "has": markFunction(function( selector ) { + return function( elem ) { + return Sizzle( selector, elem ).length > 0; + }; + }), + + "contains": markFunction(function( text ) { + return function( elem ) { + return ( elem.textContent || elem.innerText || getText( elem ) ).indexOf( text ) > -1; + }; + }), + + // "Whether an element is represented by a :lang() selector + // is based solely on the element's language value + // being equal to the identifier C, + // or beginning with the identifier C immediately followed by "-". + // The matching of C against the element's language value is performed case-insensitively. + // The identifier C does not have to be a valid language name." + // http://www.w3.org/TR/selectors/#lang-pseudo + "lang": markFunction( function( lang ) { + // lang value must be a valid identifier + if ( !ridentifier.test(lang || "") ) { + Sizzle.error( "unsupported lang: " + lang ); + } + lang = lang.replace( runescape, funescape ).toLowerCase(); + return function( elem ) { + var elemLang; + do { + if ( (elemLang = documentIsHTML ? + elem.lang : + elem.getAttribute("xml:lang") || elem.getAttribute("lang")) ) { + + elemLang = elemLang.toLowerCase(); + return elemLang === lang || elemLang.indexOf( lang + "-" ) === 0; + } + } while ( (elem = elem.parentNode) && elem.nodeType === 1 ); + return false; + }; + }), + + // Miscellaneous + "target": function( elem ) { + var hash = window.location && window.location.hash; + return hash && hash.slice( 1 ) === elem.id; + }, + + "root": function( elem ) { + return elem === docElem; + }, + + "focus": function( elem ) { + return elem === document.activeElement && (!document.hasFocus || document.hasFocus()) && !!(elem.type || elem.href || ~elem.tabIndex); + }, + + // Boolean properties + "enabled": function( elem ) { + return elem.disabled === false; + }, + + "disabled": function( elem ) { + return elem.disabled === true; + }, + + "checked": function( elem ) { + // In CSS3, :checked should return both checked and selected elements + // http://www.w3.org/TR/2011/REC-css3-selectors-20110929/#checked + var nodeName = elem.nodeName.toLowerCase(); + return (nodeName === "input" && !!elem.checked) || (nodeName === "option" && !!elem.selected); + }, + + "selected": function( elem ) { + // Accessing this property makes selected-by-default + // options in Safari work properly + if ( elem.parentNode ) { + elem.parentNode.selectedIndex; + } + + return elem.selected === true; + }, + + // Contents + "empty": function( elem ) { + // http://www.w3.org/TR/selectors/#empty-pseudo + // :empty is negated by element (1) or content nodes (text: 3; cdata: 4; entity ref: 5), + // but not by others (comment: 8; processing instruction: 7; etc.) + // nodeType < 6 works because attributes (2) do not appear as children + for ( elem = elem.firstChild; elem; elem = elem.nextSibling ) { + if ( elem.nodeType < 6 ) { + return false; + } + } + return true; + }, + + "parent": function( elem ) { + return !Expr.pseudos["empty"]( elem ); + }, + + // Element/input types + "header": function( elem ) { + return rheader.test( elem.nodeName ); + }, + + "input": function( elem ) { + return rinputs.test( elem.nodeName ); + }, + + "button": function( elem ) { + var name = elem.nodeName.toLowerCase(); + return name === "input" && elem.type === "button" || name === "button"; + }, + + "text": function( elem ) { + var attr; + return elem.nodeName.toLowerCase() === "input" && + elem.type === "text" && + + // Support: IE<8 + // New HTML5 attribute values (e.g., "search") appear with elem.type === "text" + ( (attr = elem.getAttribute("type")) == null || attr.toLowerCase() === "text" ); + }, + + // Position-in-collection + "first": createPositionalPseudo(function() { + return [ 0 ]; + }), + + "last": createPositionalPseudo(function( matchIndexes, length ) { + return [ length - 1 ]; + }), + + "eq": createPositionalPseudo(function( matchIndexes, length, argument ) { + return [ argument < 0 ? argument + length : argument ]; + }), + + "even": createPositionalPseudo(function( matchIndexes, length ) { + var i = 0; + for ( ; i < length; i += 2 ) { + matchIndexes.push( i ); + } + return matchIndexes; + }), + + "odd": createPositionalPseudo(function( matchIndexes, length ) { + var i = 1; + for ( ; i < length; i += 2 ) { + matchIndexes.push( i ); + } + return matchIndexes; + }), + + "lt": createPositionalPseudo(function( matchIndexes, length, argument ) { + var i = argument < 0 ? argument + length : argument; + for ( ; --i >= 0; ) { + matchIndexes.push( i ); + } + return matchIndexes; + }), + + "gt": createPositionalPseudo(function( matchIndexes, length, argument ) { + var i = argument < 0 ? argument + length : argument; + for ( ; ++i < length; ) { + matchIndexes.push( i ); + } + return matchIndexes; + }) + } +}; + +Expr.pseudos["nth"] = Expr.pseudos["eq"]; + +// Add button/input type pseudos +for ( i in { radio: true, checkbox: true, file: true, password: true, image: true } ) { + Expr.pseudos[ i ] = createInputPseudo( i ); +} +for ( i in { submit: true, reset: true } ) { + Expr.pseudos[ i ] = createButtonPseudo( i ); +} + +// Easy API for creating new setFilters +function setFilters() {} +setFilters.prototype = Expr.filters = Expr.pseudos; +Expr.setFilters = new setFilters(); + +tokenize = Sizzle.tokenize = function( selector, parseOnly ) { + var matched, match, tokens, type, + soFar, groups, preFilters, + cached = tokenCache[ selector + " " ]; + + if ( cached ) { + return parseOnly ? 0 : cached.slice( 0 ); + } + + soFar = selector; + groups = []; + preFilters = Expr.preFilter; + + while ( soFar ) { + + // Comma and first run + if ( !matched || (match = rcomma.exec( soFar )) ) { + if ( match ) { + // Don't consume trailing commas as valid + soFar = soFar.slice( match[0].length ) || soFar; + } + groups.push( (tokens = []) ); + } + + matched = false; + + // Combinators + if ( (match = rcombinators.exec( soFar )) ) { + matched = match.shift(); + tokens.push({ + value: matched, + // Cast descendant combinators to space + type: match[0].replace( rtrim, " " ) + }); + soFar = soFar.slice( matched.length ); + } + + // Filters + for ( type in Expr.filter ) { + if ( (match = matchExpr[ type ].exec( soFar )) && (!preFilters[ type ] || + (match = preFilters[ type ]( match ))) ) { + matched = match.shift(); + tokens.push({ + value: matched, + type: type, + matches: match + }); + soFar = soFar.slice( matched.length ); + } + } + + if ( !matched ) { + break; + } + } + + // Return the length of the invalid excess + // if we're just parsing + // Otherwise, throw an error or return tokens + return parseOnly ? + soFar.length : + soFar ? + Sizzle.error( selector ) : + // Cache the tokens + tokenCache( selector, groups ).slice( 0 ); +}; + +function toSelector( tokens ) { + var i = 0, + len = tokens.length, + selector = ""; + for ( ; i < len; i++ ) { + selector += tokens[i].value; + } + return selector; +} + +function addCombinator( matcher, combinator, base ) { + var dir = combinator.dir, + checkNonElements = base && dir === "parentNode", + doneName = done++; + + return combinator.first ? + // Check against closest ancestor/preceding element + function( elem, context, xml ) { + while ( (elem = elem[ dir ]) ) { + if ( elem.nodeType === 1 || checkNonElements ) { + return matcher( elem, context, xml ); + } + } + } : + + // Check against all ancestor/preceding elements + function( elem, context, xml ) { + var oldCache, outerCache, + newCache = [ dirruns, doneName ]; + + // We can't set arbitrary data on XML nodes, so they don't benefit from dir caching + if ( xml ) { + while ( (elem = elem[ dir ]) ) { + if ( elem.nodeType === 1 || checkNonElements ) { + if ( matcher( elem, context, xml ) ) { + return true; + } + } + } + } else { + while ( (elem = elem[ dir ]) ) { + if ( elem.nodeType === 1 || checkNonElements ) { + outerCache = elem[ expando ] || (elem[ expando ] = {}); + if ( (oldCache = outerCache[ dir ]) && + oldCache[ 0 ] === dirruns && oldCache[ 1 ] === doneName ) { + + // Assign to newCache so results back-propagate to previous elements + return (newCache[ 2 ] = oldCache[ 2 ]); + } else { + // Reuse newcache so results back-propagate to previous elements + outerCache[ dir ] = newCache; + + // A match means we're done; a fail means we have to keep checking + if ( (newCache[ 2 ] = matcher( elem, context, xml )) ) { + return true; + } + } + } + } + } + }; +} + +function elementMatcher( matchers ) { + return matchers.length > 1 ? + function( elem, context, xml ) { + var i = matchers.length; + while ( i-- ) { + if ( !matchers[i]( elem, context, xml ) ) { + return false; + } + } + return true; + } : + matchers[0]; +} + +function multipleContexts( selector, contexts, results ) { + var i = 0, + len = contexts.length; + for ( ; i < len; i++ ) { + Sizzle( selector, contexts[i], results ); + } + return results; +} + +function condense( unmatched, map, filter, context, xml ) { + var elem, + newUnmatched = [], + i = 0, + len = unmatched.length, + mapped = map != null; + + for ( ; i < len; i++ ) { + if ( (elem = unmatched[i]) ) { + if ( !filter || filter( elem, context, xml ) ) { + newUnmatched.push( elem ); + if ( mapped ) { + map.push( i ); + } + } + } + } + + return newUnmatched; +} + +function setMatcher( preFilter, selector, matcher, postFilter, postFinder, postSelector ) { + if ( postFilter && !postFilter[ expando ] ) { + postFilter = setMatcher( postFilter ); + } + if ( postFinder && !postFinder[ expando ] ) { + postFinder = setMatcher( postFinder, postSelector ); + } + return markFunction(function( seed, results, context, xml ) { + var temp, i, elem, + preMap = [], + postMap = [], + preexisting = results.length, + + // Get initial elements from seed or context + elems = seed || multipleContexts( selector || "*", context.nodeType ? [ context ] : context, [] ), + + // Prefilter to get matcher input, preserving a map for seed-results synchronization + matcherIn = preFilter && ( seed || !selector ) ? + condense( elems, preMap, preFilter, context, xml ) : + elems, + + matcherOut = matcher ? + // If we have a postFinder, or filtered seed, or non-seed postFilter or preexisting results, + postFinder || ( seed ? preFilter : preexisting || postFilter ) ? + + // ...intermediate processing is necessary + [] : + + // ...otherwise use results directly + results : + matcherIn; + + // Find primary matches + if ( matcher ) { + matcher( matcherIn, matcherOut, context, xml ); + } + + // Apply postFilter + if ( postFilter ) { + temp = condense( matcherOut, postMap ); + postFilter( temp, [], context, xml ); + + // Un-match failing elements by moving them back to matcherIn + i = temp.length; + while ( i-- ) { + if ( (elem = temp[i]) ) { + matcherOut[ postMap[i] ] = !(matcherIn[ postMap[i] ] = elem); + } + } + } + + if ( seed ) { + if ( postFinder || preFilter ) { + if ( postFinder ) { + // Get the final matcherOut by condensing this intermediate into postFinder contexts + temp = []; + i = matcherOut.length; + while ( i-- ) { + if ( (elem = matcherOut[i]) ) { + // Restore matcherIn since elem is not yet a final match + temp.push( (matcherIn[i] = elem) ); + } + } + postFinder( null, (matcherOut = []), temp, xml ); + } + + // Move matched elements from seed to results to keep them synchronized + i = matcherOut.length; + while ( i-- ) { + if ( (elem = matcherOut[i]) && + (temp = postFinder ? indexOf.call( seed, elem ) : preMap[i]) > -1 ) { + + seed[temp] = !(results[temp] = elem); + } + } + } + + // Add elements to results, through postFinder if defined + } else { + matcherOut = condense( + matcherOut === results ? + matcherOut.splice( preexisting, matcherOut.length ) : + matcherOut + ); + if ( postFinder ) { + postFinder( null, results, matcherOut, xml ); + } else { + push.apply( results, matcherOut ); + } + } + }); +} + +function matcherFromTokens( tokens ) { + var checkContext, matcher, j, + len = tokens.length, + leadingRelative = Expr.relative[ tokens[0].type ], + implicitRelative = leadingRelative || Expr.relative[" "], + i = leadingRelative ? 1 : 0, + + // The foundational matcher ensures that elements are reachable from top-level context(s) + matchContext = addCombinator( function( elem ) { + return elem === checkContext; + }, implicitRelative, true ), + matchAnyContext = addCombinator( function( elem ) { + return indexOf.call( checkContext, elem ) > -1; + }, implicitRelative, true ), + matchers = [ function( elem, context, xml ) { + return ( !leadingRelative && ( xml || context !== outermostContext ) ) || ( + (checkContext = context).nodeType ? + matchContext( elem, context, xml ) : + matchAnyContext( elem, context, xml ) ); + } ]; + + for ( ; i < len; i++ ) { + if ( (matcher = Expr.relative[ tokens[i].type ]) ) { + matchers = [ addCombinator(elementMatcher( matchers ), matcher) ]; + } else { + matcher = Expr.filter[ tokens[i].type ].apply( null, tokens[i].matches ); + + // Return special upon seeing a positional matcher + if ( matcher[ expando ] ) { + // Find the next relative operator (if any) for proper handling + j = ++i; + for ( ; j < len; j++ ) { + if ( Expr.relative[ tokens[j].type ] ) { + break; + } + } + return setMatcher( + i > 1 && elementMatcher( matchers ), + i > 1 && toSelector( + // If the preceding token was a descendant combinator, insert an implicit any-element `*` + tokens.slice( 0, i - 1 ).concat({ value: tokens[ i - 2 ].type === " " ? "*" : "" }) + ).replace( rtrim, "$1" ), + matcher, + i < j && matcherFromTokens( tokens.slice( i, j ) ), + j < len && matcherFromTokens( (tokens = tokens.slice( j )) ), + j < len && toSelector( tokens ) + ); + } + matchers.push( matcher ); + } + } + + return elementMatcher( matchers ); +} + +function matcherFromGroupMatchers( elementMatchers, setMatchers ) { + var bySet = setMatchers.length > 0, + byElement = elementMatchers.length > 0, + superMatcher = function( seed, context, xml, results, outermost ) { + var elem, j, matcher, + matchedCount = 0, + i = "0", + unmatched = seed && [], + setMatched = [], + contextBackup = outermostContext, + // We must always have either seed elements or outermost context + elems = seed || byElement && Expr.find["TAG"]( "*", outermost ), + // Use integer dirruns iff this is the outermost matcher + dirrunsUnique = (dirruns += contextBackup == null ? 1 : Math.random() || 0.1), + len = elems.length; + + if ( outermost ) { + outermostContext = context !== document && context; + } + + // Add elements passing elementMatchers directly to results + // Keep `i` a string if there are no elements so `matchedCount` will be "00" below + // Support: IE<9, Safari + // Tolerate NodeList properties (IE: "length"; Safari: <number>) matching elements by id + for ( ; i !== len && (elem = elems[i]) != null; i++ ) { + if ( byElement && elem ) { + j = 0; + while ( (matcher = elementMatchers[j++]) ) { + if ( matcher( elem, context, xml ) ) { + results.push( elem ); + break; + } + } + if ( outermost ) { + dirruns = dirrunsUnique; + } + } + + // Track unmatched elements for set filters + if ( bySet ) { + // They will have gone through all possible matchers + if ( (elem = !matcher && elem) ) { + matchedCount--; + } + + // Lengthen the array for every element, matched or not + if ( seed ) { + unmatched.push( elem ); + } + } + } + + // Apply set filters to unmatched elements + matchedCount += i; + if ( bySet && i !== matchedCount ) { + j = 0; + while ( (matcher = setMatchers[j++]) ) { + matcher( unmatched, setMatched, context, xml ); + } + + if ( seed ) { + // Reintegrate element matches to eliminate the need for sorting + if ( matchedCount > 0 ) { + while ( i-- ) { + if ( !(unmatched[i] || setMatched[i]) ) { + setMatched[i] = pop.call( results ); + } + } + } + + // Discard index placeholder values to get only actual matches + setMatched = condense( setMatched ); + } + + // Add matches to results + push.apply( results, setMatched ); + + // Seedless set matches succeeding multiple successful matchers stipulate sorting + if ( outermost && !seed && setMatched.length > 0 && + ( matchedCount + setMatchers.length ) > 1 ) { + + Sizzle.uniqueSort( results ); + } + } + + // Override manipulation of globals by nested matchers + if ( outermost ) { + dirruns = dirrunsUnique; + outermostContext = contextBackup; + } + + return unmatched; + }; + + return bySet ? + markFunction( superMatcher ) : + superMatcher; +} + +compile = Sizzle.compile = function( selector, match /* Internal Use Only */ ) { + var i, + setMatchers = [], + elementMatchers = [], + cached = compilerCache[ selector + " " ]; + + if ( !cached ) { + // Generate a function of recursive functions that can be used to check each element + if ( !match ) { + match = tokenize( selector ); + } + i = match.length; + while ( i-- ) { + cached = matcherFromTokens( match[i] ); + if ( cached[ expando ] ) { + setMatchers.push( cached ); + } else { + elementMatchers.push( cached ); + } + } + + // Cache the compiled function + cached = compilerCache( selector, matcherFromGroupMatchers( elementMatchers, setMatchers ) ); + + // Save selector and tokenization + cached.selector = selector; + } + return cached; +}; + +/** + * A low-level selection function that works with Sizzle's compiled + * selector functions + * @param {String|Function} selector A selector or a pre-compiled + * selector function built with Sizzle.compile + * @param {Element} context + * @param {Array} [results] + * @param {Array} [seed] A set of elements to match against + */ +select = Sizzle.select = function( selector, context, results, seed ) { + var i, tokens, token, type, find, + compiled = typeof selector === "function" && selector, + match = !seed && tokenize( (selector = compiled.selector || selector) ); + + results = results || []; + + // Try to minimize operations if there is no seed and only one group + if ( match.length === 1 ) { + + // Take a shortcut and set the context if the root selector is an ID + tokens = match[0] = match[0].slice( 0 ); + if ( tokens.length > 2 && (token = tokens[0]).type === "ID" && + support.getById && context.nodeType === 9 && documentIsHTML && + Expr.relative[ tokens[1].type ] ) { + + context = ( Expr.find["ID"]( token.matches[0].replace(runescape, funescape), context ) || [] )[0]; + if ( !context ) { + return results; + + // Precompiled matchers will still verify ancestry, so step up a level + } else if ( compiled ) { + context = context.parentNode; + } + + selector = selector.slice( tokens.shift().value.length ); + } + + // Fetch a seed set for right-to-left matching + i = matchExpr["needsContext"].test( selector ) ? 0 : tokens.length; + while ( i-- ) { + token = tokens[i]; + + // Abort if we hit a combinator + if ( Expr.relative[ (type = token.type) ] ) { + break; + } + if ( (find = Expr.find[ type ]) ) { + // Search, expanding context for leading sibling combinators + if ( (seed = find( + token.matches[0].replace( runescape, funescape ), + rsibling.test( tokens[0].type ) && testContext( context.parentNode ) || context + )) ) { + + // If seed is empty or no tokens remain, we can return early + tokens.splice( i, 1 ); + selector = seed.length && toSelector( tokens ); + if ( !selector ) { + push.apply( results, seed ); + return results; + } + + break; + } + } + } + } + + // Compile and execute a filtering function if one is not provided + // Provide `match` to avoid retokenization if we modified the selector above + ( compiled || compile( selector, match ) )( + seed, + context, + !documentIsHTML, + results, + rsibling.test( selector ) && testContext( context.parentNode ) || context + ); + return results; +}; + +// One-time assignments + +// Sort stability +support.sortStable = expando.split("").sort( sortOrder ).join("") === expando; + +// Support: Chrome<14 +// Always assume duplicates if they aren't passed to the comparison function +support.detectDuplicates = !!hasDuplicate; + +// Initialize against the default document +setDocument(); + +// Support: Webkit<537.32 - Safari 6.0.3/Chrome 25 (fixed in Chrome 27) +// Detached nodes confoundingly follow *each other* +support.sortDetached = assert(function( div1 ) { + // Should return 1, but returns 4 (following) + return div1.compareDocumentPosition( document.createElement("div") ) & 1; +}); + +// Support: IE<8 +// Prevent attribute/property "interpolation" +// http://msdn.microsoft.com/en-us/library/ms536429%28VS.85%29.aspx +if ( !assert(function( div ) { + div.innerHTML = "<a href='#'></a>"; + return div.firstChild.getAttribute("href") === "#" ; +}) ) { + addHandle( "type|href|height|width", function( elem, name, isXML ) { + if ( !isXML ) { + return elem.getAttribute( name, name.toLowerCase() === "type" ? 1 : 2 ); + } + }); +} + +// Support: IE<9 +// Use defaultValue in place of getAttribute("value") +if ( !support.attributes || !assert(function( div ) { + div.innerHTML = "<input/>"; + div.firstChild.setAttribute( "value", "" ); + return div.firstChild.getAttribute( "value" ) === ""; +}) ) { + addHandle( "value", function( elem, name, isXML ) { + if ( !isXML && elem.nodeName.toLowerCase() === "input" ) { + return elem.defaultValue; + } + }); +} + +// Support: IE<9 +// Use getAttributeNode to fetch booleans when getAttribute lies +if ( !assert(function( div ) { + return div.getAttribute("disabled") == null; +}) ) { + addHandle( booleans, function( elem, name, isXML ) { + var val; + if ( !isXML ) { + return elem[ name ] === true ? name.toLowerCase() : + (val = elem.getAttributeNode( name )) && val.specified ? + val.value : + null; + } + }); +} + +return Sizzle; + +})( window ); + + + +jQuery.find = Sizzle; +jQuery.expr = Sizzle.selectors; +jQuery.expr[":"] = jQuery.expr.pseudos; +jQuery.unique = Sizzle.uniqueSort; +jQuery.text = Sizzle.getText; +jQuery.isXMLDoc = Sizzle.isXML; +jQuery.contains = Sizzle.contains; + + + +var rneedsContext = jQuery.expr.match.needsContext; + +var rsingleTag = (/^<(\w+)\s*\/?>(?:<\/\1>|)$/); + + + +var risSimple = /^.[^:#\[\.,]*$/; + +// Implement the identical functionality for filter and not +function winnow( elements, qualifier, not ) { + if ( jQuery.isFunction( qualifier ) ) { + return jQuery.grep( elements, function( elem, i ) { + /* jshint -W018 */ + return !!qualifier.call( elem, i, elem ) !== not; + }); + + } + + if ( qualifier.nodeType ) { + return jQuery.grep( elements, function( elem ) { + return ( elem === qualifier ) !== not; + }); + + } + + if ( typeof qualifier === "string" ) { + if ( risSimple.test( qualifier ) ) { + return jQuery.filter( qualifier, elements, not ); + } + + qualifier = jQuery.filter( qualifier, elements ); + } + + return jQuery.grep( elements, function( elem ) { + return ( jQuery.inArray( elem, qualifier ) >= 0 ) !== not; + }); +} + +jQuery.filter = function( expr, elems, not ) { + var elem = elems[ 0 ]; + + if ( not ) { + expr = ":not(" + expr + ")"; + } + + return elems.length === 1 && elem.nodeType === 1 ? + jQuery.find.matchesSelector( elem, expr ) ? [ elem ] : [] : + jQuery.find.matches( expr, jQuery.grep( elems, function( elem ) { + return elem.nodeType === 1; + })); +}; + +jQuery.fn.extend({ + find: function( selector ) { + var i, + ret = [], + self = this, + len = self.length; + + if ( typeof selector !== "string" ) { + return this.pushStack( jQuery( selector ).filter(function() { + for ( i = 0; i < len; i++ ) { + if ( jQuery.contains( self[ i ], this ) ) { + return true; + } + } + }) ); + } + + for ( i = 0; i < len; i++ ) { + jQuery.find( selector, self[ i ], ret ); + } + + // Needed because $( selector, context ) becomes $( context ).find( selector ) + ret = this.pushStack( len > 1 ? jQuery.unique( ret ) : ret ); + ret.selector = this.selector ? this.selector + " " + selector : selector; + return ret; + }, + filter: function( selector ) { + return this.pushStack( winnow(this, selector || [], false) ); + }, + not: function( selector ) { + return this.pushStack( winnow(this, selector || [], true) ); + }, + is: function( selector ) { + return !!winnow( + this, + + // If this is a positional/relative selector, check membership in the returned set + // so $("p:first").is("p:last") won't return true for a doc with two "p". + typeof selector === "string" && rneedsContext.test( selector ) ? + jQuery( selector ) : + selector || [], + false + ).length; + } +}); + + +// Initialize a jQuery object + + +// A central reference to the root jQuery(document) +var rootjQuery, + + // Use the correct document accordingly with window argument (sandbox) + document = window.document, + + // A simple way to check for HTML strings + // Prioritize #id over <tag> to avoid XSS via location.hash (#9521) + // Strict HTML recognition (#11290: must start with <) + rquickExpr = /^(?:\s*(<[\w\W]+>)[^>]*|#([\w-]*))$/, + + init = jQuery.fn.init = function( selector, context ) { + var match, elem; + + // HANDLE: $(""), $(null), $(undefined), $(false) + if ( !selector ) { + return this; + } + + // Handle HTML strings + if ( typeof selector === "string" ) { + if ( selector.charAt(0) === "<" && selector.charAt( selector.length - 1 ) === ">" && selector.length >= 3 ) { + // Assume that strings that start and end with <> are HTML and skip the regex check + match = [ null, selector, null ]; + + } else { + match = rquickExpr.exec( selector ); + } + + // Match html or make sure no context is specified for #id + if ( match && (match[1] || !context) ) { + + // HANDLE: $(html) -> $(array) + if ( match[1] ) { + context = context instanceof jQuery ? context[0] : context; + + // scripts is true for back-compat + // Intentionally let the error be thrown if parseHTML is not present + jQuery.merge( this, jQuery.parseHTML( + match[1], + context && context.nodeType ? context.ownerDocument || context : document, + true + ) ); + + // HANDLE: $(html, props) + if ( rsingleTag.test( match[1] ) && jQuery.isPlainObject( context ) ) { + for ( match in context ) { + // Properties of context are called as methods if possible + if ( jQuery.isFunction( this[ match ] ) ) { + this[ match ]( context[ match ] ); + + // ...and otherwise set as attributes + } else { + this.attr( match, context[ match ] ); + } + } + } + + return this; + + // HANDLE: $(#id) + } else { + elem = document.getElementById( match[2] ); + + // Check parentNode to catch when Blackberry 4.6 returns + // nodes that are no longer in the document #6963 + if ( elem && elem.parentNode ) { + // Handle the case where IE and Opera return items + // by name instead of ID + if ( elem.id !== match[2] ) { + return rootjQuery.find( selector ); + } + + // Otherwise, we inject the element directly into the jQuery object + this.length = 1; + this[0] = elem; + } + + this.context = document; + this.selector = selector; + return this; + } + + // HANDLE: $(expr, $(...)) + } else if ( !context || context.jquery ) { + return ( context || rootjQuery ).find( selector ); + + // HANDLE: $(expr, context) + // (which is just equivalent to: $(context).find(expr) + } else { + return this.constructor( context ).find( selector ); + } + + // HANDLE: $(DOMElement) + } else if ( selector.nodeType ) { + this.context = this[0] = selector; + this.length = 1; + return this; + + // HANDLE: $(function) + // Shortcut for document ready + } else if ( jQuery.isFunction( selector ) ) { + return typeof rootjQuery.ready !== "undefined" ? + rootjQuery.ready( selector ) : + // Execute immediately if ready is not present + selector( jQuery ); + } + + if ( selector.selector !== undefined ) { + this.selector = selector.selector; + this.context = selector.context; + } + + return jQuery.makeArray( selector, this ); + }; + +// Give the init function the jQuery prototype for later instantiation +init.prototype = jQuery.fn; + +// Initialize central reference +rootjQuery = jQuery( document ); + + +var rparentsprev = /^(?:parents|prev(?:Until|All))/, + // methods guaranteed to produce a unique set when starting from a unique set + guaranteedUnique = { + children: true, + contents: true, + next: true, + prev: true + }; + +jQuery.extend({ + dir: function( elem, dir, until ) { + var matched = [], + cur = elem[ dir ]; + + while ( cur && cur.nodeType !== 9 && (until === undefined || cur.nodeType !== 1 || !jQuery( cur ).is( until )) ) { + if ( cur.nodeType === 1 ) { + matched.push( cur ); + } + cur = cur[dir]; + } + return matched; + }, + + sibling: function( n, elem ) { + var r = []; + + for ( ; n; n = n.nextSibling ) { + if ( n.nodeType === 1 && n !== elem ) { + r.push( n ); + } + } + + return r; + } +}); + +jQuery.fn.extend({ + has: function( target ) { + var i, + targets = jQuery( target, this ), + len = targets.length; + + return this.filter(function() { + for ( i = 0; i < len; i++ ) { + if ( jQuery.contains( this, targets[i] ) ) { + return true; + } + } + }); + }, + + closest: function( selectors, context ) { + var cur, + i = 0, + l = this.length, + matched = [], + pos = rneedsContext.test( selectors ) || typeof selectors !== "string" ? + jQuery( selectors, context || this.context ) : + 0; + + for ( ; i < l; i++ ) { + for ( cur = this[i]; cur && cur !== context; cur = cur.parentNode ) { + // Always skip document fragments + if ( cur.nodeType < 11 && (pos ? + pos.index(cur) > -1 : + + // Don't pass non-elements to Sizzle + cur.nodeType === 1 && + jQuery.find.matchesSelector(cur, selectors)) ) { + + matched.push( cur ); + break; + } + } + } + + return this.pushStack( matched.length > 1 ? jQuery.unique( matched ) : matched ); + }, + + // Determine the position of an element within + // the matched set of elements + index: function( elem ) { + + // No argument, return index in parent + if ( !elem ) { + return ( this[0] && this[0].parentNode ) ? this.first().prevAll().length : -1; + } + + // index in selector + if ( typeof elem === "string" ) { + return jQuery.inArray( this[0], jQuery( elem ) ); + } + + // Locate the position of the desired element + return jQuery.inArray( + // If it receives a jQuery object, the first element is used + elem.jquery ? elem[0] : elem, this ); + }, + + add: function( selector, context ) { + return this.pushStack( + jQuery.unique( + jQuery.merge( this.get(), jQuery( selector, context ) ) + ) + ); + }, + + addBack: function( selector ) { + return this.add( selector == null ? + this.prevObject : this.prevObject.filter(selector) + ); + } +}); + +function sibling( cur, dir ) { + do { + cur = cur[ dir ]; + } while ( cur && cur.nodeType !== 1 ); + + return cur; +} + +jQuery.each({ + parent: function( elem ) { + var parent = elem.parentNode; + return parent && parent.nodeType !== 11 ? parent : null; + }, + parents: function( elem ) { + return jQuery.dir( elem, "parentNode" ); + }, + parentsUntil: function( elem, i, until ) { + return jQuery.dir( elem, "parentNode", until ); + }, + next: function( elem ) { + return sibling( elem, "nextSibling" ); + }, + prev: function( elem ) { + return sibling( elem, "previousSibling" ); + }, + nextAll: function( elem ) { + return jQuery.dir( elem, "nextSibling" ); + }, + prevAll: function( elem ) { + return jQuery.dir( elem, "previousSibling" ); + }, + nextUntil: function( elem, i, until ) { + return jQuery.dir( elem, "nextSibling", until ); + }, + prevUntil: function( elem, i, until ) { + return jQuery.dir( elem, "previousSibling", until ); + }, + siblings: function( elem ) { + return jQuery.sibling( ( elem.parentNode || {} ).firstChild, elem ); + }, + children: function( elem ) { + return jQuery.sibling( elem.firstChild ); + }, + contents: function( elem ) { + return jQuery.nodeName( elem, "iframe" ) ? + elem.contentDocument || elem.contentWindow.document : + jQuery.merge( [], elem.childNodes ); + } +}, function( name, fn ) { + jQuery.fn[ name ] = function( until, selector ) { + var ret = jQuery.map( this, fn, until ); + + if ( name.slice( -5 ) !== "Until" ) { + selector = until; + } + + if ( selector && typeof selector === "string" ) { + ret = jQuery.filter( selector, ret ); + } + + if ( this.length > 1 ) { + // Remove duplicates + if ( !guaranteedUnique[ name ] ) { + ret = jQuery.unique( ret ); + } + + // Reverse order for parents* and prev-derivatives + if ( rparentsprev.test( name ) ) { + ret = ret.reverse(); + } + } + + return this.pushStack( ret ); + }; +}); +var rnotwhite = (/\S+/g); + + + +// String to Object options format cache +var optionsCache = {}; + +// Convert String-formatted options into Object-formatted ones and store in cache +function createOptions( options ) { + var object = optionsCache[ options ] = {}; + jQuery.each( options.match( rnotwhite ) || [], function( _, flag ) { + object[ flag ] = true; + }); + return object; +} + +/* + * Create a callback list using the following parameters: + * + * options: an optional list of space-separated options that will change how + * the callback list behaves or a more traditional option object + * + * By default a callback list will act like an event callback list and can be + * "fired" multiple times. + * + * Possible options: + * + * once: will ensure the callback list can only be fired once (like a Deferred) + * + * memory: will keep track of previous values and will call any callback added + * after the list has been fired right away with the latest "memorized" + * values (like a Deferred) + * + * unique: will ensure a callback can only be added once (no duplicate in the list) + * + * stopOnFalse: interrupt callings when a callback returns false + * + */ +jQuery.Callbacks = function( options ) { + + // Convert options from String-formatted to Object-formatted if needed + // (we check in cache first) + options = typeof options === "string" ? + ( optionsCache[ options ] || createOptions( options ) ) : + jQuery.extend( {}, options ); + + var // Flag to know if list is currently firing + firing, + // Last fire value (for non-forgettable lists) + memory, + // Flag to know if list was already fired + fired, + // End of the loop when firing + firingLength, + // Index of currently firing callback (modified by remove if needed) + firingIndex, + // First callback to fire (used internally by add and fireWith) + firingStart, + // Actual callback list + list = [], + // Stack of fire calls for repeatable lists + stack = !options.once && [], + // Fire callbacks + fire = function( data ) { + memory = options.memory && data; + fired = true; + firingIndex = firingStart || 0; + firingStart = 0; + firingLength = list.length; + firing = true; + for ( ; list && firingIndex < firingLength; firingIndex++ ) { + if ( list[ firingIndex ].apply( data[ 0 ], data[ 1 ] ) === false && options.stopOnFalse ) { + memory = false; // To prevent further calls using add + break; + } + } + firing = false; + if ( list ) { + if ( stack ) { + if ( stack.length ) { + fire( stack.shift() ); + } + } else if ( memory ) { + list = []; + } else { + self.disable(); + } + } + }, + // Actual Callbacks object + self = { + // Add a callback or a collection of callbacks to the list + add: function() { + if ( list ) { + // First, we save the current length + var start = list.length; + (function add( args ) { + jQuery.each( args, function( _, arg ) { + var type = jQuery.type( arg ); + if ( type === "function" ) { + if ( !options.unique || !self.has( arg ) ) { + list.push( arg ); + } + } else if ( arg && arg.length && type !== "string" ) { + // Inspect recursively + add( arg ); + } + }); + })( arguments ); + // Do we need to add the callbacks to the + // current firing batch? + if ( firing ) { + firingLength = list.length; + // With memory, if we're not firing then + // we should call right away + } else if ( memory ) { + firingStart = start; + fire( memory ); + } + } + return this; + }, + // Remove a callback from the list + remove: function() { + if ( list ) { + jQuery.each( arguments, function( _, arg ) { + var index; + while ( ( index = jQuery.inArray( arg, list, index ) ) > -1 ) { + list.splice( index, 1 ); + // Handle firing indexes + if ( firing ) { + if ( index <= firingLength ) { + firingLength--; + } + if ( index <= firingIndex ) { + firingIndex--; + } + } + } + }); + } + return this; + }, + // Check if a given callback is in the list. + // If no argument is given, return whether or not list has callbacks attached. + has: function( fn ) { + return fn ? jQuery.inArray( fn, list ) > -1 : !!( list && list.length ); + }, + // Remove all callbacks from the list + empty: function() { + list = []; + firingLength = 0; + return this; + }, + // Have the list do nothing anymore + disable: function() { + list = stack = memory = undefined; + return this; + }, + // Is it disabled? + disabled: function() { + return !list; + }, + // Lock the list in its current state + lock: function() { + stack = undefined; + if ( !memory ) { + self.disable(); + } + return this; + }, + // Is it locked? + locked: function() { + return !stack; + }, + // Call all callbacks with the given context and arguments + fireWith: function( context, args ) { + if ( list && ( !fired || stack ) ) { + args = args || []; + args = [ context, args.slice ? args.slice() : args ]; + if ( firing ) { + stack.push( args ); + } else { + fire( args ); + } + } + return this; + }, + // Call all the callbacks with the given arguments + fire: function() { + self.fireWith( this, arguments ); + return this; + }, + // To know if the callbacks have already been called at least once + fired: function() { + return !!fired; + } + }; + + return self; +}; + + +jQuery.extend({ + + Deferred: function( func ) { + var tuples = [ + // action, add listener, listener list, final state + [ "resolve", "done", jQuery.Callbacks("once memory"), "resolved" ], + [ "reject", "fail", jQuery.Callbacks("once memory"), "rejected" ], + [ "notify", "progress", jQuery.Callbacks("memory") ] + ], + state = "pending", + promise = { + state: function() { + return state; + }, + always: function() { + deferred.done( arguments ).fail( arguments ); + return this; + }, + then: function( /* fnDone, fnFail, fnProgress */ ) { + var fns = arguments; + return jQuery.Deferred(function( newDefer ) { + jQuery.each( tuples, function( i, tuple ) { + var fn = jQuery.isFunction( fns[ i ] ) && fns[ i ]; + // deferred[ done | fail | progress ] for forwarding actions to newDefer + deferred[ tuple[1] ](function() { + var returned = fn && fn.apply( this, arguments ); + if ( returned && jQuery.isFunction( returned.promise ) ) { + returned.promise() + .done( newDefer.resolve ) + .fail( newDefer.reject ) + .progress( newDefer.notify ); + } else { + newDefer[ tuple[ 0 ] + "With" ]( this === promise ? newDefer.promise() : this, fn ? [ returned ] : arguments ); + } + }); + }); + fns = null; + }).promise(); + }, + // Get a promise for this deferred + // If obj is provided, the promise aspect is added to the object + promise: function( obj ) { + return obj != null ? jQuery.extend( obj, promise ) : promise; + } + }, + deferred = {}; + + // Keep pipe for back-compat + promise.pipe = promise.then; + + // Add list-specific methods + jQuery.each( tuples, function( i, tuple ) { + var list = tuple[ 2 ], + stateString = tuple[ 3 ]; + + // promise[ done | fail | progress ] = list.add + promise[ tuple[1] ] = list.add; + + // Handle state + if ( stateString ) { + list.add(function() { + // state = [ resolved | rejected ] + state = stateString; + + // [ reject_list | resolve_list ].disable; progress_list.lock + }, tuples[ i ^ 1 ][ 2 ].disable, tuples[ 2 ][ 2 ].lock ); + } + + // deferred[ resolve | reject | notify ] + deferred[ tuple[0] ] = function() { + deferred[ tuple[0] + "With" ]( this === deferred ? promise : this, arguments ); + return this; + }; + deferred[ tuple[0] + "With" ] = list.fireWith; + }); + + // Make the deferred a promise + promise.promise( deferred ); + + // Call given func if any + if ( func ) { + func.call( deferred, deferred ); + } + + // All done! + return deferred; + }, + + // Deferred helper + when: function( subordinate /* , ..., subordinateN */ ) { + var i = 0, + resolveValues = slice.call( arguments ), + length = resolveValues.length, + + // the count of uncompleted subordinates + remaining = length !== 1 || ( subordinate && jQuery.isFunction( subordinate.promise ) ) ? length : 0, + + // the master Deferred. If resolveValues consist of only a single Deferred, just use that. + deferred = remaining === 1 ? subordinate : jQuery.Deferred(), + + // Update function for both resolve and progress values + updateFunc = function( i, contexts, values ) { + return function( value ) { + contexts[ i ] = this; + values[ i ] = arguments.length > 1 ? slice.call( arguments ) : value; + if ( values === progressValues ) { + deferred.notifyWith( contexts, values ); + + } else if ( !(--remaining) ) { + deferred.resolveWith( contexts, values ); + } + }; + }, + + progressValues, progressContexts, resolveContexts; + + // add listeners to Deferred subordinates; treat others as resolved + if ( length > 1 ) { + progressValues = new Array( length ); + progressContexts = new Array( length ); + resolveContexts = new Array( length ); + for ( ; i < length; i++ ) { + if ( resolveValues[ i ] && jQuery.isFunction( resolveValues[ i ].promise ) ) { + resolveValues[ i ].promise() + .done( updateFunc( i, resolveContexts, resolveValues ) ) + .fail( deferred.reject ) + .progress( updateFunc( i, progressContexts, progressValues ) ); + } else { + --remaining; + } + } + } + + // if we're not waiting on anything, resolve the master + if ( !remaining ) { + deferred.resolveWith( resolveContexts, resolveValues ); + } + + return deferred.promise(); + } +}); + + +// The deferred used on DOM ready +var readyList; + +jQuery.fn.ready = function( fn ) { + // Add the callback + jQuery.ready.promise().done( fn ); + + return this; +}; + +jQuery.extend({ + // Is the DOM ready to be used? Set to true once it occurs. + isReady: false, + + // A counter to track how many items to wait for before + // the ready event fires. See #6781 + readyWait: 1, + + // Hold (or release) the ready event + holdReady: function( hold ) { + if ( hold ) { + jQuery.readyWait++; + } else { + jQuery.ready( true ); + } + }, + + // Handle when the DOM is ready + ready: function( wait ) { + + // Abort if there are pending holds or we're already ready + if ( wait === true ? --jQuery.readyWait : jQuery.isReady ) { + return; + } + + // Make sure body exists, at least, in case IE gets a little overzealous (ticket #5443). + if ( !document.body ) { + return setTimeout( jQuery.ready ); + } + + // Remember that the DOM is ready + jQuery.isReady = true; + + // If a normal DOM Ready event fired, decrement, and wait if need be + if ( wait !== true && --jQuery.readyWait > 0 ) { + return; + } + + // If there are functions bound, to execute + readyList.resolveWith( document, [ jQuery ] ); + + // Trigger any bound ready events + if ( jQuery.fn.triggerHandler ) { + jQuery( document ).triggerHandler( "ready" ); + jQuery( document ).off( "ready" ); + } + } +}); + +/** + * Clean-up method for dom ready events + */ +function detach() { + if ( document.addEventListener ) { + document.removeEventListener( "DOMContentLoaded", completed, false ); + window.removeEventListener( "load", completed, false ); + + } else { + document.detachEvent( "onreadystatechange", completed ); + window.detachEvent( "onload", completed ); + } +} + +/** + * The ready event handler and self cleanup method + */ +function completed() { + // readyState === "complete" is good enough for us to call the dom ready in oldIE + if ( document.addEventListener || event.type === "load" || document.readyState === "complete" ) { + detach(); + jQuery.ready(); + } +} + +jQuery.ready.promise = function( obj ) { + if ( !readyList ) { + + readyList = jQuery.Deferred(); + + // Catch cases where $(document).ready() is called after the browser event has already occurred. + // we once tried to use readyState "interactive" here, but it caused issues like the one + // discovered by ChrisS here: http://bugs.jquery.com/ticket/12282#comment:15 + if ( document.readyState === "complete" ) { + // Handle it asynchronously to allow scripts the opportunity to delay ready + setTimeout( jQuery.ready ); + + // Standards-based browsers support DOMContentLoaded + } else if ( document.addEventListener ) { + // Use the handy event callback + document.addEventListener( "DOMContentLoaded", completed, false ); + + // A fallback to window.onload, that will always work + window.addEventListener( "load", completed, false ); + + // If IE event model is used + } else { + // Ensure firing before onload, maybe late but safe also for iframes + document.attachEvent( "onreadystatechange", completed ); + + // A fallback to window.onload, that will always work + window.attachEvent( "onload", completed ); + + // If IE and not a frame + // continually check to see if the document is ready + var top = false; + + try { + top = window.frameElement == null && document.documentElement; + } catch(e) {} + + if ( top && top.doScroll ) { + (function doScrollCheck() { + if ( !jQuery.isReady ) { + + try { + // Use the trick by Diego Perini + // http://javascript.nwbox.com/IEContentLoaded/ + top.doScroll("left"); + } catch(e) { + return setTimeout( doScrollCheck, 50 ); + } + + // detach all dom ready events + detach(); + + // and execute any waiting functions + jQuery.ready(); + } + })(); + } + } + } + return readyList.promise( obj ); +}; + + +var strundefined = typeof undefined; + + + +// Support: IE<9 +// Iteration over object's inherited properties before its own +var i; +for ( i in jQuery( support ) ) { + break; +} +support.ownLast = i !== "0"; + +// Note: most support tests are defined in their respective modules. +// false until the test is run +support.inlineBlockNeedsLayout = false; + +// Execute ASAP in case we need to set body.style.zoom +jQuery(function() { + // Minified: var a,b,c,d + var val, div, body, container; + + body = document.getElementsByTagName( "body" )[ 0 ]; + if ( !body || !body.style ) { + // Return for frameset docs that don't have a body + return; + } + + // Setup + div = document.createElement( "div" ); + container = document.createElement( "div" ); + container.style.cssText = "position:absolute;border:0;width:0;height:0;top:0;left:-9999px"; + body.appendChild( container ).appendChild( div ); + + if ( typeof div.style.zoom !== strundefined ) { + // Support: IE<8 + // Check if natively block-level elements act like inline-block + // elements when setting their display to 'inline' and giving + // them layout + div.style.cssText = "display:inline;margin:0;border:0;padding:1px;width:1px;zoom:1"; + + support.inlineBlockNeedsLayout = val = div.offsetWidth === 3; + if ( val ) { + // Prevent IE 6 from affecting layout for positioned elements #11048 + // Prevent IE from shrinking the body in IE 7 mode #12869 + // Support: IE<8 + body.style.zoom = 1; + } + } + + body.removeChild( container ); +}); + + + + +(function() { + var div = document.createElement( "div" ); + + // Execute the test only if not already executed in another module. + if (support.deleteExpando == null) { + // Support: IE<9 + support.deleteExpando = true; + try { + delete div.test; + } catch( e ) { + support.deleteExpando = false; + } + } + + // Null elements to avoid leaks in IE. + div = null; +})(); + + +/** + * Determines whether an object can have data + */ +jQuery.acceptData = function( elem ) { + var noData = jQuery.noData[ (elem.nodeName + " ").toLowerCase() ], + nodeType = +elem.nodeType || 1; + + // Do not set data on non-element DOM nodes because it will not be cleared (#8335). + return nodeType !== 1 && nodeType !== 9 ? + false : + + // Nodes accept data unless otherwise specified; rejection can be conditional + !noData || noData !== true && elem.getAttribute("classid") === noData; +}; + + +var rbrace = /^(?:\{[\w\W]*\}|\[[\w\W]*\])$/, + rmultiDash = /([A-Z])/g; + +function dataAttr( elem, key, data ) { + // If nothing was found internally, try to fetch any + // data from the HTML5 data-* attribute + if ( data === undefined && elem.nodeType === 1 ) { + + var name = "data-" + key.replace( rmultiDash, "-$1" ).toLowerCase(); + + data = elem.getAttribute( name ); + + if ( typeof data === "string" ) { + try { + data = data === "true" ? true : + data === "false" ? false : + data === "null" ? null : + // Only convert to a number if it doesn't change the string + +data + "" === data ? +data : + rbrace.test( data ) ? jQuery.parseJSON( data ) : + data; + } catch( e ) {} + + // Make sure we set the data so it isn't changed later + jQuery.data( elem, key, data ); + + } else { + data = undefined; + } + } + + return data; +} + +// checks a cache object for emptiness +function isEmptyDataObject( obj ) { + var name; + for ( name in obj ) { + + // if the public data object is empty, the private is still empty + if ( name === "data" && jQuery.isEmptyObject( obj[name] ) ) { + continue; + } + if ( name !== "toJSON" ) { + return false; + } + } + + return true; +} + +function internalData( elem, name, data, pvt /* Internal Use Only */ ) { + if ( !jQuery.acceptData( elem ) ) { + return; + } + + var ret, thisCache, + internalKey = jQuery.expando, + + // We have to handle DOM nodes and JS objects differently because IE6-7 + // can't GC object references properly across the DOM-JS boundary + isNode = elem.nodeType, + + // Only DOM nodes need the global jQuery cache; JS object data is + // attached directly to the object so GC can occur automatically + cache = isNode ? jQuery.cache : elem, + + // Only defining an ID for JS objects if its cache already exists allows + // the code to shortcut on the same path as a DOM node with no cache + id = isNode ? elem[ internalKey ] : elem[ internalKey ] && internalKey; + + // Avoid doing any more work than we need to when trying to get data on an + // object that has no data at all + if ( (!id || !cache[id] || (!pvt && !cache[id].data)) && data === undefined && typeof name === "string" ) { + return; + } + + if ( !id ) { + // Only DOM nodes need a new unique ID for each element since their data + // ends up in the global cache + if ( isNode ) { + id = elem[ internalKey ] = deletedIds.pop() || jQuery.guid++; + } else { + id = internalKey; + } + } + + if ( !cache[ id ] ) { + // Avoid exposing jQuery metadata on plain JS objects when the object + // is serialized using JSON.stringify + cache[ id ] = isNode ? {} : { toJSON: jQuery.noop }; + } + + // An object can be passed to jQuery.data instead of a key/value pair; this gets + // shallow copied over onto the existing cache + if ( typeof name === "object" || typeof name === "function" ) { + if ( pvt ) { + cache[ id ] = jQuery.extend( cache[ id ], name ); + } else { + cache[ id ].data = jQuery.extend( cache[ id ].data, name ); + } + } + + thisCache = cache[ id ]; + + // jQuery data() is stored in a separate object inside the object's internal data + // cache in order to avoid key collisions between internal data and user-defined + // data. + if ( !pvt ) { + if ( !thisCache.data ) { + thisCache.data = {}; + } + + thisCache = thisCache.data; + } + + if ( data !== undefined ) { + thisCache[ jQuery.camelCase( name ) ] = data; + } + + // Check for both converted-to-camel and non-converted data property names + // If a data property was specified + if ( typeof name === "string" ) { + + // First Try to find as-is property data + ret = thisCache[ name ]; + + // Test for null|undefined property data + if ( ret == null ) { + + // Try to find the camelCased property + ret = thisCache[ jQuery.camelCase( name ) ]; + } + } else { + ret = thisCache; + } + + return ret; +} + +function internalRemoveData( elem, name, pvt ) { + if ( !jQuery.acceptData( elem ) ) { + return; + } + + var thisCache, i, + isNode = elem.nodeType, + + // See jQuery.data for more information + cache = isNode ? jQuery.cache : elem, + id = isNode ? elem[ jQuery.expando ] : jQuery.expando; + + // If there is already no cache entry for this object, there is no + // purpose in continuing + if ( !cache[ id ] ) { + return; + } + + if ( name ) { + + thisCache = pvt ? cache[ id ] : cache[ id ].data; + + if ( thisCache ) { + + // Support array or space separated string names for data keys + if ( !jQuery.isArray( name ) ) { + + // try the string as a key before any manipulation + if ( name in thisCache ) { + name = [ name ]; + } else { + + // split the camel cased version by spaces unless a key with the spaces exists + name = jQuery.camelCase( name ); + if ( name in thisCache ) { + name = [ name ]; + } else { + name = name.split(" "); + } + } + } else { + // If "name" is an array of keys... + // When data is initially created, via ("key", "val") signature, + // keys will be converted to camelCase. + // Since there is no way to tell _how_ a key was added, remove + // both plain key and camelCase key. #12786 + // This will only penalize the array argument path. + name = name.concat( jQuery.map( name, jQuery.camelCase ) ); + } + + i = name.length; + while ( i-- ) { + delete thisCache[ name[i] ]; + } + + // If there is no data left in the cache, we want to continue + // and let the cache object itself get destroyed + if ( pvt ? !isEmptyDataObject(thisCache) : !jQuery.isEmptyObject(thisCache) ) { + return; + } + } + } + + // See jQuery.data for more information + if ( !pvt ) { + delete cache[ id ].data; + + // Don't destroy the parent cache unless the internal data object + // had been the only thing left in it + if ( !isEmptyDataObject( cache[ id ] ) ) { + return; + } + } + + // Destroy the cache + if ( isNode ) { + jQuery.cleanData( [ elem ], true ); + + // Use delete when supported for expandos or `cache` is not a window per isWindow (#10080) + /* jshint eqeqeq: false */ + } else if ( support.deleteExpando || cache != cache.window ) { + /* jshint eqeqeq: true */ + delete cache[ id ]; + + // When all else fails, null + } else { + cache[ id ] = null; + } +} + +jQuery.extend({ + cache: {}, + + // The following elements (space-suffixed to avoid Object.prototype collisions) + // throw uncatchable exceptions if you attempt to set expando properties + noData: { + "applet ": true, + "embed ": true, + // ...but Flash objects (which have this classid) *can* handle expandos + "object ": "clsid:D27CDB6E-AE6D-11cf-96B8-444553540000" + }, + + hasData: function( elem ) { + elem = elem.nodeType ? jQuery.cache[ elem[jQuery.expando] ] : elem[ jQuery.expando ]; + return !!elem && !isEmptyDataObject( elem ); + }, + + data: function( elem, name, data ) { + return internalData( elem, name, data ); + }, + + removeData: function( elem, name ) { + return internalRemoveData( elem, name ); + }, + + // For internal use only. + _data: function( elem, name, data ) { + return internalData( elem, name, data, true ); + }, + + _removeData: function( elem, name ) { + return internalRemoveData( elem, name, true ); + } +}); + +jQuery.fn.extend({ + data: function( key, value ) { + var i, name, data, + elem = this[0], + attrs = elem && elem.attributes; + + // Special expections of .data basically thwart jQuery.access, + // so implement the relevant behavior ourselves + + // Gets all values + if ( key === undefined ) { + if ( this.length ) { + data = jQuery.data( elem ); + + if ( elem.nodeType === 1 && !jQuery._data( elem, "parsedAttrs" ) ) { + i = attrs.length; + while ( i-- ) { + + // Support: IE11+ + // The attrs elements can be null (#14894) + if ( attrs[ i ] ) { + name = attrs[ i ].name; + if ( name.indexOf( "data-" ) === 0 ) { + name = jQuery.camelCase( name.slice(5) ); + dataAttr( elem, name, data[ name ] ); + } + } + } + jQuery._data( elem, "parsedAttrs", true ); + } + } + + return data; + } + + // Sets multiple values + if ( typeof key === "object" ) { + return this.each(function() { + jQuery.data( this, key ); + }); + } + + return arguments.length > 1 ? + + // Sets one value + this.each(function() { + jQuery.data( this, key, value ); + }) : + + // Gets one value + // Try to fetch any internally stored data first + elem ? dataAttr( elem, key, jQuery.data( elem, key ) ) : undefined; + }, + + removeData: function( key ) { + return this.each(function() { + jQuery.removeData( this, key ); + }); + } +}); + + +jQuery.extend({ + queue: function( elem, type, data ) { + var queue; + + if ( elem ) { + type = ( type || "fx" ) + "queue"; + queue = jQuery._data( elem, type ); + + // Speed up dequeue by getting out quickly if this is just a lookup + if ( data ) { + if ( !queue || jQuery.isArray(data) ) { + queue = jQuery._data( elem, type, jQuery.makeArray(data) ); + } else { + queue.push( data ); + } + } + return queue || []; + } + }, + + dequeue: function( elem, type ) { + type = type || "fx"; + + var queue = jQuery.queue( elem, type ), + startLength = queue.length, + fn = queue.shift(), + hooks = jQuery._queueHooks( elem, type ), + next = function() { + jQuery.dequeue( elem, type ); + }; + + // If the fx queue is dequeued, always remove the progress sentinel + if ( fn === "inprogress" ) { + fn = queue.shift(); + startLength--; + } + + if ( fn ) { + + // Add a progress sentinel to prevent the fx queue from being + // automatically dequeued + if ( type === "fx" ) { + queue.unshift( "inprogress" ); + } + + // clear up the last queue stop function + delete hooks.stop; + fn.call( elem, next, hooks ); + } + + if ( !startLength && hooks ) { + hooks.empty.fire(); + } + }, + + // not intended for public consumption - generates a queueHooks object, or returns the current one + _queueHooks: function( elem, type ) { + var key = type + "queueHooks"; + return jQuery._data( elem, key ) || jQuery._data( elem, key, { + empty: jQuery.Callbacks("once memory").add(function() { + jQuery._removeData( elem, type + "queue" ); + jQuery._removeData( elem, key ); + }) + }); + } +}); + +jQuery.fn.extend({ + queue: function( type, data ) { + var setter = 2; + + if ( typeof type !== "string" ) { + data = type; + type = "fx"; + setter--; + } + + if ( arguments.length < setter ) { + return jQuery.queue( this[0], type ); + } + + return data === undefined ? + this : + this.each(function() { + var queue = jQuery.queue( this, type, data ); + + // ensure a hooks for this queue + jQuery._queueHooks( this, type ); + + if ( type === "fx" && queue[0] !== "inprogress" ) { + jQuery.dequeue( this, type ); + } + }); + }, + dequeue: function( type ) { + return this.each(function() { + jQuery.dequeue( this, type ); + }); + }, + clearQueue: function( type ) { + return this.queue( type || "fx", [] ); + }, + // Get a promise resolved when queues of a certain type + // are emptied (fx is the type by default) + promise: function( type, obj ) { + var tmp, + count = 1, + defer = jQuery.Deferred(), + elements = this, + i = this.length, + resolve = function() { + if ( !( --count ) ) { + defer.resolveWith( elements, [ elements ] ); + } + }; + + if ( typeof type !== "string" ) { + obj = type; + type = undefined; + } + type = type || "fx"; + + while ( i-- ) { + tmp = jQuery._data( elements[ i ], type + "queueHooks" ); + if ( tmp && tmp.empty ) { + count++; + tmp.empty.add( resolve ); + } + } + resolve(); + return defer.promise( obj ); + } +}); +var pnum = (/[+-]?(?:\d*\.|)\d+(?:[eE][+-]?\d+|)/).source; + +var cssExpand = [ "Top", "Right", "Bottom", "Left" ]; + +var isHidden = function( elem, el ) { + // isHidden might be called from jQuery#filter function; + // in that case, element will be second argument + elem = el || elem; + return jQuery.css( elem, "display" ) === "none" || !jQuery.contains( elem.ownerDocument, elem ); + }; + + + +// Multifunctional method to get and set values of a collection +// The value/s can optionally be executed if it's a function +var access = jQuery.access = function( elems, fn, key, value, chainable, emptyGet, raw ) { + var i = 0, + length = elems.length, + bulk = key == null; + + // Sets many values + if ( jQuery.type( key ) === "object" ) { + chainable = true; + for ( i in key ) { + jQuery.access( elems, fn, i, key[i], true, emptyGet, raw ); + } + + // Sets one value + } else if ( value !== undefined ) { + chainable = true; + + if ( !jQuery.isFunction( value ) ) { + raw = true; + } + + if ( bulk ) { + // Bulk operations run against the entire set + if ( raw ) { + fn.call( elems, value ); + fn = null; + + // ...except when executing function values + } else { + bulk = fn; + fn = function( elem, key, value ) { + return bulk.call( jQuery( elem ), value ); + }; + } + } + + if ( fn ) { + for ( ; i < length; i++ ) { + fn( elems[i], key, raw ? value : value.call( elems[i], i, fn( elems[i], key ) ) ); + } + } + } + + return chainable ? + elems : + + // Gets + bulk ? + fn.call( elems ) : + length ? fn( elems[0], key ) : emptyGet; +}; +var rcheckableType = (/^(?:checkbox|radio)$/i); + + + +(function() { + // Minified: var a,b,c + var input = document.createElement( "input" ), + div = document.createElement( "div" ), + fragment = document.createDocumentFragment(); + + // Setup + div.innerHTML = " <link/><table></table><a href='/a'>a</a><input type='checkbox'/>"; + + // IE strips leading whitespace when .innerHTML is used + support.leadingWhitespace = div.firstChild.nodeType === 3; + + // Make sure that tbody elements aren't automatically inserted + // IE will insert them into empty tables + support.tbody = !div.getElementsByTagName( "tbody" ).length; + + // Make sure that link elements get serialized correctly by innerHTML + // This requires a wrapper element in IE + support.htmlSerialize = !!div.getElementsByTagName( "link" ).length; + + // Makes sure cloning an html5 element does not cause problems + // Where outerHTML is undefined, this still works + support.html5Clone = + document.createElement( "nav" ).cloneNode( true ).outerHTML !== "<:nav></:nav>"; + + // Check if a disconnected checkbox will retain its checked + // value of true after appended to the DOM (IE6/7) + input.type = "checkbox"; + input.checked = true; + fragment.appendChild( input ); + support.appendChecked = input.checked; + + // Make sure textarea (and checkbox) defaultValue is properly cloned + // Support: IE6-IE11+ + div.innerHTML = "<textarea>x</textarea>"; + support.noCloneChecked = !!div.cloneNode( true ).lastChild.defaultValue; + + // #11217 - WebKit loses check when the name is after the checked attribute + fragment.appendChild( div ); + div.innerHTML = "<input type='radio' checked='checked' name='t'/>"; + + // Support: Safari 5.1, iOS 5.1, Android 4.x, Android 2.3 + // old WebKit doesn't clone checked state correctly in fragments + support.checkClone = div.cloneNode( true ).cloneNode( true ).lastChild.checked; + + // Support: IE<9 + // Opera does not clone events (and typeof div.attachEvent === undefined). + // IE9-10 clones events bound via attachEvent, but they don't trigger with .click() + support.noCloneEvent = true; + if ( div.attachEvent ) { + div.attachEvent( "onclick", function() { + support.noCloneEvent = false; + }); + + div.cloneNode( true ).click(); + } + + // Execute the test only if not already executed in another module. + if (support.deleteExpando == null) { + // Support: IE<9 + support.deleteExpando = true; + try { + delete div.test; + } catch( e ) { + support.deleteExpando = false; + } + } +})(); + + +(function() { + var i, eventName, + div = document.createElement( "div" ); + + // Support: IE<9 (lack submit/change bubble), Firefox 23+ (lack focusin event) + for ( i in { submit: true, change: true, focusin: true }) { + eventName = "on" + i; + + if ( !(support[ i + "Bubbles" ] = eventName in window) ) { + // Beware of CSP restrictions (https://developer.mozilla.org/en/Security/CSP) + div.setAttribute( eventName, "t" ); + support[ i + "Bubbles" ] = div.attributes[ eventName ].expando === false; + } + } + + // Null elements to avoid leaks in IE. + div = null; +})(); + + +var rformElems = /^(?:input|select|textarea)$/i, + rkeyEvent = /^key/, + rmouseEvent = /^(?:mouse|pointer|contextmenu)|click/, + rfocusMorph = /^(?:focusinfocus|focusoutblur)$/, + rtypenamespace = /^([^.]*)(?:\.(.+)|)$/; + +function returnTrue() { + return true; +} + +function returnFalse() { + return false; +} + +function safeActiveElement() { + try { + return document.activeElement; + } catch ( err ) { } +} + +/* + * Helper functions for managing events -- not part of the public interface. + * Props to Dean Edwards' addEvent library for many of the ideas. + */ +jQuery.event = { + + global: {}, + + add: function( elem, types, handler, data, selector ) { + var tmp, events, t, handleObjIn, + special, eventHandle, handleObj, + handlers, type, namespaces, origType, + elemData = jQuery._data( elem ); + + // Don't attach events to noData or text/comment nodes (but allow plain objects) + if ( !elemData ) { + return; + } + + // Caller can pass in an object of custom data in lieu of the handler + if ( handler.handler ) { + handleObjIn = handler; + handler = handleObjIn.handler; + selector = handleObjIn.selector; + } + + // Make sure that the handler has a unique ID, used to find/remove it later + if ( !handler.guid ) { + handler.guid = jQuery.guid++; + } + + // Init the element's event structure and main handler, if this is the first + if ( !(events = elemData.events) ) { + events = elemData.events = {}; + } + if ( !(eventHandle = elemData.handle) ) { + eventHandle = elemData.handle = function( e ) { + // Discard the second event of a jQuery.event.trigger() and + // when an event is called after a page has unloaded + return typeof jQuery !== strundefined && (!e || jQuery.event.triggered !== e.type) ? + jQuery.event.dispatch.apply( eventHandle.elem, arguments ) : + undefined; + }; + // Add elem as a property of the handle fn to prevent a memory leak with IE non-native events + eventHandle.elem = elem; + } + + // Handle multiple events separated by a space + types = ( types || "" ).match( rnotwhite ) || [ "" ]; + t = types.length; + while ( t-- ) { + tmp = rtypenamespace.exec( types[t] ) || []; + type = origType = tmp[1]; + namespaces = ( tmp[2] || "" ).split( "." ).sort(); + + // There *must* be a type, no attaching namespace-only handlers + if ( !type ) { + continue; + } + + // If event changes its type, use the special event handlers for the changed type + special = jQuery.event.special[ type ] || {}; + + // If selector defined, determine special event api type, otherwise given type + type = ( selector ? special.delegateType : special.bindType ) || type; + + // Update special based on newly reset type + special = jQuery.event.special[ type ] || {}; + + // handleObj is passed to all event handlers + handleObj = jQuery.extend({ + type: type, + origType: origType, + data: data, + handler: handler, + guid: handler.guid, + selector: selector, + needsContext: selector && jQuery.expr.match.needsContext.test( selector ), + namespace: namespaces.join(".") + }, handleObjIn ); + + // Init the event handler queue if we're the first + if ( !(handlers = events[ type ]) ) { + handlers = events[ type ] = []; + handlers.delegateCount = 0; + + // Only use addEventListener/attachEvent if the special events handler returns false + if ( !special.setup || special.setup.call( elem, data, namespaces, eventHandle ) === false ) { + // Bind the global event handler to the element + if ( elem.addEventListener ) { + elem.addEventListener( type, eventHandle, false ); + + } else if ( elem.attachEvent ) { + elem.attachEvent( "on" + type, eventHandle ); + } + } + } + + if ( special.add ) { + special.add.call( elem, handleObj ); + + if ( !handleObj.handler.guid ) { + handleObj.handler.guid = handler.guid; + } + } + + // Add to the element's handler list, delegates in front + if ( selector ) { + handlers.splice( handlers.delegateCount++, 0, handleObj ); + } else { + handlers.push( handleObj ); + } + + // Keep track of which events have ever been used, for event optimization + jQuery.event.global[ type ] = true; + } + + // Nullify elem to prevent memory leaks in IE + elem = null; + }, + + // Detach an event or set of events from an element + remove: function( elem, types, handler, selector, mappedTypes ) { + var j, handleObj, tmp, + origCount, t, events, + special, handlers, type, + namespaces, origType, + elemData = jQuery.hasData( elem ) && jQuery._data( elem ); + + if ( !elemData || !(events = elemData.events) ) { + return; + } + + // Once for each type.namespace in types; type may be omitted + types = ( types || "" ).match( rnotwhite ) || [ "" ]; + t = types.length; + while ( t-- ) { + tmp = rtypenamespace.exec( types[t] ) || []; + type = origType = tmp[1]; + namespaces = ( tmp[2] || "" ).split( "." ).sort(); + + // Unbind all events (on this namespace, if provided) for the element + if ( !type ) { + for ( type in events ) { + jQuery.event.remove( elem, type + types[ t ], handler, selector, true ); + } + continue; + } + + special = jQuery.event.special[ type ] || {}; + type = ( selector ? special.delegateType : special.bindType ) || type; + handlers = events[ type ] || []; + tmp = tmp[2] && new RegExp( "(^|\\.)" + namespaces.join("\\.(?:.*\\.|)") + "(\\.|$)" ); + + // Remove matching events + origCount = j = handlers.length; + while ( j-- ) { + handleObj = handlers[ j ]; + + if ( ( mappedTypes || origType === handleObj.origType ) && + ( !handler || handler.guid === handleObj.guid ) && + ( !tmp || tmp.test( handleObj.namespace ) ) && + ( !selector || selector === handleObj.selector || selector === "**" && handleObj.selector ) ) { + handlers.splice( j, 1 ); + + if ( handleObj.selector ) { + handlers.delegateCount--; + } + if ( special.remove ) { + special.remove.call( elem, handleObj ); + } + } + } + + // Remove generic event handler if we removed something and no more handlers exist + // (avoids potential for endless recursion during removal of special event handlers) + if ( origCount && !handlers.length ) { + if ( !special.teardown || special.teardown.call( elem, namespaces, elemData.handle ) === false ) { + jQuery.removeEvent( elem, type, elemData.handle ); + } + + delete events[ type ]; + } + } + + // Remove the expando if it's no longer used + if ( jQuery.isEmptyObject( events ) ) { + delete elemData.handle; + + // removeData also checks for emptiness and clears the expando if empty + // so use it instead of delete + jQuery._removeData( elem, "events" ); + } + }, + + trigger: function( event, data, elem, onlyHandlers ) { + var handle, ontype, cur, + bubbleType, special, tmp, i, + eventPath = [ elem || document ], + type = hasOwn.call( event, "type" ) ? event.type : event, + namespaces = hasOwn.call( event, "namespace" ) ? event.namespace.split(".") : []; + + cur = tmp = elem = elem || document; + + // Don't do events on text and comment nodes + if ( elem.nodeType === 3 || elem.nodeType === 8 ) { + return; + } + + // focus/blur morphs to focusin/out; ensure we're not firing them right now + if ( rfocusMorph.test( type + jQuery.event.triggered ) ) { + return; + } + + if ( type.indexOf(".") >= 0 ) { + // Namespaced trigger; create a regexp to match event type in handle() + namespaces = type.split("."); + type = namespaces.shift(); + namespaces.sort(); + } + ontype = type.indexOf(":") < 0 && "on" + type; + + // Caller can pass in a jQuery.Event object, Object, or just an event type string + event = event[ jQuery.expando ] ? + event : + new jQuery.Event( type, typeof event === "object" && event ); + + // Trigger bitmask: & 1 for native handlers; & 2 for jQuery (always true) + event.isTrigger = onlyHandlers ? 2 : 3; + event.namespace = namespaces.join("."); + event.namespace_re = event.namespace ? + new RegExp( "(^|\\.)" + namespaces.join("\\.(?:.*\\.|)") + "(\\.|$)" ) : + null; + + // Clean up the event in case it is being reused + event.result = undefined; + if ( !event.target ) { + event.target = elem; + } + + // Clone any incoming data and prepend the event, creating the handler arg list + data = data == null ? + [ event ] : + jQuery.makeArray( data, [ event ] ); + + // Allow special events to draw outside the lines + special = jQuery.event.special[ type ] || {}; + if ( !onlyHandlers && special.trigger && special.trigger.apply( elem, data ) === false ) { + return; + } + + // Determine event propagation path in advance, per W3C events spec (#9951) + // Bubble up to document, then to window; watch for a global ownerDocument var (#9724) + if ( !onlyHandlers && !special.noBubble && !jQuery.isWindow( elem ) ) { + + bubbleType = special.delegateType || type; + if ( !rfocusMorph.test( bubbleType + type ) ) { + cur = cur.parentNode; + } + for ( ; cur; cur = cur.parentNode ) { + eventPath.push( cur ); + tmp = cur; + } + + // Only add window if we got to document (e.g., not plain obj or detached DOM) + if ( tmp === (elem.ownerDocument || document) ) { + eventPath.push( tmp.defaultView || tmp.parentWindow || window ); + } + } + + // Fire handlers on the event path + i = 0; + while ( (cur = eventPath[i++]) && !event.isPropagationStopped() ) { + + event.type = i > 1 ? + bubbleType : + special.bindType || type; + + // jQuery handler + handle = ( jQuery._data( cur, "events" ) || {} )[ event.type ] && jQuery._data( cur, "handle" ); + if ( handle ) { + handle.apply( cur, data ); + } + + // Native handler + handle = ontype && cur[ ontype ]; + if ( handle && handle.apply && jQuery.acceptData( cur ) ) { + event.result = handle.apply( cur, data ); + if ( event.result === false ) { + event.preventDefault(); + } + } + } + event.type = type; + + // If nobody prevented the default action, do it now + if ( !onlyHandlers && !event.isDefaultPrevented() ) { + + if ( (!special._default || special._default.apply( eventPath.pop(), data ) === false) && + jQuery.acceptData( elem ) ) { + + // Call a native DOM method on the target with the same name name as the event. + // Can't use an .isFunction() check here because IE6/7 fails that test. + // Don't do default actions on window, that's where global variables be (#6170) + if ( ontype && elem[ type ] && !jQuery.isWindow( elem ) ) { + + // Don't re-trigger an onFOO event when we call its FOO() method + tmp = elem[ ontype ]; + + if ( tmp ) { + elem[ ontype ] = null; + } + + // Prevent re-triggering of the same event, since we already bubbled it above + jQuery.event.triggered = type; + try { + elem[ type ](); + } catch ( e ) { + // IE<9 dies on focus/blur to hidden element (#1486,#12518) + // only reproducible on winXP IE8 native, not IE9 in IE8 mode + } + jQuery.event.triggered = undefined; + + if ( tmp ) { + elem[ ontype ] = tmp; + } + } + } + } + + return event.result; + }, + + dispatch: function( event ) { + + // Make a writable jQuery.Event from the native event object + event = jQuery.event.fix( event ); + + var i, ret, handleObj, matched, j, + handlerQueue = [], + args = slice.call( arguments ), + handlers = ( jQuery._data( this, "events" ) || {} )[ event.type ] || [], + special = jQuery.event.special[ event.type ] || {}; + + // Use the fix-ed jQuery.Event rather than the (read-only) native event + args[0] = event; + event.delegateTarget = this; + + // Call the preDispatch hook for the mapped type, and let it bail if desired + if ( special.preDispatch && special.preDispatch.call( this, event ) === false ) { + return; + } + + // Determine handlers + handlerQueue = jQuery.event.handlers.call( this, event, handlers ); + + // Run delegates first; they may want to stop propagation beneath us + i = 0; + while ( (matched = handlerQueue[ i++ ]) && !event.isPropagationStopped() ) { + event.currentTarget = matched.elem; + + j = 0; + while ( (handleObj = matched.handlers[ j++ ]) && !event.isImmediatePropagationStopped() ) { + + // Triggered event must either 1) have no namespace, or + // 2) have namespace(s) a subset or equal to those in the bound event (both can have no namespace). + if ( !event.namespace_re || event.namespace_re.test( handleObj.namespace ) ) { + + event.handleObj = handleObj; + event.data = handleObj.data; + + ret = ( (jQuery.event.special[ handleObj.origType ] || {}).handle || handleObj.handler ) + .apply( matched.elem, args ); + + if ( ret !== undefined ) { + if ( (event.result = ret) === false ) { + event.preventDefault(); + event.stopPropagation(); + } + } + } + } + } + + // Call the postDispatch hook for the mapped type + if ( special.postDispatch ) { + special.postDispatch.call( this, event ); + } + + return event.result; + }, + + handlers: function( event, handlers ) { + var sel, handleObj, matches, i, + handlerQueue = [], + delegateCount = handlers.delegateCount, + cur = event.target; + + // Find delegate handlers + // Black-hole SVG <use> instance trees (#13180) + // Avoid non-left-click bubbling in Firefox (#3861) + if ( delegateCount && cur.nodeType && (!event.button || event.type !== "click") ) { + + /* jshint eqeqeq: false */ + for ( ; cur != this; cur = cur.parentNode || this ) { + /* jshint eqeqeq: true */ + + // Don't check non-elements (#13208) + // Don't process clicks on disabled elements (#6911, #8165, #11382, #11764) + if ( cur.nodeType === 1 && (cur.disabled !== true || event.type !== "click") ) { + matches = []; + for ( i = 0; i < delegateCount; i++ ) { + handleObj = handlers[ i ]; + + // Don't conflict with Object.prototype properties (#13203) + sel = handleObj.selector + " "; + + if ( matches[ sel ] === undefined ) { + matches[ sel ] = handleObj.needsContext ? + jQuery( sel, this ).index( cur ) >= 0 : + jQuery.find( sel, this, null, [ cur ] ).length; + } + if ( matches[ sel ] ) { + matches.push( handleObj ); + } + } + if ( matches.length ) { + handlerQueue.push({ elem: cur, handlers: matches }); + } + } + } + } + + // Add the remaining (directly-bound) handlers + if ( delegateCount < handlers.length ) { + handlerQueue.push({ elem: this, handlers: handlers.slice( delegateCount ) }); + } + + return handlerQueue; + }, + + fix: function( event ) { + if ( event[ jQuery.expando ] ) { + return event; + } + + // Create a writable copy of the event object and normalize some properties + var i, prop, copy, + type = event.type, + originalEvent = event, + fixHook = this.fixHooks[ type ]; + + if ( !fixHook ) { + this.fixHooks[ type ] = fixHook = + rmouseEvent.test( type ) ? this.mouseHooks : + rkeyEvent.test( type ) ? this.keyHooks : + {}; + } + copy = fixHook.props ? this.props.concat( fixHook.props ) : this.props; + + event = new jQuery.Event( originalEvent ); + + i = copy.length; + while ( i-- ) { + prop = copy[ i ]; + event[ prop ] = originalEvent[ prop ]; + } + + // Support: IE<9 + // Fix target property (#1925) + if ( !event.target ) { + event.target = originalEvent.srcElement || document; + } + + // Support: Chrome 23+, Safari? + // Target should not be a text node (#504, #13143) + if ( event.target.nodeType === 3 ) { + event.target = event.target.parentNode; + } + + // Support: IE<9 + // For mouse/key events, metaKey==false if it's undefined (#3368, #11328) + event.metaKey = !!event.metaKey; + + return fixHook.filter ? fixHook.filter( event, originalEvent ) : event; + }, + + // Includes some event props shared by KeyEvent and MouseEvent + props: "altKey bubbles cancelable ctrlKey currentTarget eventPhase metaKey relatedTarget shiftKey target timeStamp view which".split(" "), + + fixHooks: {}, + + keyHooks: { + props: "char charCode key keyCode".split(" "), + filter: function( event, original ) { + + // Add which for key events + if ( event.which == null ) { + event.which = original.charCode != null ? original.charCode : original.keyCode; + } + + return event; + } + }, + + mouseHooks: { + props: "button buttons clientX clientY fromElement offsetX offsetY pageX pageY screenX screenY toElement".split(" "), + filter: function( event, original ) { + var body, eventDoc, doc, + button = original.button, + fromElement = original.fromElement; + + // Calculate pageX/Y if missing and clientX/Y available + if ( event.pageX == null && original.clientX != null ) { + eventDoc = event.target.ownerDocument || document; + doc = eventDoc.documentElement; + body = eventDoc.body; + + event.pageX = original.clientX + ( doc && doc.scrollLeft || body && body.scrollLeft || 0 ) - ( doc && doc.clientLeft || body && body.clientLeft || 0 ); + event.pageY = original.clientY + ( doc && doc.scrollTop || body && body.scrollTop || 0 ) - ( doc && doc.clientTop || body && body.clientTop || 0 ); + } + + // Add relatedTarget, if necessary + if ( !event.relatedTarget && fromElement ) { + event.relatedTarget = fromElement === event.target ? original.toElement : fromElement; + } + + // Add which for click: 1 === left; 2 === middle; 3 === right + // Note: button is not normalized, so don't use it + if ( !event.which && button !== undefined ) { + event.which = ( button & 1 ? 1 : ( button & 2 ? 3 : ( button & 4 ? 2 : 0 ) ) ); + } + + return event; + } + }, + + special: { + load: { + // Prevent triggered image.load events from bubbling to window.load + noBubble: true + }, + focus: { + // Fire native event if possible so blur/focus sequence is correct + trigger: function() { + if ( this !== safeActiveElement() && this.focus ) { + try { + this.focus(); + return false; + } catch ( e ) { + // Support: IE<9 + // If we error on focus to hidden element (#1486, #12518), + // let .trigger() run the handlers + } + } + }, + delegateType: "focusin" + }, + blur: { + trigger: function() { + if ( this === safeActiveElement() && this.blur ) { + this.blur(); + return false; + } + }, + delegateType: "focusout" + }, + click: { + // For checkbox, fire native event so checked state will be right + trigger: function() { + if ( jQuery.nodeName( this, "input" ) && this.type === "checkbox" && this.click ) { + this.click(); + return false; + } + }, + + // For cross-browser consistency, don't fire native .click() on links + _default: function( event ) { + return jQuery.nodeName( event.target, "a" ); + } + }, + + beforeunload: { + postDispatch: function( event ) { + + // Support: Firefox 20+ + // Firefox doesn't alert if the returnValue field is not set. + if ( event.result !== undefined && event.originalEvent ) { + event.originalEvent.returnValue = event.result; + } + } + } + }, + + simulate: function( type, elem, event, bubble ) { + // Piggyback on a donor event to simulate a different one. + // Fake originalEvent to avoid donor's stopPropagation, but if the + // simulated event prevents default then we do the same on the donor. + var e = jQuery.extend( + new jQuery.Event(), + event, + { + type: type, + isSimulated: true, + originalEvent: {} + } + ); + if ( bubble ) { + jQuery.event.trigger( e, null, elem ); + } else { + jQuery.event.dispatch.call( elem, e ); + } + if ( e.isDefaultPrevented() ) { + event.preventDefault(); + } + } +}; + +jQuery.removeEvent = document.removeEventListener ? + function( elem, type, handle ) { + if ( elem.removeEventListener ) { + elem.removeEventListener( type, handle, false ); + } + } : + function( elem, type, handle ) { + var name = "on" + type; + + if ( elem.detachEvent ) { + + // #8545, #7054, preventing memory leaks for custom events in IE6-8 + // detachEvent needed property on element, by name of that event, to properly expose it to GC + if ( typeof elem[ name ] === strundefined ) { + elem[ name ] = null; + } + + elem.detachEvent( name, handle ); + } + }; + +jQuery.Event = function( src, props ) { + // Allow instantiation without the 'new' keyword + if ( !(this instanceof jQuery.Event) ) { + return new jQuery.Event( src, props ); + } + + // Event object + if ( src && src.type ) { + this.originalEvent = src; + this.type = src.type; + + // Events bubbling up the document may have been marked as prevented + // by a handler lower down the tree; reflect the correct value. + this.isDefaultPrevented = src.defaultPrevented || + src.defaultPrevented === undefined && + // Support: IE < 9, Android < 4.0 + src.returnValue === false ? + returnTrue : + returnFalse; + + // Event type + } else { + this.type = src; + } + + // Put explicitly provided properties onto the event object + if ( props ) { + jQuery.extend( this, props ); + } + + // Create a timestamp if incoming event doesn't have one + this.timeStamp = src && src.timeStamp || jQuery.now(); + + // Mark it as fixed + this[ jQuery.expando ] = true; +}; + +// jQuery.Event is based on DOM3 Events as specified by the ECMAScript Language Binding +// http://www.w3.org/TR/2003/WD-DOM-Level-3-Events-20030331/ecma-script-binding.html +jQuery.Event.prototype = { + isDefaultPrevented: returnFalse, + isPropagationStopped: returnFalse, + isImmediatePropagationStopped: returnFalse, + + preventDefault: function() { + var e = this.originalEvent; + + this.isDefaultPrevented = returnTrue; + if ( !e ) { + return; + } + + // If preventDefault exists, run it on the original event + if ( e.preventDefault ) { + e.preventDefault(); + + // Support: IE + // Otherwise set the returnValue property of the original event to false + } else { + e.returnValue = false; + } + }, + stopPropagation: function() { + var e = this.originalEvent; + + this.isPropagationStopped = returnTrue; + if ( !e ) { + return; + } + // If stopPropagation exists, run it on the original event + if ( e.stopPropagation ) { + e.stopPropagation(); + } + + // Support: IE + // Set the cancelBubble property of the original event to true + e.cancelBubble = true; + }, + stopImmediatePropagation: function() { + var e = this.originalEvent; + + this.isImmediatePropagationStopped = returnTrue; + + if ( e && e.stopImmediatePropagation ) { + e.stopImmediatePropagation(); + } + + this.stopPropagation(); + } +}; + +// Create mouseenter/leave events using mouseover/out and event-time checks +jQuery.each({ + mouseenter: "mouseover", + mouseleave: "mouseout", + pointerenter: "pointerover", + pointerleave: "pointerout" +}, function( orig, fix ) { + jQuery.event.special[ orig ] = { + delegateType: fix, + bindType: fix, + + handle: function( event ) { + var ret, + target = this, + related = event.relatedTarget, + handleObj = event.handleObj; + + // For mousenter/leave call the handler if related is outside the target. + // NB: No relatedTarget if the mouse left/entered the browser window + if ( !related || (related !== target && !jQuery.contains( target, related )) ) { + event.type = handleObj.origType; + ret = handleObj.handler.apply( this, arguments ); + event.type = fix; + } + return ret; + } + }; +}); + +// IE submit delegation +if ( !support.submitBubbles ) { + + jQuery.event.special.submit = { + setup: function() { + // Only need this for delegated form submit events + if ( jQuery.nodeName( this, "form" ) ) { + return false; + } + + // Lazy-add a submit handler when a descendant form may potentially be submitted + jQuery.event.add( this, "click._submit keypress._submit", function( e ) { + // Node name check avoids a VML-related crash in IE (#9807) + var elem = e.target, + form = jQuery.nodeName( elem, "input" ) || jQuery.nodeName( elem, "button" ) ? elem.form : undefined; + if ( form && !jQuery._data( form, "submitBubbles" ) ) { + jQuery.event.add( form, "submit._submit", function( event ) { + event._submit_bubble = true; + }); + jQuery._data( form, "submitBubbles", true ); + } + }); + // return undefined since we don't need an event listener + }, + + postDispatch: function( event ) { + // If form was submitted by the user, bubble the event up the tree + if ( event._submit_bubble ) { + delete event._submit_bubble; + if ( this.parentNode && !event.isTrigger ) { + jQuery.event.simulate( "submit", this.parentNode, event, true ); + } + } + }, + + teardown: function() { + // Only need this for delegated form submit events + if ( jQuery.nodeName( this, "form" ) ) { + return false; + } + + // Remove delegated handlers; cleanData eventually reaps submit handlers attached above + jQuery.event.remove( this, "._submit" ); + } + }; +} + +// IE change delegation and checkbox/radio fix +if ( !support.changeBubbles ) { + + jQuery.event.special.change = { + + setup: function() { + + if ( rformElems.test( this.nodeName ) ) { + // IE doesn't fire change on a check/radio until blur; trigger it on click + // after a propertychange. Eat the blur-change in special.change.handle. + // This still fires onchange a second time for check/radio after blur. + if ( this.type === "checkbox" || this.type === "radio" ) { + jQuery.event.add( this, "propertychange._change", function( event ) { + if ( event.originalEvent.propertyName === "checked" ) { + this._just_changed = true; + } + }); + jQuery.event.add( this, "click._change", function( event ) { + if ( this._just_changed && !event.isTrigger ) { + this._just_changed = false; + } + // Allow triggered, simulated change events (#11500) + jQuery.event.simulate( "change", this, event, true ); + }); + } + return false; + } + // Delegated event; lazy-add a change handler on descendant inputs + jQuery.event.add( this, "beforeactivate._change", function( e ) { + var elem = e.target; + + if ( rformElems.test( elem.nodeName ) && !jQuery._data( elem, "changeBubbles" ) ) { + jQuery.event.add( elem, "change._change", function( event ) { + if ( this.parentNode && !event.isSimulated && !event.isTrigger ) { + jQuery.event.simulate( "change", this.parentNode, event, true ); + } + }); + jQuery._data( elem, "changeBubbles", true ); + } + }); + }, + + handle: function( event ) { + var elem = event.target; + + // Swallow native change events from checkbox/radio, we already triggered them above + if ( this !== elem || event.isSimulated || event.isTrigger || (elem.type !== "radio" && elem.type !== "checkbox") ) { + return event.handleObj.handler.apply( this, arguments ); + } + }, + + teardown: function() { + jQuery.event.remove( this, "._change" ); + + return !rformElems.test( this.nodeName ); + } + }; +} + +// Create "bubbling" focus and blur events +if ( !support.focusinBubbles ) { + jQuery.each({ focus: "focusin", blur: "focusout" }, function( orig, fix ) { + + // Attach a single capturing handler on the document while someone wants focusin/focusout + var handler = function( event ) { + jQuery.event.simulate( fix, event.target, jQuery.event.fix( event ), true ); + }; + + jQuery.event.special[ fix ] = { + setup: function() { + var doc = this.ownerDocument || this, + attaches = jQuery._data( doc, fix ); + + if ( !attaches ) { + doc.addEventListener( orig, handler, true ); + } + jQuery._data( doc, fix, ( attaches || 0 ) + 1 ); + }, + teardown: function() { + var doc = this.ownerDocument || this, + attaches = jQuery._data( doc, fix ) - 1; + + if ( !attaches ) { + doc.removeEventListener( orig, handler, true ); + jQuery._removeData( doc, fix ); + } else { + jQuery._data( doc, fix, attaches ); + } + } + }; + }); +} + +jQuery.fn.extend({ + + on: function( types, selector, data, fn, /*INTERNAL*/ one ) { + var type, origFn; + + // Types can be a map of types/handlers + if ( typeof types === "object" ) { + // ( types-Object, selector, data ) + if ( typeof selector !== "string" ) { + // ( types-Object, data ) + data = data || selector; + selector = undefined; + } + for ( type in types ) { + this.on( type, selector, data, types[ type ], one ); + } + return this; + } + + if ( data == null && fn == null ) { + // ( types, fn ) + fn = selector; + data = selector = undefined; + } else if ( fn == null ) { + if ( typeof selector === "string" ) { + // ( types, selector, fn ) + fn = data; + data = undefined; + } else { + // ( types, data, fn ) + fn = data; + data = selector; + selector = undefined; + } + } + if ( fn === false ) { + fn = returnFalse; + } else if ( !fn ) { + return this; + } + + if ( one === 1 ) { + origFn = fn; + fn = function( event ) { + // Can use an empty set, since event contains the info + jQuery().off( event ); + return origFn.apply( this, arguments ); + }; + // Use same guid so caller can remove using origFn + fn.guid = origFn.guid || ( origFn.guid = jQuery.guid++ ); + } + return this.each( function() { + jQuery.event.add( this, types, fn, data, selector ); + }); + }, + one: function( types, selector, data, fn ) { + return this.on( types, selector, data, fn, 1 ); + }, + off: function( types, selector, fn ) { + var handleObj, type; + if ( types && types.preventDefault && types.handleObj ) { + // ( event ) dispatched jQuery.Event + handleObj = types.handleObj; + jQuery( types.delegateTarget ).off( + handleObj.namespace ? handleObj.origType + "." + handleObj.namespace : handleObj.origType, + handleObj.selector, + handleObj.handler + ); + return this; + } + if ( typeof types === "object" ) { + // ( types-object [, selector] ) + for ( type in types ) { + this.off( type, selector, types[ type ] ); + } + return this; + } + if ( selector === false || typeof selector === "function" ) { + // ( types [, fn] ) + fn = selector; + selector = undefined; + } + if ( fn === false ) { + fn = returnFalse; + } + return this.each(function() { + jQuery.event.remove( this, types, fn, selector ); + }); + }, + + trigger: function( type, data ) { + return this.each(function() { + jQuery.event.trigger( type, data, this ); + }); + }, + triggerHandler: function( type, data ) { + var elem = this[0]; + if ( elem ) { + return jQuery.event.trigger( type, data, elem, true ); + } + } +}); + + +function createSafeFragment( document ) { + var list = nodeNames.split( "|" ), + safeFrag = document.createDocumentFragment(); + + if ( safeFrag.createElement ) { + while ( list.length ) { + safeFrag.createElement( + list.pop() + ); + } + } + return safeFrag; +} + +var nodeNames = "abbr|article|aside|audio|bdi|canvas|data|datalist|details|figcaption|figure|footer|" + + "header|hgroup|mark|meter|nav|output|progress|section|summary|time|video", + rinlinejQuery = / jQuery\d+="(?:null|\d+)"/g, + rnoshimcache = new RegExp("<(?:" + nodeNames + ")[\\s/>]", "i"), + rleadingWhitespace = /^\s+/, + rxhtmlTag = /<(?!area|br|col|embed|hr|img|input|link|meta|param)(([\w:]+)[^>]*)\/>/gi, + rtagName = /<([\w:]+)/, + rtbody = /<tbody/i, + rhtml = /<|&#?\w+;/, + rnoInnerhtml = /<(?:script|style|link)/i, + // checked="checked" or checked + rchecked = /checked\s*(?:[^=]|=\s*.checked.)/i, + rscriptType = /^$|\/(?:java|ecma)script/i, + rscriptTypeMasked = /^true\/(.*)/, + rcleanScript = /^\s*<!(?:\[CDATA\[|--)|(?:\]\]|--)>\s*$/g, + + // We have to close these tags to support XHTML (#13200) + wrapMap = { + option: [ 1, "<select multiple='multiple'>", "</select>" ], + legend: [ 1, "<fieldset>", "</fieldset>" ], + area: [ 1, "<map>", "</map>" ], + param: [ 1, "<object>", "</object>" ], + thead: [ 1, "<table>", "</table>" ], + tr: [ 2, "<table><tbody>", "</tbody></table>" ], + col: [ 2, "<table><tbody></tbody><colgroup>", "</colgroup></table>" ], + td: [ 3, "<table><tbody><tr>", "</tr></tbody></table>" ], + + // IE6-8 can't serialize link, script, style, or any html5 (NoScope) tags, + // unless wrapped in a div with non-breaking characters in front of it. + _default: support.htmlSerialize ? [ 0, "", "" ] : [ 1, "X<div>", "</div>" ] + }, + safeFragment = createSafeFragment( document ), + fragmentDiv = safeFragment.appendChild( document.createElement("div") ); + +wrapMap.optgroup = wrapMap.option; +wrapMap.tbody = wrapMap.tfoot = wrapMap.colgroup = wrapMap.caption = wrapMap.thead; +wrapMap.th = wrapMap.td; + +function getAll( context, tag ) { + var elems, elem, + i = 0, + found = typeof context.getElementsByTagName !== strundefined ? context.getElementsByTagName( tag || "*" ) : + typeof context.querySelectorAll !== strundefined ? context.querySelectorAll( tag || "*" ) : + undefined; + + if ( !found ) { + for ( found = [], elems = context.childNodes || context; (elem = elems[i]) != null; i++ ) { + if ( !tag || jQuery.nodeName( elem, tag ) ) { + found.push( elem ); + } else { + jQuery.merge( found, getAll( elem, tag ) ); + } + } + } + + return tag === undefined || tag && jQuery.nodeName( context, tag ) ? + jQuery.merge( [ context ], found ) : + found; +} + +// Used in buildFragment, fixes the defaultChecked property +function fixDefaultChecked( elem ) { + if ( rcheckableType.test( elem.type ) ) { + elem.defaultChecked = elem.checked; + } +} + +// Support: IE<8 +// Manipulating tables requires a tbody +function manipulationTarget( elem, content ) { + return jQuery.nodeName( elem, "table" ) && + jQuery.nodeName( content.nodeType !== 11 ? content : content.firstChild, "tr" ) ? + + elem.getElementsByTagName("tbody")[0] || + elem.appendChild( elem.ownerDocument.createElement("tbody") ) : + elem; +} + +// Replace/restore the type attribute of script elements for safe DOM manipulation +function disableScript( elem ) { + elem.type = (jQuery.find.attr( elem, "type" ) !== null) + "/" + elem.type; + return elem; +} +function restoreScript( elem ) { + var match = rscriptTypeMasked.exec( elem.type ); + if ( match ) { + elem.type = match[1]; + } else { + elem.removeAttribute("type"); + } + return elem; +} + +// Mark scripts as having already been evaluated +function setGlobalEval( elems, refElements ) { + var elem, + i = 0; + for ( ; (elem = elems[i]) != null; i++ ) { + jQuery._data( elem, "globalEval", !refElements || jQuery._data( refElements[i], "globalEval" ) ); + } +} + +function cloneCopyEvent( src, dest ) { + + if ( dest.nodeType !== 1 || !jQuery.hasData( src ) ) { + return; + } + + var type, i, l, + oldData = jQuery._data( src ), + curData = jQuery._data( dest, oldData ), + events = oldData.events; + + if ( events ) { + delete curData.handle; + curData.events = {}; + + for ( type in events ) { + for ( i = 0, l = events[ type ].length; i < l; i++ ) { + jQuery.event.add( dest, type, events[ type ][ i ] ); + } + } + } + + // make the cloned public data object a copy from the original + if ( curData.data ) { + curData.data = jQuery.extend( {}, curData.data ); + } +} + +function fixCloneNodeIssues( src, dest ) { + var nodeName, e, data; + + // We do not need to do anything for non-Elements + if ( dest.nodeType !== 1 ) { + return; + } + + nodeName = dest.nodeName.toLowerCase(); + + // IE6-8 copies events bound via attachEvent when using cloneNode. + if ( !support.noCloneEvent && dest[ jQuery.expando ] ) { + data = jQuery._data( dest ); + + for ( e in data.events ) { + jQuery.removeEvent( dest, e, data.handle ); + } + + // Event data gets referenced instead of copied if the expando gets copied too + dest.removeAttribute( jQuery.expando ); + } + + // IE blanks contents when cloning scripts, and tries to evaluate newly-set text + if ( nodeName === "script" && dest.text !== src.text ) { + disableScript( dest ).text = src.text; + restoreScript( dest ); + + // IE6-10 improperly clones children of object elements using classid. + // IE10 throws NoModificationAllowedError if parent is null, #12132. + } else if ( nodeName === "object" ) { + if ( dest.parentNode ) { + dest.outerHTML = src.outerHTML; + } + + // This path appears unavoidable for IE9. When cloning an object + // element in IE9, the outerHTML strategy above is not sufficient. + // If the src has innerHTML and the destination does not, + // copy the src.innerHTML into the dest.innerHTML. #10324 + if ( support.html5Clone && ( src.innerHTML && !jQuery.trim(dest.innerHTML) ) ) { + dest.innerHTML = src.innerHTML; + } + + } else if ( nodeName === "input" && rcheckableType.test( src.type ) ) { + // IE6-8 fails to persist the checked state of a cloned checkbox + // or radio button. Worse, IE6-7 fail to give the cloned element + // a checked appearance if the defaultChecked value isn't also set + + dest.defaultChecked = dest.checked = src.checked; + + // IE6-7 get confused and end up setting the value of a cloned + // checkbox/radio button to an empty string instead of "on" + if ( dest.value !== src.value ) { + dest.value = src.value; + } + + // IE6-8 fails to return the selected option to the default selected + // state when cloning options + } else if ( nodeName === "option" ) { + dest.defaultSelected = dest.selected = src.defaultSelected; + + // IE6-8 fails to set the defaultValue to the correct value when + // cloning other types of input fields + } else if ( nodeName === "input" || nodeName === "textarea" ) { + dest.defaultValue = src.defaultValue; + } +} + +jQuery.extend({ + clone: function( elem, dataAndEvents, deepDataAndEvents ) { + var destElements, node, clone, i, srcElements, + inPage = jQuery.contains( elem.ownerDocument, elem ); + + if ( support.html5Clone || jQuery.isXMLDoc(elem) || !rnoshimcache.test( "<" + elem.nodeName + ">" ) ) { + clone = elem.cloneNode( true ); + + // IE<=8 does not properly clone detached, unknown element nodes + } else { + fragmentDiv.innerHTML = elem.outerHTML; + fragmentDiv.removeChild( clone = fragmentDiv.firstChild ); + } + + if ( (!support.noCloneEvent || !support.noCloneChecked) && + (elem.nodeType === 1 || elem.nodeType === 11) && !jQuery.isXMLDoc(elem) ) { + + // We eschew Sizzle here for performance reasons: http://jsperf.com/getall-vs-sizzle/2 + destElements = getAll( clone ); + srcElements = getAll( elem ); + + // Fix all IE cloning issues + for ( i = 0; (node = srcElements[i]) != null; ++i ) { + // Ensure that the destination node is not null; Fixes #9587 + if ( destElements[i] ) { + fixCloneNodeIssues( node, destElements[i] ); + } + } + } + + // Copy the events from the original to the clone + if ( dataAndEvents ) { + if ( deepDataAndEvents ) { + srcElements = srcElements || getAll( elem ); + destElements = destElements || getAll( clone ); + + for ( i = 0; (node = srcElements[i]) != null; i++ ) { + cloneCopyEvent( node, destElements[i] ); + } + } else { + cloneCopyEvent( elem, clone ); + } + } + + // Preserve script evaluation history + destElements = getAll( clone, "script" ); + if ( destElements.length > 0 ) { + setGlobalEval( destElements, !inPage && getAll( elem, "script" ) ); + } + + destElements = srcElements = node = null; + + // Return the cloned set + return clone; + }, + + buildFragment: function( elems, context, scripts, selection ) { + var j, elem, contains, + tmp, tag, tbody, wrap, + l = elems.length, + + // Ensure a safe fragment + safe = createSafeFragment( context ), + + nodes = [], + i = 0; + + for ( ; i < l; i++ ) { + elem = elems[ i ]; + + if ( elem || elem === 0 ) { + + // Add nodes directly + if ( jQuery.type( elem ) === "object" ) { + jQuery.merge( nodes, elem.nodeType ? [ elem ] : elem ); + + // Convert non-html into a text node + } else if ( !rhtml.test( elem ) ) { + nodes.push( context.createTextNode( elem ) ); + + // Convert html into DOM nodes + } else { + tmp = tmp || safe.appendChild( context.createElement("div") ); + + // Deserialize a standard representation + tag = (rtagName.exec( elem ) || [ "", "" ])[ 1 ].toLowerCase(); + wrap = wrapMap[ tag ] || wrapMap._default; + + tmp.innerHTML = wrap[1] + elem.replace( rxhtmlTag, "<$1></$2>" ) + wrap[2]; + + // Descend through wrappers to the right content + j = wrap[0]; + while ( j-- ) { + tmp = tmp.lastChild; + } + + // Manually add leading whitespace removed by IE + if ( !support.leadingWhitespace && rleadingWhitespace.test( elem ) ) { + nodes.push( context.createTextNode( rleadingWhitespace.exec( elem )[0] ) ); + } + + // Remove IE's autoinserted <tbody> from table fragments + if ( !support.tbody ) { + + // String was a <table>, *may* have spurious <tbody> + elem = tag === "table" && !rtbody.test( elem ) ? + tmp.firstChild : + + // String was a bare <thead> or <tfoot> + wrap[1] === "<table>" && !rtbody.test( elem ) ? + tmp : + 0; + + j = elem && elem.childNodes.length; + while ( j-- ) { + if ( jQuery.nodeName( (tbody = elem.childNodes[j]), "tbody" ) && !tbody.childNodes.length ) { + elem.removeChild( tbody ); + } + } + } + + jQuery.merge( nodes, tmp.childNodes ); + + // Fix #12392 for WebKit and IE > 9 + tmp.textContent = ""; + + // Fix #12392 for oldIE + while ( tmp.firstChild ) { + tmp.removeChild( tmp.firstChild ); + } + + // Remember the top-level container for proper cleanup + tmp = safe.lastChild; + } + } + } + + // Fix #11356: Clear elements from fragment + if ( tmp ) { + safe.removeChild( tmp ); + } + + // Reset defaultChecked for any radios and checkboxes + // about to be appended to the DOM in IE 6/7 (#8060) + if ( !support.appendChecked ) { + jQuery.grep( getAll( nodes, "input" ), fixDefaultChecked ); + } + + i = 0; + while ( (elem = nodes[ i++ ]) ) { + + // #4087 - If origin and destination elements are the same, and this is + // that element, do not do anything + if ( selection && jQuery.inArray( elem, selection ) !== -1 ) { + continue; + } + + contains = jQuery.contains( elem.ownerDocument, elem ); + + // Append to fragment + tmp = getAll( safe.appendChild( elem ), "script" ); + + // Preserve script evaluation history + if ( contains ) { + setGlobalEval( tmp ); + } + + // Capture executables + if ( scripts ) { + j = 0; + while ( (elem = tmp[ j++ ]) ) { + if ( rscriptType.test( elem.type || "" ) ) { + scripts.push( elem ); + } + } + } + } + + tmp = null; + + return safe; + }, + + cleanData: function( elems, /* internal */ acceptData ) { + var elem, type, id, data, + i = 0, + internalKey = jQuery.expando, + cache = jQuery.cache, + deleteExpando = support.deleteExpando, + special = jQuery.event.special; + + for ( ; (elem = elems[i]) != null; i++ ) { + if ( acceptData || jQuery.acceptData( elem ) ) { + + id = elem[ internalKey ]; + data = id && cache[ id ]; + + if ( data ) { + if ( data.events ) { + for ( type in data.events ) { + if ( special[ type ] ) { + jQuery.event.remove( elem, type ); + + // This is a shortcut to avoid jQuery.event.remove's overhead + } else { + jQuery.removeEvent( elem, type, data.handle ); + } + } + } + + // Remove cache only if it was not already removed by jQuery.event.remove + if ( cache[ id ] ) { + + delete cache[ id ]; + + // IE does not allow us to delete expando properties from nodes, + // nor does it have a removeAttribute function on Document nodes; + // we must handle all of these cases + if ( deleteExpando ) { + delete elem[ internalKey ]; + + } else if ( typeof elem.removeAttribute !== strundefined ) { + elem.removeAttribute( internalKey ); + + } else { + elem[ internalKey ] = null; + } + + deletedIds.push( id ); + } + } + } + } + } +}); + +jQuery.fn.extend({ + text: function( value ) { + return access( this, function( value ) { + return value === undefined ? + jQuery.text( this ) : + this.empty().append( ( this[0] && this[0].ownerDocument || document ).createTextNode( value ) ); + }, null, value, arguments.length ); + }, + + append: function() { + return this.domManip( arguments, function( elem ) { + if ( this.nodeType === 1 || this.nodeType === 11 || this.nodeType === 9 ) { + var target = manipulationTarget( this, elem ); + target.appendChild( elem ); + } + }); + }, + + prepend: function() { + return this.domManip( arguments, function( elem ) { + if ( this.nodeType === 1 || this.nodeType === 11 || this.nodeType === 9 ) { + var target = manipulationTarget( this, elem ); + target.insertBefore( elem, target.firstChild ); + } + }); + }, + + before: function() { + return this.domManip( arguments, function( elem ) { + if ( this.parentNode ) { + this.parentNode.insertBefore( elem, this ); + } + }); + }, + + after: function() { + return this.domManip( arguments, function( elem ) { + if ( this.parentNode ) { + this.parentNode.insertBefore( elem, this.nextSibling ); + } + }); + }, + + remove: function( selector, keepData /* Internal Use Only */ ) { + var elem, + elems = selector ? jQuery.filter( selector, this ) : this, + i = 0; + + for ( ; (elem = elems[i]) != null; i++ ) { + + if ( !keepData && elem.nodeType === 1 ) { + jQuery.cleanData( getAll( elem ) ); + } + + if ( elem.parentNode ) { + if ( keepData && jQuery.contains( elem.ownerDocument, elem ) ) { + setGlobalEval( getAll( elem, "script" ) ); + } + elem.parentNode.removeChild( elem ); + } + } + + return this; + }, + + empty: function() { + var elem, + i = 0; + + for ( ; (elem = this[i]) != null; i++ ) { + // Remove element nodes and prevent memory leaks + if ( elem.nodeType === 1 ) { + jQuery.cleanData( getAll( elem, false ) ); + } + + // Remove any remaining nodes + while ( elem.firstChild ) { + elem.removeChild( elem.firstChild ); + } + + // If this is a select, ensure that it displays empty (#12336) + // Support: IE<9 + if ( elem.options && jQuery.nodeName( elem, "select" ) ) { + elem.options.length = 0; + } + } + + return this; + }, + + clone: function( dataAndEvents, deepDataAndEvents ) { + dataAndEvents = dataAndEvents == null ? false : dataAndEvents; + deepDataAndEvents = deepDataAndEvents == null ? dataAndEvents : deepDataAndEvents; + + return this.map(function() { + return jQuery.clone( this, dataAndEvents, deepDataAndEvents ); + }); + }, + + html: function( value ) { + return access( this, function( value ) { + var elem = this[ 0 ] || {}, + i = 0, + l = this.length; + + if ( value === undefined ) { + return elem.nodeType === 1 ? + elem.innerHTML.replace( rinlinejQuery, "" ) : + undefined; + } + + // See if we can take a shortcut and just use innerHTML + if ( typeof value === "string" && !rnoInnerhtml.test( value ) && + ( support.htmlSerialize || !rnoshimcache.test( value ) ) && + ( support.leadingWhitespace || !rleadingWhitespace.test( value ) ) && + !wrapMap[ (rtagName.exec( value ) || [ "", "" ])[ 1 ].toLowerCase() ] ) { + + value = value.replace( rxhtmlTag, "<$1></$2>" ); + + try { + for (; i < l; i++ ) { + // Remove element nodes and prevent memory leaks + elem = this[i] || {}; + if ( elem.nodeType === 1 ) { + jQuery.cleanData( getAll( elem, false ) ); + elem.innerHTML = value; + } + } + + elem = 0; + + // If using innerHTML throws an exception, use the fallback method + } catch(e) {} + } + + if ( elem ) { + this.empty().append( value ); + } + }, null, value, arguments.length ); + }, + + replaceWith: function() { + var arg = arguments[ 0 ]; + + // Make the changes, replacing each context element with the new content + this.domManip( arguments, function( elem ) { + arg = this.parentNode; + + jQuery.cleanData( getAll( this ) ); + + if ( arg ) { + arg.replaceChild( elem, this ); + } + }); + + // Force removal if there was no new content (e.g., from empty arguments) + return arg && (arg.length || arg.nodeType) ? this : this.remove(); + }, + + detach: function( selector ) { + return this.remove( selector, true ); + }, + + domManip: function( args, callback ) { + + // Flatten any nested arrays + args = concat.apply( [], args ); + + var first, node, hasScripts, + scripts, doc, fragment, + i = 0, + l = this.length, + set = this, + iNoClone = l - 1, + value = args[0], + isFunction = jQuery.isFunction( value ); + + // We can't cloneNode fragments that contain checked, in WebKit + if ( isFunction || + ( l > 1 && typeof value === "string" && + !support.checkClone && rchecked.test( value ) ) ) { + return this.each(function( index ) { + var self = set.eq( index ); + if ( isFunction ) { + args[0] = value.call( this, index, self.html() ); + } + self.domManip( args, callback ); + }); + } + + if ( l ) { + fragment = jQuery.buildFragment( args, this[ 0 ].ownerDocument, false, this ); + first = fragment.firstChild; + + if ( fragment.childNodes.length === 1 ) { + fragment = first; + } + + if ( first ) { + scripts = jQuery.map( getAll( fragment, "script" ), disableScript ); + hasScripts = scripts.length; + + // Use the original fragment for the last item instead of the first because it can end up + // being emptied incorrectly in certain situations (#8070). + for ( ; i < l; i++ ) { + node = fragment; + + if ( i !== iNoClone ) { + node = jQuery.clone( node, true, true ); + + // Keep references to cloned scripts for later restoration + if ( hasScripts ) { + jQuery.merge( scripts, getAll( node, "script" ) ); + } + } + + callback.call( this[i], node, i ); + } + + if ( hasScripts ) { + doc = scripts[ scripts.length - 1 ].ownerDocument; + + // Reenable scripts + jQuery.map( scripts, restoreScript ); + + // Evaluate executable scripts on first document insertion + for ( i = 0; i < hasScripts; i++ ) { + node = scripts[ i ]; + if ( rscriptType.test( node.type || "" ) && + !jQuery._data( node, "globalEval" ) && jQuery.contains( doc, node ) ) { + + if ( node.src ) { + // Optional AJAX dependency, but won't run scripts if not present + if ( jQuery._evalUrl ) { + jQuery._evalUrl( node.src ); + } + } else { + jQuery.globalEval( ( node.text || node.textContent || node.innerHTML || "" ).replace( rcleanScript, "" ) ); + } + } + } + } + + // Fix #11809: Avoid leaking memory + fragment = first = null; + } + } + + return this; + } +}); + +jQuery.each({ + appendTo: "append", + prependTo: "prepend", + insertBefore: "before", + insertAfter: "after", + replaceAll: "replaceWith" +}, function( name, original ) { + jQuery.fn[ name ] = function( selector ) { + var elems, + i = 0, + ret = [], + insert = jQuery( selector ), + last = insert.length - 1; + + for ( ; i <= last; i++ ) { + elems = i === last ? this : this.clone(true); + jQuery( insert[i] )[ original ]( elems ); + + // Modern browsers can apply jQuery collections as arrays, but oldIE needs a .get() + push.apply( ret, elems.get() ); + } + + return this.pushStack( ret ); + }; +}); + + +var iframe, + elemdisplay = {}; + +/** + * Retrieve the actual display of a element + * @param {String} name nodeName of the element + * @param {Object} doc Document object + */ +// Called only from within defaultDisplay +function actualDisplay( name, doc ) { + var style, + elem = jQuery( doc.createElement( name ) ).appendTo( doc.body ), + + // getDefaultComputedStyle might be reliably used only on attached element + display = window.getDefaultComputedStyle && ( style = window.getDefaultComputedStyle( elem[ 0 ] ) ) ? + + // Use of this method is a temporary fix (more like optmization) until something better comes along, + // since it was removed from specification and supported only in FF + style.display : jQuery.css( elem[ 0 ], "display" ); + + // We don't have any data stored on the element, + // so use "detach" method as fast way to get rid of the element + elem.detach(); + + return display; +} + +/** + * Try to determine the default display value of an element + * @param {String} nodeName + */ +function defaultDisplay( nodeName ) { + var doc = document, + display = elemdisplay[ nodeName ]; + + if ( !display ) { + display = actualDisplay( nodeName, doc ); + + // If the simple way fails, read from inside an iframe + if ( display === "none" || !display ) { + + // Use the already-created iframe if possible + iframe = (iframe || jQuery( "<iframe frameborder='0' width='0' height='0'/>" )).appendTo( doc.documentElement ); + + // Always write a new HTML skeleton so Webkit and Firefox don't choke on reuse + doc = ( iframe[ 0 ].contentWindow || iframe[ 0 ].contentDocument ).document; + + // Support: IE + doc.write(); + doc.close(); + + display = actualDisplay( nodeName, doc ); + iframe.detach(); + } + + // Store the correct default display + elemdisplay[ nodeName ] = display; + } + + return display; +} + + +(function() { + var shrinkWrapBlocksVal; + + support.shrinkWrapBlocks = function() { + if ( shrinkWrapBlocksVal != null ) { + return shrinkWrapBlocksVal; + } + + // Will be changed later if needed. + shrinkWrapBlocksVal = false; + + // Minified: var b,c,d + var div, body, container; + + body = document.getElementsByTagName( "body" )[ 0 ]; + if ( !body || !body.style ) { + // Test fired too early or in an unsupported environment, exit. + return; + } + + // Setup + div = document.createElement( "div" ); + container = document.createElement( "div" ); + container.style.cssText = "position:absolute;border:0;width:0;height:0;top:0;left:-9999px"; + body.appendChild( container ).appendChild( div ); + + // Support: IE6 + // Check if elements with layout shrink-wrap their children + if ( typeof div.style.zoom !== strundefined ) { + // Reset CSS: box-sizing; display; margin; border + div.style.cssText = + // Support: Firefox<29, Android 2.3 + // Vendor-prefix box-sizing + "-webkit-box-sizing:content-box;-moz-box-sizing:content-box;" + + "box-sizing:content-box;display:block;margin:0;border:0;" + + "padding:1px;width:1px;zoom:1"; + div.appendChild( document.createElement( "div" ) ).style.width = "5px"; + shrinkWrapBlocksVal = div.offsetWidth !== 3; + } + + body.removeChild( container ); + + return shrinkWrapBlocksVal; + }; + +})(); +var rmargin = (/^margin/); + +var rnumnonpx = new RegExp( "^(" + pnum + ")(?!px)[a-z%]+$", "i" ); + + + +var getStyles, curCSS, + rposition = /^(top|right|bottom|left)$/; + +if ( window.getComputedStyle ) { + getStyles = function( elem ) { + return elem.ownerDocument.defaultView.getComputedStyle( elem, null ); + }; + + curCSS = function( elem, name, computed ) { + var width, minWidth, maxWidth, ret, + style = elem.style; + + computed = computed || getStyles( elem ); + + // getPropertyValue is only needed for .css('filter') in IE9, see #12537 + ret = computed ? computed.getPropertyValue( name ) || computed[ name ] : undefined; + + if ( computed ) { + + if ( ret === "" && !jQuery.contains( elem.ownerDocument, elem ) ) { + ret = jQuery.style( elem, name ); + } + + // A tribute to the "awesome hack by Dean Edwards" + // Chrome < 17 and Safari 5.0 uses "computed value" instead of "used value" for margin-right + // Safari 5.1.7 (at least) returns percentage for a larger set of values, but width seems to be reliably pixels + // this is against the CSSOM draft spec: http://dev.w3.org/csswg/cssom/#resolved-values + if ( rnumnonpx.test( ret ) && rmargin.test( name ) ) { + + // Remember the original values + width = style.width; + minWidth = style.minWidth; + maxWidth = style.maxWidth; + + // Put in the new values to get a computed value out + style.minWidth = style.maxWidth = style.width = ret; + ret = computed.width; + + // Revert the changed values + style.width = width; + style.minWidth = minWidth; + style.maxWidth = maxWidth; + } + } + + // Support: IE + // IE returns zIndex value as an integer. + return ret === undefined ? + ret : + ret + ""; + }; +} else if ( document.documentElement.currentStyle ) { + getStyles = function( elem ) { + return elem.currentStyle; + }; + + curCSS = function( elem, name, computed ) { + var left, rs, rsLeft, ret, + style = elem.style; + + computed = computed || getStyles( elem ); + ret = computed ? computed[ name ] : undefined; + + // Avoid setting ret to empty string here + // so we don't default to auto + if ( ret == null && style && style[ name ] ) { + ret = style[ name ]; + } + + // From the awesome hack by Dean Edwards + // http://erik.eae.net/archives/2007/07/27/18.54.15/#comment-102291 + + // If we're not dealing with a regular pixel number + // but a number that has a weird ending, we need to convert it to pixels + // but not position css attributes, as those are proportional to the parent element instead + // and we can't measure the parent instead because it might trigger a "stacking dolls" problem + if ( rnumnonpx.test( ret ) && !rposition.test( name ) ) { + + // Remember the original values + left = style.left; + rs = elem.runtimeStyle; + rsLeft = rs && rs.left; + + // Put in the new values to get a computed value out + if ( rsLeft ) { + rs.left = elem.currentStyle.left; + } + style.left = name === "fontSize" ? "1em" : ret; + ret = style.pixelLeft + "px"; + + // Revert the changed values + style.left = left; + if ( rsLeft ) { + rs.left = rsLeft; + } + } + + // Support: IE + // IE returns zIndex value as an integer. + return ret === undefined ? + ret : + ret + "" || "auto"; + }; +} + + + + +function addGetHookIf( conditionFn, hookFn ) { + // Define the hook, we'll check on the first run if it's really needed. + return { + get: function() { + var condition = conditionFn(); + + if ( condition == null ) { + // The test was not ready at this point; screw the hook this time + // but check again when needed next time. + return; + } + + if ( condition ) { + // Hook not needed (or it's not possible to use it due to missing dependency), + // remove it. + // Since there are no other hooks for marginRight, remove the whole object. + delete this.get; + return; + } + + // Hook needed; redefine it so that the support test is not executed again. + + return (this.get = hookFn).apply( this, arguments ); + } + }; +} + + +(function() { + // Minified: var b,c,d,e,f,g, h,i + var div, style, a, pixelPositionVal, boxSizingReliableVal, + reliableHiddenOffsetsVal, reliableMarginRightVal; + + // Setup + div = document.createElement( "div" ); + div.innerHTML = " <link/><table></table><a href='/a'>a</a><input type='checkbox'/>"; + a = div.getElementsByTagName( "a" )[ 0 ]; + style = a && a.style; + + // Finish early in limited (non-browser) environments + if ( !style ) { + return; + } + + style.cssText = "float:left;opacity:.5"; + + // Support: IE<9 + // Make sure that element opacity exists (as opposed to filter) + support.opacity = style.opacity === "0.5"; + + // Verify style float existence + // (IE uses styleFloat instead of cssFloat) + support.cssFloat = !!style.cssFloat; + + div.style.backgroundClip = "content-box"; + div.cloneNode( true ).style.backgroundClip = ""; + support.clearCloneStyle = div.style.backgroundClip === "content-box"; + + // Support: Firefox<29, Android 2.3 + // Vendor-prefix box-sizing + support.boxSizing = style.boxSizing === "" || style.MozBoxSizing === "" || + style.WebkitBoxSizing === ""; + + jQuery.extend(support, { + reliableHiddenOffsets: function() { + if ( reliableHiddenOffsetsVal == null ) { + computeStyleTests(); + } + return reliableHiddenOffsetsVal; + }, + + boxSizingReliable: function() { + if ( boxSizingReliableVal == null ) { + computeStyleTests(); + } + return boxSizingReliableVal; + }, + + pixelPosition: function() { + if ( pixelPositionVal == null ) { + computeStyleTests(); + } + return pixelPositionVal; + }, + + // Support: Android 2.3 + reliableMarginRight: function() { + if ( reliableMarginRightVal == null ) { + computeStyleTests(); + } + return reliableMarginRightVal; + } + }); + + function computeStyleTests() { + // Minified: var b,c,d,j + var div, body, container, contents; + + body = document.getElementsByTagName( "body" )[ 0 ]; + if ( !body || !body.style ) { + // Test fired too early or in an unsupported environment, exit. + return; + } + + // Setup + div = document.createElement( "div" ); + container = document.createElement( "div" ); + container.style.cssText = "position:absolute;border:0;width:0;height:0;top:0;left:-9999px"; + body.appendChild( container ).appendChild( div ); + + div.style.cssText = + // Support: Firefox<29, Android 2.3 + // Vendor-prefix box-sizing + "-webkit-box-sizing:border-box;-moz-box-sizing:border-box;" + + "box-sizing:border-box;display:block;margin-top:1%;top:1%;" + + "border:1px;padding:1px;width:4px;position:absolute"; + + // Support: IE<9 + // Assume reasonable values in the absence of getComputedStyle + pixelPositionVal = boxSizingReliableVal = false; + reliableMarginRightVal = true; + + // Check for getComputedStyle so that this code is not run in IE<9. + if ( window.getComputedStyle ) { + pixelPositionVal = ( window.getComputedStyle( div, null ) || {} ).top !== "1%"; + boxSizingReliableVal = + ( window.getComputedStyle( div, null ) || { width: "4px" } ).width === "4px"; + + // Support: Android 2.3 + // Div with explicit width and no margin-right incorrectly + // gets computed margin-right based on width of container (#3333) + // WebKit Bug 13343 - getComputedStyle returns wrong value for margin-right + contents = div.appendChild( document.createElement( "div" ) ); + + // Reset CSS: box-sizing; display; margin; border; padding + contents.style.cssText = div.style.cssText = + // Support: Firefox<29, Android 2.3 + // Vendor-prefix box-sizing + "-webkit-box-sizing:content-box;-moz-box-sizing:content-box;" + + "box-sizing:content-box;display:block;margin:0;border:0;padding:0"; + contents.style.marginRight = contents.style.width = "0"; + div.style.width = "1px"; + + reliableMarginRightVal = + !parseFloat( ( window.getComputedStyle( contents, null ) || {} ).marginRight ); + } + + // Support: IE8 + // Check if table cells still have offsetWidth/Height when they are set + // to display:none and there are still other visible table cells in a + // table row; if so, offsetWidth/Height are not reliable for use when + // determining if an element has been hidden directly using + // display:none (it is still safe to use offsets if a parent element is + // hidden; don safety goggles and see bug #4512 for more information). + div.innerHTML = "<table><tr><td></td><td>t</td></tr></table>"; + contents = div.getElementsByTagName( "td" ); + contents[ 0 ].style.cssText = "margin:0;border:0;padding:0;display:none"; + reliableHiddenOffsetsVal = contents[ 0 ].offsetHeight === 0; + if ( reliableHiddenOffsetsVal ) { + contents[ 0 ].style.display = ""; + contents[ 1 ].style.display = "none"; + reliableHiddenOffsetsVal = contents[ 0 ].offsetHeight === 0; + } + + body.removeChild( container ); + } + +})(); + + +// A method for quickly swapping in/out CSS properties to get correct calculations. +jQuery.swap = function( elem, options, callback, args ) { + var ret, name, + old = {}; + + // Remember the old values, and insert the new ones + for ( name in options ) { + old[ name ] = elem.style[ name ]; + elem.style[ name ] = options[ name ]; + } + + ret = callback.apply( elem, args || [] ); + + // Revert the old values + for ( name in options ) { + elem.style[ name ] = old[ name ]; + } + + return ret; +}; + + +var + ralpha = /alpha\([^)]*\)/i, + ropacity = /opacity\s*=\s*([^)]*)/, + + // swappable if display is none or starts with table except "table", "table-cell", or "table-caption" + // see here for display values: https://developer.mozilla.org/en-US/docs/CSS/display + rdisplayswap = /^(none|table(?!-c[ea]).+)/, + rnumsplit = new RegExp( "^(" + pnum + ")(.*)$", "i" ), + rrelNum = new RegExp( "^([+-])=(" + pnum + ")", "i" ), + + cssShow = { position: "absolute", visibility: "hidden", display: "block" }, + cssNormalTransform = { + letterSpacing: "0", + fontWeight: "400" + }, + + cssPrefixes = [ "Webkit", "O", "Moz", "ms" ]; + + +// return a css property mapped to a potentially vendor prefixed property +function vendorPropName( style, name ) { + + // shortcut for names that are not vendor prefixed + if ( name in style ) { + return name; + } + + // check for vendor prefixed names + var capName = name.charAt(0).toUpperCase() + name.slice(1), + origName = name, + i = cssPrefixes.length; + + while ( i-- ) { + name = cssPrefixes[ i ] + capName; + if ( name in style ) { + return name; + } + } + + return origName; +} + +function showHide( elements, show ) { + var display, elem, hidden, + values = [], + index = 0, + length = elements.length; + + for ( ; index < length; index++ ) { + elem = elements[ index ]; + if ( !elem.style ) { + continue; + } + + values[ index ] = jQuery._data( elem, "olddisplay" ); + display = elem.style.display; + if ( show ) { + // Reset the inline display of this element to learn if it is + // being hidden by cascaded rules or not + if ( !values[ index ] && display === "none" ) { + elem.style.display = ""; + } + + // Set elements which have been overridden with display: none + // in a stylesheet to whatever the default browser style is + // for such an element + if ( elem.style.display === "" && isHidden( elem ) ) { + values[ index ] = jQuery._data( elem, "olddisplay", defaultDisplay(elem.nodeName) ); + } + } else { + hidden = isHidden( elem ); + + if ( display && display !== "none" || !hidden ) { + jQuery._data( elem, "olddisplay", hidden ? display : jQuery.css( elem, "display" ) ); + } + } + } + + // Set the display of most of the elements in a second loop + // to avoid the constant reflow + for ( index = 0; index < length; index++ ) { + elem = elements[ index ]; + if ( !elem.style ) { + continue; + } + if ( !show || elem.style.display === "none" || elem.style.display === "" ) { + elem.style.display = show ? values[ index ] || "" : "none"; + } + } + + return elements; +} + +function setPositiveNumber( elem, value, subtract ) { + var matches = rnumsplit.exec( value ); + return matches ? + // Guard against undefined "subtract", e.g., when used as in cssHooks + Math.max( 0, matches[ 1 ] - ( subtract || 0 ) ) + ( matches[ 2 ] || "px" ) : + value; +} + +function augmentWidthOrHeight( elem, name, extra, isBorderBox, styles ) { + var i = extra === ( isBorderBox ? "border" : "content" ) ? + // If we already have the right measurement, avoid augmentation + 4 : + // Otherwise initialize for horizontal or vertical properties + name === "width" ? 1 : 0, + + val = 0; + + for ( ; i < 4; i += 2 ) { + // both box models exclude margin, so add it if we want it + if ( extra === "margin" ) { + val += jQuery.css( elem, extra + cssExpand[ i ], true, styles ); + } + + if ( isBorderBox ) { + // border-box includes padding, so remove it if we want content + if ( extra === "content" ) { + val -= jQuery.css( elem, "padding" + cssExpand[ i ], true, styles ); + } + + // at this point, extra isn't border nor margin, so remove border + if ( extra !== "margin" ) { + val -= jQuery.css( elem, "border" + cssExpand[ i ] + "Width", true, styles ); + } + } else { + // at this point, extra isn't content, so add padding + val += jQuery.css( elem, "padding" + cssExpand[ i ], true, styles ); + + // at this point, extra isn't content nor padding, so add border + if ( extra !== "padding" ) { + val += jQuery.css( elem, "border" + cssExpand[ i ] + "Width", true, styles ); + } + } + } + + return val; +} + +function getWidthOrHeight( elem, name, extra ) { + + // Start with offset property, which is equivalent to the border-box value + var valueIsBorderBox = true, + val = name === "width" ? elem.offsetWidth : elem.offsetHeight, + styles = getStyles( elem ), + isBorderBox = support.boxSizing && jQuery.css( elem, "boxSizing", false, styles ) === "border-box"; + + // some non-html elements return undefined for offsetWidth, so check for null/undefined + // svg - https://bugzilla.mozilla.org/show_bug.cgi?id=649285 + // MathML - https://bugzilla.mozilla.org/show_bug.cgi?id=491668 + if ( val <= 0 || val == null ) { + // Fall back to computed then uncomputed css if necessary + val = curCSS( elem, name, styles ); + if ( val < 0 || val == null ) { + val = elem.style[ name ]; + } + + // Computed unit is not pixels. Stop here and return. + if ( rnumnonpx.test(val) ) { + return val; + } + + // we need the check for style in case a browser which returns unreliable values + // for getComputedStyle silently falls back to the reliable elem.style + valueIsBorderBox = isBorderBox && ( support.boxSizingReliable() || val === elem.style[ name ] ); + + // Normalize "", auto, and prepare for extra + val = parseFloat( val ) || 0; + } + + // use the active box-sizing model to add/subtract irrelevant styles + return ( val + + augmentWidthOrHeight( + elem, + name, + extra || ( isBorderBox ? "border" : "content" ), + valueIsBorderBox, + styles + ) + ) + "px"; +} + +jQuery.extend({ + // Add in style property hooks for overriding the default + // behavior of getting and setting a style property + cssHooks: { + opacity: { + get: function( elem, computed ) { + if ( computed ) { + // We should always get a number back from opacity + var ret = curCSS( elem, "opacity" ); + return ret === "" ? "1" : ret; + } + } + } + }, + + // Don't automatically add "px" to these possibly-unitless properties + cssNumber: { + "columnCount": true, + "fillOpacity": true, + "flexGrow": true, + "flexShrink": true, + "fontWeight": true, + "lineHeight": true, + "opacity": true, + "order": true, + "orphans": true, + "widows": true, + "zIndex": true, + "zoom": true + }, + + // Add in properties whose names you wish to fix before + // setting or getting the value + cssProps: { + // normalize float css property + "float": support.cssFloat ? "cssFloat" : "styleFloat" + }, + + // Get and set the style property on a DOM Node + style: function( elem, name, value, extra ) { + // Don't set styles on text and comment nodes + if ( !elem || elem.nodeType === 3 || elem.nodeType === 8 || !elem.style ) { + return; + } + + // Make sure that we're working with the right name + var ret, type, hooks, + origName = jQuery.camelCase( name ), + style = elem.style; + + name = jQuery.cssProps[ origName ] || ( jQuery.cssProps[ origName ] = vendorPropName( style, origName ) ); + + // gets hook for the prefixed version + // followed by the unprefixed version + hooks = jQuery.cssHooks[ name ] || jQuery.cssHooks[ origName ]; + + // Check if we're setting a value + if ( value !== undefined ) { + type = typeof value; + + // convert relative number strings (+= or -=) to relative numbers. #7345 + if ( type === "string" && (ret = rrelNum.exec( value )) ) { + value = ( ret[1] + 1 ) * ret[2] + parseFloat( jQuery.css( elem, name ) ); + // Fixes bug #9237 + type = "number"; + } + + // Make sure that null and NaN values aren't set. See: #7116 + if ( value == null || value !== value ) { + return; + } + + // If a number was passed in, add 'px' to the (except for certain CSS properties) + if ( type === "number" && !jQuery.cssNumber[ origName ] ) { + value += "px"; + } + + // Fixes #8908, it can be done more correctly by specifing setters in cssHooks, + // but it would mean to define eight (for every problematic property) identical functions + if ( !support.clearCloneStyle && value === "" && name.indexOf("background") === 0 ) { + style[ name ] = "inherit"; + } + + // If a hook was provided, use that value, otherwise just set the specified value + if ( !hooks || !("set" in hooks) || (value = hooks.set( elem, value, extra )) !== undefined ) { + + // Support: IE + // Swallow errors from 'invalid' CSS values (#5509) + try { + style[ name ] = value; + } catch(e) {} + } + + } else { + // If a hook was provided get the non-computed value from there + if ( hooks && "get" in hooks && (ret = hooks.get( elem, false, extra )) !== undefined ) { + return ret; + } + + // Otherwise just get the value from the style object + return style[ name ]; + } + }, + + css: function( elem, name, extra, styles ) { + var num, val, hooks, + origName = jQuery.camelCase( name ); + + // Make sure that we're working with the right name + name = jQuery.cssProps[ origName ] || ( jQuery.cssProps[ origName ] = vendorPropName( elem.style, origName ) ); + + // gets hook for the prefixed version + // followed by the unprefixed version + hooks = jQuery.cssHooks[ name ] || jQuery.cssHooks[ origName ]; + + // If a hook was provided get the computed value from there + if ( hooks && "get" in hooks ) { + val = hooks.get( elem, true, extra ); + } + + // Otherwise, if a way to get the computed value exists, use that + if ( val === undefined ) { + val = curCSS( elem, name, styles ); + } + + //convert "normal" to computed value + if ( val === "normal" && name in cssNormalTransform ) { + val = cssNormalTransform[ name ]; + } + + // Return, converting to number if forced or a qualifier was provided and val looks numeric + if ( extra === "" || extra ) { + num = parseFloat( val ); + return extra === true || jQuery.isNumeric( num ) ? num || 0 : val; + } + return val; + } +}); + +jQuery.each([ "height", "width" ], function( i, name ) { + jQuery.cssHooks[ name ] = { + get: function( elem, computed, extra ) { + if ( computed ) { + // certain elements can have dimension info if we invisibly show them + // however, it must have a current display style that would benefit from this + return rdisplayswap.test( jQuery.css( elem, "display" ) ) && elem.offsetWidth === 0 ? + jQuery.swap( elem, cssShow, function() { + return getWidthOrHeight( elem, name, extra ); + }) : + getWidthOrHeight( elem, name, extra ); + } + }, + + set: function( elem, value, extra ) { + var styles = extra && getStyles( elem ); + return setPositiveNumber( elem, value, extra ? + augmentWidthOrHeight( + elem, + name, + extra, + support.boxSizing && jQuery.css( elem, "boxSizing", false, styles ) === "border-box", + styles + ) : 0 + ); + } + }; +}); + +if ( !support.opacity ) { + jQuery.cssHooks.opacity = { + get: function( elem, computed ) { + // IE uses filters for opacity + return ropacity.test( (computed && elem.currentStyle ? elem.currentStyle.filter : elem.style.filter) || "" ) ? + ( 0.01 * parseFloat( RegExp.$1 ) ) + "" : + computed ? "1" : ""; + }, + + set: function( elem, value ) { + var style = elem.style, + currentStyle = elem.currentStyle, + opacity = jQuery.isNumeric( value ) ? "alpha(opacity=" + value * 100 + ")" : "", + filter = currentStyle && currentStyle.filter || style.filter || ""; + + // IE has trouble with opacity if it does not have layout + // Force it by setting the zoom level + style.zoom = 1; + + // if setting opacity to 1, and no other filters exist - attempt to remove filter attribute #6652 + // if value === "", then remove inline opacity #12685 + if ( ( value >= 1 || value === "" ) && + jQuery.trim( filter.replace( ralpha, "" ) ) === "" && + style.removeAttribute ) { + + // Setting style.filter to null, "" & " " still leave "filter:" in the cssText + // if "filter:" is present at all, clearType is disabled, we want to avoid this + // style.removeAttribute is IE Only, but so apparently is this code path... + style.removeAttribute( "filter" ); + + // if there is no filter style applied in a css rule or unset inline opacity, we are done + if ( value === "" || currentStyle && !currentStyle.filter ) { + return; + } + } + + // otherwise, set new filter values + style.filter = ralpha.test( filter ) ? + filter.replace( ralpha, opacity ) : + filter + " " + opacity; + } + }; +} + +jQuery.cssHooks.marginRight = addGetHookIf( support.reliableMarginRight, + function( elem, computed ) { + if ( computed ) { + // WebKit Bug 13343 - getComputedStyle returns wrong value for margin-right + // Work around by temporarily setting element display to inline-block + return jQuery.swap( elem, { "display": "inline-block" }, + curCSS, [ elem, "marginRight" ] ); + } + } +); + +// These hooks are used by animate to expand properties +jQuery.each({ + margin: "", + padding: "", + border: "Width" +}, function( prefix, suffix ) { + jQuery.cssHooks[ prefix + suffix ] = { + expand: function( value ) { + var i = 0, + expanded = {}, + + // assumes a single number if not a string + parts = typeof value === "string" ? value.split(" ") : [ value ]; + + for ( ; i < 4; i++ ) { + expanded[ prefix + cssExpand[ i ] + suffix ] = + parts[ i ] || parts[ i - 2 ] || parts[ 0 ]; + } + + return expanded; + } + }; + + if ( !rmargin.test( prefix ) ) { + jQuery.cssHooks[ prefix + suffix ].set = setPositiveNumber; + } +}); + +jQuery.fn.extend({ + css: function( name, value ) { + return access( this, function( elem, name, value ) { + var styles, len, + map = {}, + i = 0; + + if ( jQuery.isArray( name ) ) { + styles = getStyles( elem ); + len = name.length; + + for ( ; i < len; i++ ) { + map[ name[ i ] ] = jQuery.css( elem, name[ i ], false, styles ); + } + + return map; + } + + return value !== undefined ? + jQuery.style( elem, name, value ) : + jQuery.css( elem, name ); + }, name, value, arguments.length > 1 ); + }, + show: function() { + return showHide( this, true ); + }, + hide: function() { + return showHide( this ); + }, + toggle: function( state ) { + if ( typeof state === "boolean" ) { + return state ? this.show() : this.hide(); + } + + return this.each(function() { + if ( isHidden( this ) ) { + jQuery( this ).show(); + } else { + jQuery( this ).hide(); + } + }); + } +}); + + +function Tween( elem, options, prop, end, easing ) { + return new Tween.prototype.init( elem, options, prop, end, easing ); +} +jQuery.Tween = Tween; + +Tween.prototype = { + constructor: Tween, + init: function( elem, options, prop, end, easing, unit ) { + this.elem = elem; + this.prop = prop; + this.easing = easing || "swing"; + this.options = options; + this.start = this.now = this.cur(); + this.end = end; + this.unit = unit || ( jQuery.cssNumber[ prop ] ? "" : "px" ); + }, + cur: function() { + var hooks = Tween.propHooks[ this.prop ]; + + return hooks && hooks.get ? + hooks.get( this ) : + Tween.propHooks._default.get( this ); + }, + run: function( percent ) { + var eased, + hooks = Tween.propHooks[ this.prop ]; + + if ( this.options.duration ) { + this.pos = eased = jQuery.easing[ this.easing ]( + percent, this.options.duration * percent, 0, 1, this.options.duration + ); + } else { + this.pos = eased = percent; + } + this.now = ( this.end - this.start ) * eased + this.start; + + if ( this.options.step ) { + this.options.step.call( this.elem, this.now, this ); + } + + if ( hooks && hooks.set ) { + hooks.set( this ); + } else { + Tween.propHooks._default.set( this ); + } + return this; + } +}; + +Tween.prototype.init.prototype = Tween.prototype; + +Tween.propHooks = { + _default: { + get: function( tween ) { + var result; + + if ( tween.elem[ tween.prop ] != null && + (!tween.elem.style || tween.elem.style[ tween.prop ] == null) ) { + return tween.elem[ tween.prop ]; + } + + // passing an empty string as a 3rd parameter to .css will automatically + // attempt a parseFloat and fallback to a string if the parse fails + // so, simple values such as "10px" are parsed to Float. + // complex values such as "rotate(1rad)" are returned as is. + result = jQuery.css( tween.elem, tween.prop, "" ); + // Empty strings, null, undefined and "auto" are converted to 0. + return !result || result === "auto" ? 0 : result; + }, + set: function( tween ) { + // use step hook for back compat - use cssHook if its there - use .style if its + // available and use plain properties where available + if ( jQuery.fx.step[ tween.prop ] ) { + jQuery.fx.step[ tween.prop ]( tween ); + } else if ( tween.elem.style && ( tween.elem.style[ jQuery.cssProps[ tween.prop ] ] != null || jQuery.cssHooks[ tween.prop ] ) ) { + jQuery.style( tween.elem, tween.prop, tween.now + tween.unit ); + } else { + tween.elem[ tween.prop ] = tween.now; + } + } + } +}; + +// Support: IE <=9 +// Panic based approach to setting things on disconnected nodes + +Tween.propHooks.scrollTop = Tween.propHooks.scrollLeft = { + set: function( tween ) { + if ( tween.elem.nodeType && tween.elem.parentNode ) { + tween.elem[ tween.prop ] = tween.now; + } + } +}; + +jQuery.easing = { + linear: function( p ) { + return p; + }, + swing: function( p ) { + return 0.5 - Math.cos( p * Math.PI ) / 2; + } +}; + +jQuery.fx = Tween.prototype.init; + +// Back Compat <1.8 extension point +jQuery.fx.step = {}; + + + + +var + fxNow, timerId, + rfxtypes = /^(?:toggle|show|hide)$/, + rfxnum = new RegExp( "^(?:([+-])=|)(" + pnum + ")([a-z%]*)$", "i" ), + rrun = /queueHooks$/, + animationPrefilters = [ defaultPrefilter ], + tweeners = { + "*": [ function( prop, value ) { + var tween = this.createTween( prop, value ), + target = tween.cur(), + parts = rfxnum.exec( value ), + unit = parts && parts[ 3 ] || ( jQuery.cssNumber[ prop ] ? "" : "px" ), + + // Starting value computation is required for potential unit mismatches + start = ( jQuery.cssNumber[ prop ] || unit !== "px" && +target ) && + rfxnum.exec( jQuery.css( tween.elem, prop ) ), + scale = 1, + maxIterations = 20; + + if ( start && start[ 3 ] !== unit ) { + // Trust units reported by jQuery.css + unit = unit || start[ 3 ]; + + // Make sure we update the tween properties later on + parts = parts || []; + + // Iteratively approximate from a nonzero starting point + start = +target || 1; + + do { + // If previous iteration zeroed out, double until we get *something* + // Use a string for doubling factor so we don't accidentally see scale as unchanged below + scale = scale || ".5"; + + // Adjust and apply + start = start / scale; + jQuery.style( tween.elem, prop, start + unit ); + + // Update scale, tolerating zero or NaN from tween.cur() + // And breaking the loop if scale is unchanged or perfect, or if we've just had enough + } while ( scale !== (scale = tween.cur() / target) && scale !== 1 && --maxIterations ); + } + + // Update tween properties + if ( parts ) { + start = tween.start = +start || +target || 0; + tween.unit = unit; + // If a +=/-= token was provided, we're doing a relative animation + tween.end = parts[ 1 ] ? + start + ( parts[ 1 ] + 1 ) * parts[ 2 ] : + +parts[ 2 ]; + } + + return tween; + } ] + }; + +// Animations created synchronously will run synchronously +function createFxNow() { + setTimeout(function() { + fxNow = undefined; + }); + return ( fxNow = jQuery.now() ); +} + +// Generate parameters to create a standard animation +function genFx( type, includeWidth ) { + var which, + attrs = { height: type }, + i = 0; + + // if we include width, step value is 1 to do all cssExpand values, + // if we don't include width, step value is 2 to skip over Left and Right + includeWidth = includeWidth ? 1 : 0; + for ( ; i < 4 ; i += 2 - includeWidth ) { + which = cssExpand[ i ]; + attrs[ "margin" + which ] = attrs[ "padding" + which ] = type; + } + + if ( includeWidth ) { + attrs.opacity = attrs.width = type; + } + + return attrs; +} + +function createTween( value, prop, animation ) { + var tween, + collection = ( tweeners[ prop ] || [] ).concat( tweeners[ "*" ] ), + index = 0, + length = collection.length; + for ( ; index < length; index++ ) { + if ( (tween = collection[ index ].call( animation, prop, value )) ) { + + // we're done with this property + return tween; + } + } +} + +function defaultPrefilter( elem, props, opts ) { + /* jshint validthis: true */ + var prop, value, toggle, tween, hooks, oldfire, display, checkDisplay, + anim = this, + orig = {}, + style = elem.style, + hidden = elem.nodeType && isHidden( elem ), + dataShow = jQuery._data( elem, "fxshow" ); + + // handle queue: false promises + if ( !opts.queue ) { + hooks = jQuery._queueHooks( elem, "fx" ); + if ( hooks.unqueued == null ) { + hooks.unqueued = 0; + oldfire = hooks.empty.fire; + hooks.empty.fire = function() { + if ( !hooks.unqueued ) { + oldfire(); + } + }; + } + hooks.unqueued++; + + anim.always(function() { + // doing this makes sure that the complete handler will be called + // before this completes + anim.always(function() { + hooks.unqueued--; + if ( !jQuery.queue( elem, "fx" ).length ) { + hooks.empty.fire(); + } + }); + }); + } + + // height/width overflow pass + if ( elem.nodeType === 1 && ( "height" in props || "width" in props ) ) { + // Make sure that nothing sneaks out + // Record all 3 overflow attributes because IE does not + // change the overflow attribute when overflowX and + // overflowY are set to the same value + opts.overflow = [ style.overflow, style.overflowX, style.overflowY ]; + + // Set display property to inline-block for height/width + // animations on inline elements that are having width/height animated + display = jQuery.css( elem, "display" ); + + // Test default display if display is currently "none" + checkDisplay = display === "none" ? + jQuery._data( elem, "olddisplay" ) || defaultDisplay( elem.nodeName ) : display; + + if ( checkDisplay === "inline" && jQuery.css( elem, "float" ) === "none" ) { + + // inline-level elements accept inline-block; + // block-level elements need to be inline with layout + if ( !support.inlineBlockNeedsLayout || defaultDisplay( elem.nodeName ) === "inline" ) { + style.display = "inline-block"; + } else { + style.zoom = 1; + } + } + } + + if ( opts.overflow ) { + style.overflow = "hidden"; + if ( !support.shrinkWrapBlocks() ) { + anim.always(function() { + style.overflow = opts.overflow[ 0 ]; + style.overflowX = opts.overflow[ 1 ]; + style.overflowY = opts.overflow[ 2 ]; + }); + } + } + + // show/hide pass + for ( prop in props ) { + value = props[ prop ]; + if ( rfxtypes.exec( value ) ) { + delete props[ prop ]; + toggle = toggle || value === "toggle"; + if ( value === ( hidden ? "hide" : "show" ) ) { + + // If there is dataShow left over from a stopped hide or show and we are going to proceed with show, we should pretend to be hidden + if ( value === "show" && dataShow && dataShow[ prop ] !== undefined ) { + hidden = true; + } else { + continue; + } + } + orig[ prop ] = dataShow && dataShow[ prop ] || jQuery.style( elem, prop ); + + // Any non-fx value stops us from restoring the original display value + } else { + display = undefined; + } + } + + if ( !jQuery.isEmptyObject( orig ) ) { + if ( dataShow ) { + if ( "hidden" in dataShow ) { + hidden = dataShow.hidden; + } + } else { + dataShow = jQuery._data( elem, "fxshow", {} ); + } + + // store state if its toggle - enables .stop().toggle() to "reverse" + if ( toggle ) { + dataShow.hidden = !hidden; + } + if ( hidden ) { + jQuery( elem ).show(); + } else { + anim.done(function() { + jQuery( elem ).hide(); + }); + } + anim.done(function() { + var prop; + jQuery._removeData( elem, "fxshow" ); + for ( prop in orig ) { + jQuery.style( elem, prop, orig[ prop ] ); + } + }); + for ( prop in orig ) { + tween = createTween( hidden ? dataShow[ prop ] : 0, prop, anim ); + + if ( !( prop in dataShow ) ) { + dataShow[ prop ] = tween.start; + if ( hidden ) { + tween.end = tween.start; + tween.start = prop === "width" || prop === "height" ? 1 : 0; + } + } + } + + // If this is a noop like .hide().hide(), restore an overwritten display value + } else if ( (display === "none" ? defaultDisplay( elem.nodeName ) : display) === "inline" ) { + style.display = display; + } +} + +function propFilter( props, specialEasing ) { + var index, name, easing, value, hooks; + + // camelCase, specialEasing and expand cssHook pass + for ( index in props ) { + name = jQuery.camelCase( index ); + easing = specialEasing[ name ]; + value = props[ index ]; + if ( jQuery.isArray( value ) ) { + easing = value[ 1 ]; + value = props[ index ] = value[ 0 ]; + } + + if ( index !== name ) { + props[ name ] = value; + delete props[ index ]; + } + + hooks = jQuery.cssHooks[ name ]; + if ( hooks && "expand" in hooks ) { + value = hooks.expand( value ); + delete props[ name ]; + + // not quite $.extend, this wont overwrite keys already present. + // also - reusing 'index' from above because we have the correct "name" + for ( index in value ) { + if ( !( index in props ) ) { + props[ index ] = value[ index ]; + specialEasing[ index ] = easing; + } + } + } else { + specialEasing[ name ] = easing; + } + } +} + +function Animation( elem, properties, options ) { + var result, + stopped, + index = 0, + length = animationPrefilters.length, + deferred = jQuery.Deferred().always( function() { + // don't match elem in the :animated selector + delete tick.elem; + }), + tick = function() { + if ( stopped ) { + return false; + } + var currentTime = fxNow || createFxNow(), + remaining = Math.max( 0, animation.startTime + animation.duration - currentTime ), + // archaic crash bug won't allow us to use 1 - ( 0.5 || 0 ) (#12497) + temp = remaining / animation.duration || 0, + percent = 1 - temp, + index = 0, + length = animation.tweens.length; + + for ( ; index < length ; index++ ) { + animation.tweens[ index ].run( percent ); + } + + deferred.notifyWith( elem, [ animation, percent, remaining ]); + + if ( percent < 1 && length ) { + return remaining; + } else { + deferred.resolveWith( elem, [ animation ] ); + return false; + } + }, + animation = deferred.promise({ + elem: elem, + props: jQuery.extend( {}, properties ), + opts: jQuery.extend( true, { specialEasing: {} }, options ), + originalProperties: properties, + originalOptions: options, + startTime: fxNow || createFxNow(), + duration: options.duration, + tweens: [], + createTween: function( prop, end ) { + var tween = jQuery.Tween( elem, animation.opts, prop, end, + animation.opts.specialEasing[ prop ] || animation.opts.easing ); + animation.tweens.push( tween ); + return tween; + }, + stop: function( gotoEnd ) { + var index = 0, + // if we are going to the end, we want to run all the tweens + // otherwise we skip this part + length = gotoEnd ? animation.tweens.length : 0; + if ( stopped ) { + return this; + } + stopped = true; + for ( ; index < length ; index++ ) { + animation.tweens[ index ].run( 1 ); + } + + // resolve when we played the last frame + // otherwise, reject + if ( gotoEnd ) { + deferred.resolveWith( elem, [ animation, gotoEnd ] ); + } else { + deferred.rejectWith( elem, [ animation, gotoEnd ] ); + } + return this; + } + }), + props = animation.props; + + propFilter( props, animation.opts.specialEasing ); + + for ( ; index < length ; index++ ) { + result = animationPrefilters[ index ].call( animation, elem, props, animation.opts ); + if ( result ) { + return result; + } + } + + jQuery.map( props, createTween, animation ); + + if ( jQuery.isFunction( animation.opts.start ) ) { + animation.opts.start.call( elem, animation ); + } + + jQuery.fx.timer( + jQuery.extend( tick, { + elem: elem, + anim: animation, + queue: animation.opts.queue + }) + ); + + // attach callbacks from options + return animation.progress( animation.opts.progress ) + .done( animation.opts.done, animation.opts.complete ) + .fail( animation.opts.fail ) + .always( animation.opts.always ); +} + +jQuery.Animation = jQuery.extend( Animation, { + tweener: function( props, callback ) { + if ( jQuery.isFunction( props ) ) { + callback = props; + props = [ "*" ]; + } else { + props = props.split(" "); + } + + var prop, + index = 0, + length = props.length; + + for ( ; index < length ; index++ ) { + prop = props[ index ]; + tweeners[ prop ] = tweeners[ prop ] || []; + tweeners[ prop ].unshift( callback ); + } + }, + + prefilter: function( callback, prepend ) { + if ( prepend ) { + animationPrefilters.unshift( callback ); + } else { + animationPrefilters.push( callback ); + } + } +}); + +jQuery.speed = function( speed, easing, fn ) { + var opt = speed && typeof speed === "object" ? jQuery.extend( {}, speed ) : { + complete: fn || !fn && easing || + jQuery.isFunction( speed ) && speed, + duration: speed, + easing: fn && easing || easing && !jQuery.isFunction( easing ) && easing + }; + + opt.duration = jQuery.fx.off ? 0 : typeof opt.duration === "number" ? opt.duration : + opt.duration in jQuery.fx.speeds ? jQuery.fx.speeds[ opt.duration ] : jQuery.fx.speeds._default; + + // normalize opt.queue - true/undefined/null -> "fx" + if ( opt.queue == null || opt.queue === true ) { + opt.queue = "fx"; + } + + // Queueing + opt.old = opt.complete; + + opt.complete = function() { + if ( jQuery.isFunction( opt.old ) ) { + opt.old.call( this ); + } + + if ( opt.queue ) { + jQuery.dequeue( this, opt.queue ); + } + }; + + return opt; +}; + +jQuery.fn.extend({ + fadeTo: function( speed, to, easing, callback ) { + + // show any hidden elements after setting opacity to 0 + return this.filter( isHidden ).css( "opacity", 0 ).show() + + // animate to the value specified + .end().animate({ opacity: to }, speed, easing, callback ); + }, + animate: function( prop, speed, easing, callback ) { + var empty = jQuery.isEmptyObject( prop ), + optall = jQuery.speed( speed, easing, callback ), + doAnimation = function() { + // Operate on a copy of prop so per-property easing won't be lost + var anim = Animation( this, jQuery.extend( {}, prop ), optall ); + + // Empty animations, or finishing resolves immediately + if ( empty || jQuery._data( this, "finish" ) ) { + anim.stop( true ); + } + }; + doAnimation.finish = doAnimation; + + return empty || optall.queue === false ? + this.each( doAnimation ) : + this.queue( optall.queue, doAnimation ); + }, + stop: function( type, clearQueue, gotoEnd ) { + var stopQueue = function( hooks ) { + var stop = hooks.stop; + delete hooks.stop; + stop( gotoEnd ); + }; + + if ( typeof type !== "string" ) { + gotoEnd = clearQueue; + clearQueue = type; + type = undefined; + } + if ( clearQueue && type !== false ) { + this.queue( type || "fx", [] ); + } + + return this.each(function() { + var dequeue = true, + index = type != null && type + "queueHooks", + timers = jQuery.timers, + data = jQuery._data( this ); + + if ( index ) { + if ( data[ index ] && data[ index ].stop ) { + stopQueue( data[ index ] ); + } + } else { + for ( index in data ) { + if ( data[ index ] && data[ index ].stop && rrun.test( index ) ) { + stopQueue( data[ index ] ); + } + } + } + + for ( index = timers.length; index--; ) { + if ( timers[ index ].elem === this && (type == null || timers[ index ].queue === type) ) { + timers[ index ].anim.stop( gotoEnd ); + dequeue = false; + timers.splice( index, 1 ); + } + } + + // start the next in the queue if the last step wasn't forced + // timers currently will call their complete callbacks, which will dequeue + // but only if they were gotoEnd + if ( dequeue || !gotoEnd ) { + jQuery.dequeue( this, type ); + } + }); + }, + finish: function( type ) { + if ( type !== false ) { + type = type || "fx"; + } + return this.each(function() { + var index, + data = jQuery._data( this ), + queue = data[ type + "queue" ], + hooks = data[ type + "queueHooks" ], + timers = jQuery.timers, + length = queue ? queue.length : 0; + + // enable finishing flag on private data + data.finish = true; + + // empty the queue first + jQuery.queue( this, type, [] ); + + if ( hooks && hooks.stop ) { + hooks.stop.call( this, true ); + } + + // look for any active animations, and finish them + for ( index = timers.length; index--; ) { + if ( timers[ index ].elem === this && timers[ index ].queue === type ) { + timers[ index ].anim.stop( true ); + timers.splice( index, 1 ); + } + } + + // look for any animations in the old queue and finish them + for ( index = 0; index < length; index++ ) { + if ( queue[ index ] && queue[ index ].finish ) { + queue[ index ].finish.call( this ); + } + } + + // turn off finishing flag + delete data.finish; + }); + } +}); + +jQuery.each([ "toggle", "show", "hide" ], function( i, name ) { + var cssFn = jQuery.fn[ name ]; + jQuery.fn[ name ] = function( speed, easing, callback ) { + return speed == null || typeof speed === "boolean" ? + cssFn.apply( this, arguments ) : + this.animate( genFx( name, true ), speed, easing, callback ); + }; +}); + +// Generate shortcuts for custom animations +jQuery.each({ + slideDown: genFx("show"), + slideUp: genFx("hide"), + slideToggle: genFx("toggle"), + fadeIn: { opacity: "show" }, + fadeOut: { opacity: "hide" }, + fadeToggle: { opacity: "toggle" } +}, function( name, props ) { + jQuery.fn[ name ] = function( speed, easing, callback ) { + return this.animate( props, speed, easing, callback ); + }; +}); + +jQuery.timers = []; +jQuery.fx.tick = function() { + var timer, + timers = jQuery.timers, + i = 0; + + fxNow = jQuery.now(); + + for ( ; i < timers.length; i++ ) { + timer = timers[ i ]; + // Checks the timer has not already been removed + if ( !timer() && timers[ i ] === timer ) { + timers.splice( i--, 1 ); + } + } + + if ( !timers.length ) { + jQuery.fx.stop(); + } + fxNow = undefined; +}; + +jQuery.fx.timer = function( timer ) { + jQuery.timers.push( timer ); + if ( timer() ) { + jQuery.fx.start(); + } else { + jQuery.timers.pop(); + } +}; + +jQuery.fx.interval = 13; + +jQuery.fx.start = function() { + if ( !timerId ) { + timerId = setInterval( jQuery.fx.tick, jQuery.fx.interval ); + } +}; + +jQuery.fx.stop = function() { + clearInterval( timerId ); + timerId = null; +}; + +jQuery.fx.speeds = { + slow: 600, + fast: 200, + // Default speed + _default: 400 +}; + + +// Based off of the plugin by Clint Helfers, with permission. +// http://blindsignals.com/index.php/2009/07/jquery-delay/ +jQuery.fn.delay = function( time, type ) { + time = jQuery.fx ? jQuery.fx.speeds[ time ] || time : time; + type = type || "fx"; + + return this.queue( type, function( next, hooks ) { + var timeout = setTimeout( next, time ); + hooks.stop = function() { + clearTimeout( timeout ); + }; + }); +}; + + +(function() { + // Minified: var a,b,c,d,e + var input, div, select, a, opt; + + // Setup + div = document.createElement( "div" ); + div.setAttribute( "className", "t" ); + div.innerHTML = " <link/><table></table><a href='/a'>a</a><input type='checkbox'/>"; + a = div.getElementsByTagName("a")[ 0 ]; + + // First batch of tests. + select = document.createElement("select"); + opt = select.appendChild( document.createElement("option") ); + input = div.getElementsByTagName("input")[ 0 ]; + + a.style.cssText = "top:1px"; + + // Test setAttribute on camelCase class. If it works, we need attrFixes when doing get/setAttribute (ie6/7) + support.getSetAttribute = div.className !== "t"; + + // Get the style information from getAttribute + // (IE uses .cssText instead) + support.style = /top/.test( a.getAttribute("style") ); + + // Make sure that URLs aren't manipulated + // (IE normalizes it by default) + support.hrefNormalized = a.getAttribute("href") === "/a"; + + // Check the default checkbox/radio value ("" on WebKit; "on" elsewhere) + support.checkOn = !!input.value; + + // Make sure that a selected-by-default option has a working selected property. + // (WebKit defaults to false instead of true, IE too, if it's in an optgroup) + support.optSelected = opt.selected; + + // Tests for enctype support on a form (#6743) + support.enctype = !!document.createElement("form").enctype; + + // Make sure that the options inside disabled selects aren't marked as disabled + // (WebKit marks them as disabled) + select.disabled = true; + support.optDisabled = !opt.disabled; + + // Support: IE8 only + // Check if we can trust getAttribute("value") + input = document.createElement( "input" ); + input.setAttribute( "value", "" ); + support.input = input.getAttribute( "value" ) === ""; + + // Check if an input maintains its value after becoming a radio + input.value = "t"; + input.setAttribute( "type", "radio" ); + support.radioValue = input.value === "t"; +})(); + + +var rreturn = /\r/g; + +jQuery.fn.extend({ + val: function( value ) { + var hooks, ret, isFunction, + elem = this[0]; + + if ( !arguments.length ) { + if ( elem ) { + hooks = jQuery.valHooks[ elem.type ] || jQuery.valHooks[ elem.nodeName.toLowerCase() ]; + + if ( hooks && "get" in hooks && (ret = hooks.get( elem, "value" )) !== undefined ) { + return ret; + } + + ret = elem.value; + + return typeof ret === "string" ? + // handle most common string cases + ret.replace(rreturn, "") : + // handle cases where value is null/undef or number + ret == null ? "" : ret; + } + + return; + } + + isFunction = jQuery.isFunction( value ); + + return this.each(function( i ) { + var val; + + if ( this.nodeType !== 1 ) { + return; + } + + if ( isFunction ) { + val = value.call( this, i, jQuery( this ).val() ); + } else { + val = value; + } + + // Treat null/undefined as ""; convert numbers to string + if ( val == null ) { + val = ""; + } else if ( typeof val === "number" ) { + val += ""; + } else if ( jQuery.isArray( val ) ) { + val = jQuery.map( val, function( value ) { + return value == null ? "" : value + ""; + }); + } + + hooks = jQuery.valHooks[ this.type ] || jQuery.valHooks[ this.nodeName.toLowerCase() ]; + + // If set returns undefined, fall back to normal setting + if ( !hooks || !("set" in hooks) || hooks.set( this, val, "value" ) === undefined ) { + this.value = val; + } + }); + } +}); + +jQuery.extend({ + valHooks: { + option: { + get: function( elem ) { + var val = jQuery.find.attr( elem, "value" ); + return val != null ? + val : + // Support: IE10-11+ + // option.text throws exceptions (#14686, #14858) + jQuery.trim( jQuery.text( elem ) ); + } + }, + select: { + get: function( elem ) { + var value, option, + options = elem.options, + index = elem.selectedIndex, + one = elem.type === "select-one" || index < 0, + values = one ? null : [], + max = one ? index + 1 : options.length, + i = index < 0 ? + max : + one ? index : 0; + + // Loop through all the selected options + for ( ; i < max; i++ ) { + option = options[ i ]; + + // oldIE doesn't update selected after form reset (#2551) + if ( ( option.selected || i === index ) && + // Don't return options that are disabled or in a disabled optgroup + ( support.optDisabled ? !option.disabled : option.getAttribute("disabled") === null ) && + ( !option.parentNode.disabled || !jQuery.nodeName( option.parentNode, "optgroup" ) ) ) { + + // Get the specific value for the option + value = jQuery( option ).val(); + + // We don't need an array for one selects + if ( one ) { + return value; + } + + // Multi-Selects return an array + values.push( value ); + } + } + + return values; + }, + + set: function( elem, value ) { + var optionSet, option, + options = elem.options, + values = jQuery.makeArray( value ), + i = options.length; + + while ( i-- ) { + option = options[ i ]; + + if ( jQuery.inArray( jQuery.valHooks.option.get( option ), values ) >= 0 ) { + + // Support: IE6 + // When new option element is added to select box we need to + // force reflow of newly added node in order to workaround delay + // of initialization properties + try { + option.selected = optionSet = true; + + } catch ( _ ) { + + // Will be executed only in IE6 + option.scrollHeight; + } + + } else { + option.selected = false; + } + } + + // Force browsers to behave consistently when non-matching value is set + if ( !optionSet ) { + elem.selectedIndex = -1; + } + + return options; + } + } + } +}); + +// Radios and checkboxes getter/setter +jQuery.each([ "radio", "checkbox" ], function() { + jQuery.valHooks[ this ] = { + set: function( elem, value ) { + if ( jQuery.isArray( value ) ) { + return ( elem.checked = jQuery.inArray( jQuery(elem).val(), value ) >= 0 ); + } + } + }; + if ( !support.checkOn ) { + jQuery.valHooks[ this ].get = function( elem ) { + // Support: Webkit + // "" is returned instead of "on" if a value isn't specified + return elem.getAttribute("value") === null ? "on" : elem.value; + }; + } +}); + + + + +var nodeHook, boolHook, + attrHandle = jQuery.expr.attrHandle, + ruseDefault = /^(?:checked|selected)$/i, + getSetAttribute = support.getSetAttribute, + getSetInput = support.input; + +jQuery.fn.extend({ + attr: function( name, value ) { + return access( this, jQuery.attr, name, value, arguments.length > 1 ); + }, + + removeAttr: function( name ) { + return this.each(function() { + jQuery.removeAttr( this, name ); + }); + } +}); + +jQuery.extend({ + attr: function( elem, name, value ) { + var hooks, ret, + nType = elem.nodeType; + + // don't get/set attributes on text, comment and attribute nodes + if ( !elem || nType === 3 || nType === 8 || nType === 2 ) { + return; + } + + // Fallback to prop when attributes are not supported + if ( typeof elem.getAttribute === strundefined ) { + return jQuery.prop( elem, name, value ); + } + + // All attributes are lowercase + // Grab necessary hook if one is defined + if ( nType !== 1 || !jQuery.isXMLDoc( elem ) ) { + name = name.toLowerCase(); + hooks = jQuery.attrHooks[ name ] || + ( jQuery.expr.match.bool.test( name ) ? boolHook : nodeHook ); + } + + if ( value !== undefined ) { + + if ( value === null ) { + jQuery.removeAttr( elem, name ); + + } else if ( hooks && "set" in hooks && (ret = hooks.set( elem, value, name )) !== undefined ) { + return ret; + + } else { + elem.setAttribute( name, value + "" ); + return value; + } + + } else if ( hooks && "get" in hooks && (ret = hooks.get( elem, name )) !== null ) { + return ret; + + } else { + ret = jQuery.find.attr( elem, name ); + + // Non-existent attributes return null, we normalize to undefined + return ret == null ? + undefined : + ret; + } + }, + + removeAttr: function( elem, value ) { + var name, propName, + i = 0, + attrNames = value && value.match( rnotwhite ); + + if ( attrNames && elem.nodeType === 1 ) { + while ( (name = attrNames[i++]) ) { + propName = jQuery.propFix[ name ] || name; + + // Boolean attributes get special treatment (#10870) + if ( jQuery.expr.match.bool.test( name ) ) { + // Set corresponding property to false + if ( getSetInput && getSetAttribute || !ruseDefault.test( name ) ) { + elem[ propName ] = false; + // Support: IE<9 + // Also clear defaultChecked/defaultSelected (if appropriate) + } else { + elem[ jQuery.camelCase( "default-" + name ) ] = + elem[ propName ] = false; + } + + // See #9699 for explanation of this approach (setting first, then removal) + } else { + jQuery.attr( elem, name, "" ); + } + + elem.removeAttribute( getSetAttribute ? name : propName ); + } + } + }, + + attrHooks: { + type: { + set: function( elem, value ) { + if ( !support.radioValue && value === "radio" && jQuery.nodeName(elem, "input") ) { + // Setting the type on a radio button after the value resets the value in IE6-9 + // Reset value to default in case type is set after value during creation + var val = elem.value; + elem.setAttribute( "type", value ); + if ( val ) { + elem.value = val; + } + return value; + } + } + } + } +}); + +// Hook for boolean attributes +boolHook = { + set: function( elem, value, name ) { + if ( value === false ) { + // Remove boolean attributes when set to false + jQuery.removeAttr( elem, name ); + } else if ( getSetInput && getSetAttribute || !ruseDefault.test( name ) ) { + // IE<8 needs the *property* name + elem.setAttribute( !getSetAttribute && jQuery.propFix[ name ] || name, name ); + + // Use defaultChecked and defaultSelected for oldIE + } else { + elem[ jQuery.camelCase( "default-" + name ) ] = elem[ name ] = true; + } + + return name; + } +}; + +// Retrieve booleans specially +jQuery.each( jQuery.expr.match.bool.source.match( /\w+/g ), function( i, name ) { + + var getter = attrHandle[ name ] || jQuery.find.attr; + + attrHandle[ name ] = getSetInput && getSetAttribute || !ruseDefault.test( name ) ? + function( elem, name, isXML ) { + var ret, handle; + if ( !isXML ) { + // Avoid an infinite loop by temporarily removing this function from the getter + handle = attrHandle[ name ]; + attrHandle[ name ] = ret; + ret = getter( elem, name, isXML ) != null ? + name.toLowerCase() : + null; + attrHandle[ name ] = handle; + } + return ret; + } : + function( elem, name, isXML ) { + if ( !isXML ) { + return elem[ jQuery.camelCase( "default-" + name ) ] ? + name.toLowerCase() : + null; + } + }; +}); + +// fix oldIE attroperties +if ( !getSetInput || !getSetAttribute ) { + jQuery.attrHooks.value = { + set: function( elem, value, name ) { + if ( jQuery.nodeName( elem, "input" ) ) { + // Does not return so that setAttribute is also used + elem.defaultValue = value; + } else { + // Use nodeHook if defined (#1954); otherwise setAttribute is fine + return nodeHook && nodeHook.set( elem, value, name ); + } + } + }; +} + +// IE6/7 do not support getting/setting some attributes with get/setAttribute +if ( !getSetAttribute ) { + + // Use this for any attribute in IE6/7 + // This fixes almost every IE6/7 issue + nodeHook = { + set: function( elem, value, name ) { + // Set the existing or create a new attribute node + var ret = elem.getAttributeNode( name ); + if ( !ret ) { + elem.setAttributeNode( + (ret = elem.ownerDocument.createAttribute( name )) + ); + } + + ret.value = value += ""; + + // Break association with cloned elements by also using setAttribute (#9646) + if ( name === "value" || value === elem.getAttribute( name ) ) { + return value; + } + } + }; + + // Some attributes are constructed with empty-string values when not defined + attrHandle.id = attrHandle.name = attrHandle.coords = + function( elem, name, isXML ) { + var ret; + if ( !isXML ) { + return (ret = elem.getAttributeNode( name )) && ret.value !== "" ? + ret.value : + null; + } + }; + + // Fixing value retrieval on a button requires this module + jQuery.valHooks.button = { + get: function( elem, name ) { + var ret = elem.getAttributeNode( name ); + if ( ret && ret.specified ) { + return ret.value; + } + }, + set: nodeHook.set + }; + + // Set contenteditable to false on removals(#10429) + // Setting to empty string throws an error as an invalid value + jQuery.attrHooks.contenteditable = { + set: function( elem, value, name ) { + nodeHook.set( elem, value === "" ? false : value, name ); + } + }; + + // Set width and height to auto instead of 0 on empty string( Bug #8150 ) + // This is for removals + jQuery.each([ "width", "height" ], function( i, name ) { + jQuery.attrHooks[ name ] = { + set: function( elem, value ) { + if ( value === "" ) { + elem.setAttribute( name, "auto" ); + return value; + } + } + }; + }); +} + +if ( !support.style ) { + jQuery.attrHooks.style = { + get: function( elem ) { + // Return undefined in the case of empty string + // Note: IE uppercases css property names, but if we were to .toLowerCase() + // .cssText, that would destroy case senstitivity in URL's, like in "background" + return elem.style.cssText || undefined; + }, + set: function( elem, value ) { + return ( elem.style.cssText = value + "" ); + } + }; +} + + + + +var rfocusable = /^(?:input|select|textarea|button|object)$/i, + rclickable = /^(?:a|area)$/i; + +jQuery.fn.extend({ + prop: function( name, value ) { + return access( this, jQuery.prop, name, value, arguments.length > 1 ); + }, + + removeProp: function( name ) { + name = jQuery.propFix[ name ] || name; + return this.each(function() { + // try/catch handles cases where IE balks (such as removing a property on window) + try { + this[ name ] = undefined; + delete this[ name ]; + } catch( e ) {} + }); + } +}); + +jQuery.extend({ + propFix: { + "for": "htmlFor", + "class": "className" + }, + + prop: function( elem, name, value ) { + var ret, hooks, notxml, + nType = elem.nodeType; + + // don't get/set properties on text, comment and attribute nodes + if ( !elem || nType === 3 || nType === 8 || nType === 2 ) { + return; + } + + notxml = nType !== 1 || !jQuery.isXMLDoc( elem ); + + if ( notxml ) { + // Fix name and attach hooks + name = jQuery.propFix[ name ] || name; + hooks = jQuery.propHooks[ name ]; + } + + if ( value !== undefined ) { + return hooks && "set" in hooks && (ret = hooks.set( elem, value, name )) !== undefined ? + ret : + ( elem[ name ] = value ); + + } else { + return hooks && "get" in hooks && (ret = hooks.get( elem, name )) !== null ? + ret : + elem[ name ]; + } + }, + + propHooks: { + tabIndex: { + get: function( elem ) { + // elem.tabIndex doesn't always return the correct value when it hasn't been explicitly set + // http://fluidproject.org/blog/2008/01/09/getting-setting-and-removing-tabindex-values-with-javascript/ + // Use proper attribute retrieval(#12072) + var tabindex = jQuery.find.attr( elem, "tabindex" ); + + return tabindex ? + parseInt( tabindex, 10 ) : + rfocusable.test( elem.nodeName ) || rclickable.test( elem.nodeName ) && elem.href ? + 0 : + -1; + } + } + } +}); + +// Some attributes require a special call on IE +// http://msdn.microsoft.com/en-us/library/ms536429%28VS.85%29.aspx +if ( !support.hrefNormalized ) { + // href/src property should get the full normalized URL (#10299/#12915) + jQuery.each([ "href", "src" ], function( i, name ) { + jQuery.propHooks[ name ] = { + get: function( elem ) { + return elem.getAttribute( name, 4 ); + } + }; + }); +} + +// Support: Safari, IE9+ +// mis-reports the default selected property of an option +// Accessing the parent's selectedIndex property fixes it +if ( !support.optSelected ) { + jQuery.propHooks.selected = { + get: function( elem ) { + var parent = elem.parentNode; + + if ( parent ) { + parent.selectedIndex; + + // Make sure that it also works with optgroups, see #5701 + if ( parent.parentNode ) { + parent.parentNode.selectedIndex; + } + } + return null; + } + }; +} + +jQuery.each([ + "tabIndex", + "readOnly", + "maxLength", + "cellSpacing", + "cellPadding", + "rowSpan", + "colSpan", + "useMap", + "frameBorder", + "contentEditable" +], function() { + jQuery.propFix[ this.toLowerCase() ] = this; +}); + +// IE6/7 call enctype encoding +if ( !support.enctype ) { + jQuery.propFix.enctype = "encoding"; +} + + + + +var rclass = /[\t\r\n\f]/g; + +jQuery.fn.extend({ + addClass: function( value ) { + var classes, elem, cur, clazz, j, finalValue, + i = 0, + len = this.length, + proceed = typeof value === "string" && value; + + if ( jQuery.isFunction( value ) ) { + return this.each(function( j ) { + jQuery( this ).addClass( value.call( this, j, this.className ) ); + }); + } + + if ( proceed ) { + // The disjunction here is for better compressibility (see removeClass) + classes = ( value || "" ).match( rnotwhite ) || []; + + for ( ; i < len; i++ ) { + elem = this[ i ]; + cur = elem.nodeType === 1 && ( elem.className ? + ( " " + elem.className + " " ).replace( rclass, " " ) : + " " + ); + + if ( cur ) { + j = 0; + while ( (clazz = classes[j++]) ) { + if ( cur.indexOf( " " + clazz + " " ) < 0 ) { + cur += clazz + " "; + } + } + + // only assign if different to avoid unneeded rendering. + finalValue = jQuery.trim( cur ); + if ( elem.className !== finalValue ) { + elem.className = finalValue; + } + } + } + } + + return this; + }, + + removeClass: function( value ) { + var classes, elem, cur, clazz, j, finalValue, + i = 0, + len = this.length, + proceed = arguments.length === 0 || typeof value === "string" && value; + + if ( jQuery.isFunction( value ) ) { + return this.each(function( j ) { + jQuery( this ).removeClass( value.call( this, j, this.className ) ); + }); + } + if ( proceed ) { + classes = ( value || "" ).match( rnotwhite ) || []; + + for ( ; i < len; i++ ) { + elem = this[ i ]; + // This expression is here for better compressibility (see addClass) + cur = elem.nodeType === 1 && ( elem.className ? + ( " " + elem.className + " " ).replace( rclass, " " ) : + "" + ); + + if ( cur ) { + j = 0; + while ( (clazz = classes[j++]) ) { + // Remove *all* instances + while ( cur.indexOf( " " + clazz + " " ) >= 0 ) { + cur = cur.replace( " " + clazz + " ", " " ); + } + } + + // only assign if different to avoid unneeded rendering. + finalValue = value ? jQuery.trim( cur ) : ""; + if ( elem.className !== finalValue ) { + elem.className = finalValue; + } + } + } + } + + return this; + }, + + toggleClass: function( value, stateVal ) { + var type = typeof value; + + if ( typeof stateVal === "boolean" && type === "string" ) { + return stateVal ? this.addClass( value ) : this.removeClass( value ); + } + + if ( jQuery.isFunction( value ) ) { + return this.each(function( i ) { + jQuery( this ).toggleClass( value.call(this, i, this.className, stateVal), stateVal ); + }); + } + + return this.each(function() { + if ( type === "string" ) { + // toggle individual class names + var className, + i = 0, + self = jQuery( this ), + classNames = value.match( rnotwhite ) || []; + + while ( (className = classNames[ i++ ]) ) { + // check each className given, space separated list + if ( self.hasClass( className ) ) { + self.removeClass( className ); + } else { + self.addClass( className ); + } + } + + // Toggle whole class name + } else if ( type === strundefined || type === "boolean" ) { + if ( this.className ) { + // store className if set + jQuery._data( this, "__className__", this.className ); + } + + // If the element has a class name or if we're passed "false", + // then remove the whole classname (if there was one, the above saved it). + // Otherwise bring back whatever was previously saved (if anything), + // falling back to the empty string if nothing was stored. + this.className = this.className || value === false ? "" : jQuery._data( this, "__className__" ) || ""; + } + }); + }, + + hasClass: function( selector ) { + var className = " " + selector + " ", + i = 0, + l = this.length; + for ( ; i < l; i++ ) { + if ( this[i].nodeType === 1 && (" " + this[i].className + " ").replace(rclass, " ").indexOf( className ) >= 0 ) { + return true; + } + } + + return false; + } +}); + + + + +// Return jQuery for attributes-only inclusion + + +jQuery.each( ("blur focus focusin focusout load resize scroll unload click dblclick " + + "mousedown mouseup mousemove mouseover mouseout mouseenter mouseleave " + + "change select submit keydown keypress keyup error contextmenu").split(" "), function( i, name ) { + + // Handle event binding + jQuery.fn[ name ] = function( data, fn ) { + return arguments.length > 0 ? + this.on( name, null, data, fn ) : + this.trigger( name ); + }; +}); + +jQuery.fn.extend({ + hover: function( fnOver, fnOut ) { + return this.mouseenter( fnOver ).mouseleave( fnOut || fnOver ); + }, + + bind: function( types, data, fn ) { + return this.on( types, null, data, fn ); + }, + unbind: function( types, fn ) { + return this.off( types, null, fn ); + }, + + delegate: function( selector, types, data, fn ) { + return this.on( types, selector, data, fn ); + }, + undelegate: function( selector, types, fn ) { + // ( namespace ) or ( selector, types [, fn] ) + return arguments.length === 1 ? this.off( selector, "**" ) : this.off( types, selector || "**", fn ); + } +}); + + +var nonce = jQuery.now(); + +var rquery = (/\?/); + + + +var rvalidtokens = /(,)|(\[|{)|(}|])|"(?:[^"\\\r\n]|\\["\\\/bfnrt]|\\u[\da-fA-F]{4})*"\s*:?|true|false|null|-?(?!0\d)\d+(?:\.\d+|)(?:[eE][+-]?\d+|)/g; + +jQuery.parseJSON = function( data ) { + // Attempt to parse using the native JSON parser first + if ( window.JSON && window.JSON.parse ) { + // Support: Android 2.3 + // Workaround failure to string-cast null input + return window.JSON.parse( data + "" ); + } + + var requireNonComma, + depth = null, + str = jQuery.trim( data + "" ); + + // Guard against invalid (and possibly dangerous) input by ensuring that nothing remains + // after removing valid tokens + return str && !jQuery.trim( str.replace( rvalidtokens, function( token, comma, open, close ) { + + // Force termination if we see a misplaced comma + if ( requireNonComma && comma ) { + depth = 0; + } + + // Perform no more replacements after returning to outermost depth + if ( depth === 0 ) { + return token; + } + + // Commas must not follow "[", "{", or "," + requireNonComma = open || comma; + + // Determine new depth + // array/object open ("[" or "{"): depth += true - false (increment) + // array/object close ("]" or "}"): depth += false - true (decrement) + // other cases ("," or primitive): depth += true - true (numeric cast) + depth += !close - !open; + + // Remove this token + return ""; + }) ) ? + ( Function( "return " + str ) )() : + jQuery.error( "Invalid JSON: " + data ); +}; + + +// Cross-browser xml parsing +jQuery.parseXML = function( data ) { + var xml, tmp; + if ( !data || typeof data !== "string" ) { + return null; + } + try { + if ( window.DOMParser ) { // Standard + tmp = new DOMParser(); + xml = tmp.parseFromString( data, "text/xml" ); + } else { // IE + xml = new ActiveXObject( "Microsoft.XMLDOM" ); + xml.async = "false"; + xml.loadXML( data ); + } + } catch( e ) { + xml = undefined; + } + if ( !xml || !xml.documentElement || xml.getElementsByTagName( "parsererror" ).length ) { + jQuery.error( "Invalid XML: " + data ); + } + return xml; +}; + + +var + // Document location + ajaxLocParts, + ajaxLocation, + + rhash = /#.*$/, + rts = /([?&])_=[^&]*/, + rheaders = /^(.*?):[ \t]*([^\r\n]*)\r?$/mg, // IE leaves an \r character at EOL + // #7653, #8125, #8152: local protocol detection + rlocalProtocol = /^(?:about|app|app-storage|.+-extension|file|res|widget):$/, + rnoContent = /^(?:GET|HEAD)$/, + rprotocol = /^\/\//, + rurl = /^([\w.+-]+:)(?:\/\/(?:[^\/?#]*@|)([^\/?#:]*)(?::(\d+)|)|)/, + + /* Prefilters + * 1) They are useful to introduce custom dataTypes (see ajax/jsonp.js for an example) + * 2) These are called: + * - BEFORE asking for a transport + * - AFTER param serialization (s.data is a string if s.processData is true) + * 3) key is the dataType + * 4) the catchall symbol "*" can be used + * 5) execution will start with transport dataType and THEN continue down to "*" if needed + */ + prefilters = {}, + + /* Transports bindings + * 1) key is the dataType + * 2) the catchall symbol "*" can be used + * 3) selection will start with transport dataType and THEN go to "*" if needed + */ + transports = {}, + + // Avoid comment-prolog char sequence (#10098); must appease lint and evade compression + allTypes = "*/".concat("*"); + +// #8138, IE may throw an exception when accessing +// a field from window.location if document.domain has been set +try { + ajaxLocation = location.href; +} catch( e ) { + // Use the href attribute of an A element + // since IE will modify it given document.location + ajaxLocation = document.createElement( "a" ); + ajaxLocation.href = ""; + ajaxLocation = ajaxLocation.href; +} + +// Segment location into parts +ajaxLocParts = rurl.exec( ajaxLocation.toLowerCase() ) || []; + +// Base "constructor" for jQuery.ajaxPrefilter and jQuery.ajaxTransport +function addToPrefiltersOrTransports( structure ) { + + // dataTypeExpression is optional and defaults to "*" + return function( dataTypeExpression, func ) { + + if ( typeof dataTypeExpression !== "string" ) { + func = dataTypeExpression; + dataTypeExpression = "*"; + } + + var dataType, + i = 0, + dataTypes = dataTypeExpression.toLowerCase().match( rnotwhite ) || []; + + if ( jQuery.isFunction( func ) ) { + // For each dataType in the dataTypeExpression + while ( (dataType = dataTypes[i++]) ) { + // Prepend if requested + if ( dataType.charAt( 0 ) === "+" ) { + dataType = dataType.slice( 1 ) || "*"; + (structure[ dataType ] = structure[ dataType ] || []).unshift( func ); + + // Otherwise append + } else { + (structure[ dataType ] = structure[ dataType ] || []).push( func ); + } + } + } + }; +} + +// Base inspection function for prefilters and transports +function inspectPrefiltersOrTransports( structure, options, originalOptions, jqXHR ) { + + var inspected = {}, + seekingTransport = ( structure === transports ); + + function inspect( dataType ) { + var selected; + inspected[ dataType ] = true; + jQuery.each( structure[ dataType ] || [], function( _, prefilterOrFactory ) { + var dataTypeOrTransport = prefilterOrFactory( options, originalOptions, jqXHR ); + if ( typeof dataTypeOrTransport === "string" && !seekingTransport && !inspected[ dataTypeOrTransport ] ) { + options.dataTypes.unshift( dataTypeOrTransport ); + inspect( dataTypeOrTransport ); + return false; + } else if ( seekingTransport ) { + return !( selected = dataTypeOrTransport ); + } + }); + return selected; + } + + return inspect( options.dataTypes[ 0 ] ) || !inspected[ "*" ] && inspect( "*" ); +} + +// A special extend for ajax options +// that takes "flat" options (not to be deep extended) +// Fixes #9887 +function ajaxExtend( target, src ) { + var deep, key, + flatOptions = jQuery.ajaxSettings.flatOptions || {}; + + for ( key in src ) { + if ( src[ key ] !== undefined ) { + ( flatOptions[ key ] ? target : ( deep || (deep = {}) ) )[ key ] = src[ key ]; + } + } + if ( deep ) { + jQuery.extend( true, target, deep ); + } + + return target; +} + +/* Handles responses to an ajax request: + * - finds the right dataType (mediates between content-type and expected dataType) + * - returns the corresponding response + */ +function ajaxHandleResponses( s, jqXHR, responses ) { + var firstDataType, ct, finalDataType, type, + contents = s.contents, + dataTypes = s.dataTypes; + + // Remove auto dataType and get content-type in the process + while ( dataTypes[ 0 ] === "*" ) { + dataTypes.shift(); + if ( ct === undefined ) { + ct = s.mimeType || jqXHR.getResponseHeader("Content-Type"); + } + } + + // Check if we're dealing with a known content-type + if ( ct ) { + for ( type in contents ) { + if ( contents[ type ] && contents[ type ].test( ct ) ) { + dataTypes.unshift( type ); + break; + } + } + } + + // Check to see if we have a response for the expected dataType + if ( dataTypes[ 0 ] in responses ) { + finalDataType = dataTypes[ 0 ]; + } else { + // Try convertible dataTypes + for ( type in responses ) { + if ( !dataTypes[ 0 ] || s.converters[ type + " " + dataTypes[0] ] ) { + finalDataType = type; + break; + } + if ( !firstDataType ) { + firstDataType = type; + } + } + // Or just use first one + finalDataType = finalDataType || firstDataType; + } + + // If we found a dataType + // We add the dataType to the list if needed + // and return the corresponding response + if ( finalDataType ) { + if ( finalDataType !== dataTypes[ 0 ] ) { + dataTypes.unshift( finalDataType ); + } + return responses[ finalDataType ]; + } +} + +/* Chain conversions given the request and the original response + * Also sets the responseXXX fields on the jqXHR instance + */ +function ajaxConvert( s, response, jqXHR, isSuccess ) { + var conv2, current, conv, tmp, prev, + converters = {}, + // Work with a copy of dataTypes in case we need to modify it for conversion + dataTypes = s.dataTypes.slice(); + + // Create converters map with lowercased keys + if ( dataTypes[ 1 ] ) { + for ( conv in s.converters ) { + converters[ conv.toLowerCase() ] = s.converters[ conv ]; + } + } + + current = dataTypes.shift(); + + // Convert to each sequential dataType + while ( current ) { + + if ( s.responseFields[ current ] ) { + jqXHR[ s.responseFields[ current ] ] = response; + } + + // Apply the dataFilter if provided + if ( !prev && isSuccess && s.dataFilter ) { + response = s.dataFilter( response, s.dataType ); + } + + prev = current; + current = dataTypes.shift(); + + if ( current ) { + + // There's only work to do if current dataType is non-auto + if ( current === "*" ) { + + current = prev; + + // Convert response if prev dataType is non-auto and differs from current + } else if ( prev !== "*" && prev !== current ) { + + // Seek a direct converter + conv = converters[ prev + " " + current ] || converters[ "* " + current ]; + + // If none found, seek a pair + if ( !conv ) { + for ( conv2 in converters ) { + + // If conv2 outputs current + tmp = conv2.split( " " ); + if ( tmp[ 1 ] === current ) { + + // If prev can be converted to accepted input + conv = converters[ prev + " " + tmp[ 0 ] ] || + converters[ "* " + tmp[ 0 ] ]; + if ( conv ) { + // Condense equivalence converters + if ( conv === true ) { + conv = converters[ conv2 ]; + + // Otherwise, insert the intermediate dataType + } else if ( converters[ conv2 ] !== true ) { + current = tmp[ 0 ]; + dataTypes.unshift( tmp[ 1 ] ); + } + break; + } + } + } + } + + // Apply converter (if not an equivalence) + if ( conv !== true ) { + + // Unless errors are allowed to bubble, catch and return them + if ( conv && s[ "throws" ] ) { + response = conv( response ); + } else { + try { + response = conv( response ); + } catch ( e ) { + return { state: "parsererror", error: conv ? e : "No conversion from " + prev + " to " + current }; + } + } + } + } + } + } + + return { state: "success", data: response }; +} + +jQuery.extend({ + + // Counter for holding the number of active queries + active: 0, + + // Last-Modified header cache for next request + lastModified: {}, + etag: {}, + + ajaxSettings: { + url: ajaxLocation, + type: "GET", + isLocal: rlocalProtocol.test( ajaxLocParts[ 1 ] ), + global: true, + processData: true, + async: true, + contentType: "application/x-www-form-urlencoded; charset=UTF-8", + /* + timeout: 0, + data: null, + dataType: null, + username: null, + password: null, + cache: null, + throws: false, + traditional: false, + headers: {}, + */ + + accepts: { + "*": allTypes, + text: "text/plain", + html: "text/html", + xml: "application/xml, text/xml", + json: "application/json, text/javascript" + }, + + contents: { + xml: /xml/, + html: /html/, + json: /json/ + }, + + responseFields: { + xml: "responseXML", + text: "responseText", + json: "responseJSON" + }, + + // Data converters + // Keys separate source (or catchall "*") and destination types with a single space + converters: { + + // Convert anything to text + "* text": String, + + // Text to html (true = no transformation) + "text html": true, + + // Evaluate text as a json expression + "text json": jQuery.parseJSON, + + // Parse text as xml + "text xml": jQuery.parseXML + }, + + // For options that shouldn't be deep extended: + // you can add your own custom options here if + // and when you create one that shouldn't be + // deep extended (see ajaxExtend) + flatOptions: { + url: true, + context: true + } + }, + + // Creates a full fledged settings object into target + // with both ajaxSettings and settings fields. + // If target is omitted, writes into ajaxSettings. + ajaxSetup: function( target, settings ) { + return settings ? + + // Building a settings object + ajaxExtend( ajaxExtend( target, jQuery.ajaxSettings ), settings ) : + + // Extending ajaxSettings + ajaxExtend( jQuery.ajaxSettings, target ); + }, + + ajaxPrefilter: addToPrefiltersOrTransports( prefilters ), + ajaxTransport: addToPrefiltersOrTransports( transports ), + + // Main method + ajax: function( url, options ) { + + // If url is an object, simulate pre-1.5 signature + if ( typeof url === "object" ) { + options = url; + url = undefined; + } + + // Force options to be an object + options = options || {}; + + var // Cross-domain detection vars + parts, + // Loop variable + i, + // URL without anti-cache param + cacheURL, + // Response headers as string + responseHeadersString, + // timeout handle + timeoutTimer, + + // To know if global events are to be dispatched + fireGlobals, + + transport, + // Response headers + responseHeaders, + // Create the final options object + s = jQuery.ajaxSetup( {}, options ), + // Callbacks context + callbackContext = s.context || s, + // Context for global events is callbackContext if it is a DOM node or jQuery collection + globalEventContext = s.context && ( callbackContext.nodeType || callbackContext.jquery ) ? + jQuery( callbackContext ) : + jQuery.event, + // Deferreds + deferred = jQuery.Deferred(), + completeDeferred = jQuery.Callbacks("once memory"), + // Status-dependent callbacks + statusCode = s.statusCode || {}, + // Headers (they are sent all at once) + requestHeaders = {}, + requestHeadersNames = {}, + // The jqXHR state + state = 0, + // Default abort message + strAbort = "canceled", + // Fake xhr + jqXHR = { + readyState: 0, + + // Builds headers hashtable if needed + getResponseHeader: function( key ) { + var match; + if ( state === 2 ) { + if ( !responseHeaders ) { + responseHeaders = {}; + while ( (match = rheaders.exec( responseHeadersString )) ) { + responseHeaders[ match[1].toLowerCase() ] = match[ 2 ]; + } + } + match = responseHeaders[ key.toLowerCase() ]; + } + return match == null ? null : match; + }, + + // Raw string + getAllResponseHeaders: function() { + return state === 2 ? responseHeadersString : null; + }, + + // Caches the header + setRequestHeader: function( name, value ) { + var lname = name.toLowerCase(); + if ( !state ) { + name = requestHeadersNames[ lname ] = requestHeadersNames[ lname ] || name; + requestHeaders[ name ] = value; + } + return this; + }, + + // Overrides response content-type header + overrideMimeType: function( type ) { + if ( !state ) { + s.mimeType = type; + } + return this; + }, + + // Status-dependent callbacks + statusCode: function( map ) { + var code; + if ( map ) { + if ( state < 2 ) { + for ( code in map ) { + // Lazy-add the new callback in a way that preserves old ones + statusCode[ code ] = [ statusCode[ code ], map[ code ] ]; + } + } else { + // Execute the appropriate callbacks + jqXHR.always( map[ jqXHR.status ] ); + } + } + return this; + }, + + // Cancel the request + abort: function( statusText ) { + var finalText = statusText || strAbort; + if ( transport ) { + transport.abort( finalText ); + } + done( 0, finalText ); + return this; + } + }; + + // Attach deferreds + deferred.promise( jqXHR ).complete = completeDeferred.add; + jqXHR.success = jqXHR.done; + jqXHR.error = jqXHR.fail; + + // Remove hash character (#7531: and string promotion) + // Add protocol if not provided (#5866: IE7 issue with protocol-less urls) + // Handle falsy url in the settings object (#10093: consistency with old signature) + // We also use the url parameter if available + s.url = ( ( url || s.url || ajaxLocation ) + "" ).replace( rhash, "" ).replace( rprotocol, ajaxLocParts[ 1 ] + "//" ); + + // Alias method option to type as per ticket #12004 + s.type = options.method || options.type || s.method || s.type; + + // Extract dataTypes list + s.dataTypes = jQuery.trim( s.dataType || "*" ).toLowerCase().match( rnotwhite ) || [ "" ]; + + // A cross-domain request is in order when we have a protocol:host:port mismatch + if ( s.crossDomain == null ) { + parts = rurl.exec( s.url.toLowerCase() ); + s.crossDomain = !!( parts && + ( parts[ 1 ] !== ajaxLocParts[ 1 ] || parts[ 2 ] !== ajaxLocParts[ 2 ] || + ( parts[ 3 ] || ( parts[ 1 ] === "http:" ? "80" : "443" ) ) !== + ( ajaxLocParts[ 3 ] || ( ajaxLocParts[ 1 ] === "http:" ? "80" : "443" ) ) ) + ); + } + + // Convert data if not already a string + if ( s.data && s.processData && typeof s.data !== "string" ) { + s.data = jQuery.param( s.data, s.traditional ); + } + + // Apply prefilters + inspectPrefiltersOrTransports( prefilters, s, options, jqXHR ); + + // If request was aborted inside a prefilter, stop there + if ( state === 2 ) { + return jqXHR; + } + + // We can fire global events as of now if asked to + fireGlobals = s.global; + + // Watch for a new set of requests + if ( fireGlobals && jQuery.active++ === 0 ) { + jQuery.event.trigger("ajaxStart"); + } + + // Uppercase the type + s.type = s.type.toUpperCase(); + + // Determine if request has content + s.hasContent = !rnoContent.test( s.type ); + + // Save the URL in case we're toying with the If-Modified-Since + // and/or If-None-Match header later on + cacheURL = s.url; + + // More options handling for requests with no content + if ( !s.hasContent ) { + + // If data is available, append data to url + if ( s.data ) { + cacheURL = ( s.url += ( rquery.test( cacheURL ) ? "&" : "?" ) + s.data ); + // #9682: remove data so that it's not used in an eventual retry + delete s.data; + } + + // Add anti-cache in url if needed + if ( s.cache === false ) { + s.url = rts.test( cacheURL ) ? + + // If there is already a '_' parameter, set its value + cacheURL.replace( rts, "$1_=" + nonce++ ) : + + // Otherwise add one to the end + cacheURL + ( rquery.test( cacheURL ) ? "&" : "?" ) + "_=" + nonce++; + } + } + + // Set the If-Modified-Since and/or If-None-Match header, if in ifModified mode. + if ( s.ifModified ) { + if ( jQuery.lastModified[ cacheURL ] ) { + jqXHR.setRequestHeader( "If-Modified-Since", jQuery.lastModified[ cacheURL ] ); + } + if ( jQuery.etag[ cacheURL ] ) { + jqXHR.setRequestHeader( "If-None-Match", jQuery.etag[ cacheURL ] ); + } + } + + // Set the correct header, if data is being sent + if ( s.data && s.hasContent && s.contentType !== false || options.contentType ) { + jqXHR.setRequestHeader( "Content-Type", s.contentType ); + } + + // Set the Accepts header for the server, depending on the dataType + jqXHR.setRequestHeader( + "Accept", + s.dataTypes[ 0 ] && s.accepts[ s.dataTypes[0] ] ? + s.accepts[ s.dataTypes[0] ] + ( s.dataTypes[ 0 ] !== "*" ? ", " + allTypes + "; q=0.01" : "" ) : + s.accepts[ "*" ] + ); + + // Check for headers option + for ( i in s.headers ) { + jqXHR.setRequestHeader( i, s.headers[ i ] ); + } + + // Allow custom headers/mimetypes and early abort + if ( s.beforeSend && ( s.beforeSend.call( callbackContext, jqXHR, s ) === false || state === 2 ) ) { + // Abort if not done already and return + return jqXHR.abort(); + } + + // aborting is no longer a cancellation + strAbort = "abort"; + + // Install callbacks on deferreds + for ( i in { success: 1, error: 1, complete: 1 } ) { + jqXHR[ i ]( s[ i ] ); + } + + // Get transport + transport = inspectPrefiltersOrTransports( transports, s, options, jqXHR ); + + // If no transport, we auto-abort + if ( !transport ) { + done( -1, "No Transport" ); + } else { + jqXHR.readyState = 1; + + // Send global event + if ( fireGlobals ) { + globalEventContext.trigger( "ajaxSend", [ jqXHR, s ] ); + } + // Timeout + if ( s.async && s.timeout > 0 ) { + timeoutTimer = setTimeout(function() { + jqXHR.abort("timeout"); + }, s.timeout ); + } + + try { + state = 1; + transport.send( requestHeaders, done ); + } catch ( e ) { + // Propagate exception as error if not done + if ( state < 2 ) { + done( -1, e ); + // Simply rethrow otherwise + } else { + throw e; + } + } + } + + // Callback for when everything is done + function done( status, nativeStatusText, responses, headers ) { + var isSuccess, success, error, response, modified, + statusText = nativeStatusText; + + // Called once + if ( state === 2 ) { + return; + } + + // State is "done" now + state = 2; + + // Clear timeout if it exists + if ( timeoutTimer ) { + clearTimeout( timeoutTimer ); + } + + // Dereference transport for early garbage collection + // (no matter how long the jqXHR object will be used) + transport = undefined; + + // Cache response headers + responseHeadersString = headers || ""; + + // Set readyState + jqXHR.readyState = status > 0 ? 4 : 0; + + // Determine if successful + isSuccess = status >= 200 && status < 300 || status === 304; + + // Get response data + if ( responses ) { + response = ajaxHandleResponses( s, jqXHR, responses ); + } + + // Convert no matter what (that way responseXXX fields are always set) + response = ajaxConvert( s, response, jqXHR, isSuccess ); + + // If successful, handle type chaining + if ( isSuccess ) { + + // Set the If-Modified-Since and/or If-None-Match header, if in ifModified mode. + if ( s.ifModified ) { + modified = jqXHR.getResponseHeader("Last-Modified"); + if ( modified ) { + jQuery.lastModified[ cacheURL ] = modified; + } + modified = jqXHR.getResponseHeader("etag"); + if ( modified ) { + jQuery.etag[ cacheURL ] = modified; + } + } + + // if no content + if ( status === 204 || s.type === "HEAD" ) { + statusText = "nocontent"; + + // if not modified + } else if ( status === 304 ) { + statusText = "notmodified"; + + // If we have data, let's convert it + } else { + statusText = response.state; + success = response.data; + error = response.error; + isSuccess = !error; + } + } else { + // We extract error from statusText + // then normalize statusText and status for non-aborts + error = statusText; + if ( status || !statusText ) { + statusText = "error"; + if ( status < 0 ) { + status = 0; + } + } + } + + // Set data for the fake xhr object + jqXHR.status = status; + jqXHR.statusText = ( nativeStatusText || statusText ) + ""; + + // Success/Error + if ( isSuccess ) { + deferred.resolveWith( callbackContext, [ success, statusText, jqXHR ] ); + } else { + deferred.rejectWith( callbackContext, [ jqXHR, statusText, error ] ); + } + + // Status-dependent callbacks + jqXHR.statusCode( statusCode ); + statusCode = undefined; + + if ( fireGlobals ) { + globalEventContext.trigger( isSuccess ? "ajaxSuccess" : "ajaxError", + [ jqXHR, s, isSuccess ? success : error ] ); + } + + // Complete + completeDeferred.fireWith( callbackContext, [ jqXHR, statusText ] ); + + if ( fireGlobals ) { + globalEventContext.trigger( "ajaxComplete", [ jqXHR, s ] ); + // Handle the global AJAX counter + if ( !( --jQuery.active ) ) { + jQuery.event.trigger("ajaxStop"); + } + } + } + + return jqXHR; + }, + + getJSON: function( url, data, callback ) { + return jQuery.get( url, data, callback, "json" ); + }, + + getScript: function( url, callback ) { + return jQuery.get( url, undefined, callback, "script" ); + } +}); + +jQuery.each( [ "get", "post" ], function( i, method ) { + jQuery[ method ] = function( url, data, callback, type ) { + // shift arguments if data argument was omitted + if ( jQuery.isFunction( data ) ) { + type = type || callback; + callback = data; + data = undefined; + } + + return jQuery.ajax({ + url: url, + type: method, + dataType: type, + data: data, + success: callback + }); + }; +}); + +// Attach a bunch of functions for handling common AJAX events +jQuery.each( [ "ajaxStart", "ajaxStop", "ajaxComplete", "ajaxError", "ajaxSuccess", "ajaxSend" ], function( i, type ) { + jQuery.fn[ type ] = function( fn ) { + return this.on( type, fn ); + }; +}); + + +jQuery._evalUrl = function( url ) { + return jQuery.ajax({ + url: url, + type: "GET", + dataType: "script", + async: false, + global: false, + "throws": true + }); +}; + + +jQuery.fn.extend({ + wrapAll: function( html ) { + if ( jQuery.isFunction( html ) ) { + return this.each(function(i) { + jQuery(this).wrapAll( html.call(this, i) ); + }); + } + + if ( this[0] ) { + // The elements to wrap the target around + var wrap = jQuery( html, this[0].ownerDocument ).eq(0).clone(true); + + if ( this[0].parentNode ) { + wrap.insertBefore( this[0] ); + } + + wrap.map(function() { + var elem = this; + + while ( elem.firstChild && elem.firstChild.nodeType === 1 ) { + elem = elem.firstChild; + } + + return elem; + }).append( this ); + } + + return this; + }, + + wrapInner: function( html ) { + if ( jQuery.isFunction( html ) ) { + return this.each(function(i) { + jQuery(this).wrapInner( html.call(this, i) ); + }); + } + + return this.each(function() { + var self = jQuery( this ), + contents = self.contents(); + + if ( contents.length ) { + contents.wrapAll( html ); + + } else { + self.append( html ); + } + }); + }, + + wrap: function( html ) { + var isFunction = jQuery.isFunction( html ); + + return this.each(function(i) { + jQuery( this ).wrapAll( isFunction ? html.call(this, i) : html ); + }); + }, + + unwrap: function() { + return this.parent().each(function() { + if ( !jQuery.nodeName( this, "body" ) ) { + jQuery( this ).replaceWith( this.childNodes ); + } + }).end(); + } +}); + + +jQuery.expr.filters.hidden = function( elem ) { + // Support: Opera <= 12.12 + // Opera reports offsetWidths and offsetHeights less than zero on some elements + return elem.offsetWidth <= 0 && elem.offsetHeight <= 0 || + (!support.reliableHiddenOffsets() && + ((elem.style && elem.style.display) || jQuery.css( elem, "display" )) === "none"); +}; + +jQuery.expr.filters.visible = function( elem ) { + return !jQuery.expr.filters.hidden( elem ); +}; + + + + +var r20 = /%20/g, + rbracket = /\[\]$/, + rCRLF = /\r?\n/g, + rsubmitterTypes = /^(?:submit|button|image|reset|file)$/i, + rsubmittable = /^(?:input|select|textarea|keygen)/i; + +function buildParams( prefix, obj, traditional, add ) { + var name; + + if ( jQuery.isArray( obj ) ) { + // Serialize array item. + jQuery.each( obj, function( i, v ) { + if ( traditional || rbracket.test( prefix ) ) { + // Treat each array item as a scalar. + add( prefix, v ); + + } else { + // Item is non-scalar (array or object), encode its numeric index. + buildParams( prefix + "[" + ( typeof v === "object" ? i : "" ) + "]", v, traditional, add ); + } + }); + + } else if ( !traditional && jQuery.type( obj ) === "object" ) { + // Serialize object item. + for ( name in obj ) { + buildParams( prefix + "[" + name + "]", obj[ name ], traditional, add ); + } + + } else { + // Serialize scalar item. + add( prefix, obj ); + } +} + +// Serialize an array of form elements or a set of +// key/values into a query string +jQuery.param = function( a, traditional ) { + var prefix, + s = [], + add = function( key, value ) { + // If value is a function, invoke it and return its value + value = jQuery.isFunction( value ) ? value() : ( value == null ? "" : value ); + s[ s.length ] = encodeURIComponent( key ) + "=" + encodeURIComponent( value ); + }; + + // Set traditional to true for jQuery <= 1.3.2 behavior. + if ( traditional === undefined ) { + traditional = jQuery.ajaxSettings && jQuery.ajaxSettings.traditional; + } + + // If an array was passed in, assume that it is an array of form elements. + if ( jQuery.isArray( a ) || ( a.jquery && !jQuery.isPlainObject( a ) ) ) { + // Serialize the form elements + jQuery.each( a, function() { + add( this.name, this.value ); + }); + + } else { + // If traditional, encode the "old" way (the way 1.3.2 or older + // did it), otherwise encode params recursively. + for ( prefix in a ) { + buildParams( prefix, a[ prefix ], traditional, add ); + } + } + + // Return the resulting serialization + return s.join( "&" ).replace( r20, "+" ); +}; + +jQuery.fn.extend({ + serialize: function() { + return jQuery.param( this.serializeArray() ); + }, + serializeArray: function() { + return this.map(function() { + // Can add propHook for "elements" to filter or add form elements + var elements = jQuery.prop( this, "elements" ); + return elements ? jQuery.makeArray( elements ) : this; + }) + .filter(function() { + var type = this.type; + // Use .is(":disabled") so that fieldset[disabled] works + return this.name && !jQuery( this ).is( ":disabled" ) && + rsubmittable.test( this.nodeName ) && !rsubmitterTypes.test( type ) && + ( this.checked || !rcheckableType.test( type ) ); + }) + .map(function( i, elem ) { + var val = jQuery( this ).val(); + + return val == null ? + null : + jQuery.isArray( val ) ? + jQuery.map( val, function( val ) { + return { name: elem.name, value: val.replace( rCRLF, "\r\n" ) }; + }) : + { name: elem.name, value: val.replace( rCRLF, "\r\n" ) }; + }).get(); + } +}); + + +// Create the request object +// (This is still attached to ajaxSettings for backward compatibility) +jQuery.ajaxSettings.xhr = window.ActiveXObject !== undefined ? + // Support: IE6+ + function() { + + // XHR cannot access local files, always use ActiveX for that case + return !this.isLocal && + + // Support: IE7-8 + // oldIE XHR does not support non-RFC2616 methods (#13240) + // See http://msdn.microsoft.com/en-us/library/ie/ms536648(v=vs.85).aspx + // and http://www.w3.org/Protocols/rfc2616/rfc2616-sec9.html#sec9 + // Although this check for six methods instead of eight + // since IE also does not support "trace" and "connect" + /^(get|post|head|put|delete|options)$/i.test( this.type ) && + + createStandardXHR() || createActiveXHR(); + } : + // For all other browsers, use the standard XMLHttpRequest object + createStandardXHR; + +var xhrId = 0, + xhrCallbacks = {}, + xhrSupported = jQuery.ajaxSettings.xhr(); + +// Support: IE<10 +// Open requests must be manually aborted on unload (#5280) +if ( window.ActiveXObject ) { + jQuery( window ).on( "unload", function() { + for ( var key in xhrCallbacks ) { + xhrCallbacks[ key ]( undefined, true ); + } + }); +} + +// Determine support properties +support.cors = !!xhrSupported && ( "withCredentials" in xhrSupported ); +xhrSupported = support.ajax = !!xhrSupported; + +// Create transport if the browser can provide an xhr +if ( xhrSupported ) { + + jQuery.ajaxTransport(function( options ) { + // Cross domain only allowed if supported through XMLHttpRequest + if ( !options.crossDomain || support.cors ) { + + var callback; + + return { + send: function( headers, complete ) { + var i, + xhr = options.xhr(), + id = ++xhrId; + + // Open the socket + xhr.open( options.type, options.url, options.async, options.username, options.password ); + + // Apply custom fields if provided + if ( options.xhrFields ) { + for ( i in options.xhrFields ) { + xhr[ i ] = options.xhrFields[ i ]; + } + } + + // Override mime type if needed + if ( options.mimeType && xhr.overrideMimeType ) { + xhr.overrideMimeType( options.mimeType ); + } + + // X-Requested-With header + // For cross-domain requests, seeing as conditions for a preflight are + // akin to a jigsaw puzzle, we simply never set it to be sure. + // (it can always be set on a per-request basis or even using ajaxSetup) + // For same-domain requests, won't change header if already provided. + if ( !options.crossDomain && !headers["X-Requested-With"] ) { + headers["X-Requested-With"] = "XMLHttpRequest"; + } + + // Set headers + for ( i in headers ) { + // Support: IE<9 + // IE's ActiveXObject throws a 'Type Mismatch' exception when setting + // request header to a null-value. + // + // To keep consistent with other XHR implementations, cast the value + // to string and ignore `undefined`. + if ( headers[ i ] !== undefined ) { + xhr.setRequestHeader( i, headers[ i ] + "" ); + } + } + + // Do send the request + // This may raise an exception which is actually + // handled in jQuery.ajax (so no try/catch here) + xhr.send( ( options.hasContent && options.data ) || null ); + + // Listener + callback = function( _, isAbort ) { + var status, statusText, responses; + + // Was never called and is aborted or complete + if ( callback && ( isAbort || xhr.readyState === 4 ) ) { + // Clean up + delete xhrCallbacks[ id ]; + callback = undefined; + xhr.onreadystatechange = jQuery.noop; + + // Abort manually if needed + if ( isAbort ) { + if ( xhr.readyState !== 4 ) { + xhr.abort(); + } + } else { + responses = {}; + status = xhr.status; + + // Support: IE<10 + // Accessing binary-data responseText throws an exception + // (#11426) + if ( typeof xhr.responseText === "string" ) { + responses.text = xhr.responseText; + } + + // Firefox throws an exception when accessing + // statusText for faulty cross-domain requests + try { + statusText = xhr.statusText; + } catch( e ) { + // We normalize with Webkit giving an empty statusText + statusText = ""; + } + + // Filter status for non standard behaviors + + // If the request is local and we have data: assume a success + // (success with no data won't get notified, that's the best we + // can do given current implementations) + if ( !status && options.isLocal && !options.crossDomain ) { + status = responses.text ? 200 : 404; + // IE - #1450: sometimes returns 1223 when it should be 204 + } else if ( status === 1223 ) { + status = 204; + } + } + } + + // Call complete if needed + if ( responses ) { + complete( status, statusText, responses, xhr.getAllResponseHeaders() ); + } + }; + + if ( !options.async ) { + // if we're in sync mode we fire the callback + callback(); + } else if ( xhr.readyState === 4 ) { + // (IE6 & IE7) if it's in cache and has been + // retrieved directly we need to fire the callback + setTimeout( callback ); + } else { + // Add to the list of active xhr callbacks + xhr.onreadystatechange = xhrCallbacks[ id ] = callback; + } + }, + + abort: function() { + if ( callback ) { + callback( undefined, true ); + } + } + }; + } + }); +} + +// Functions to create xhrs +function createStandardXHR() { + try { + return new window.XMLHttpRequest(); + } catch( e ) {} +} + +function createActiveXHR() { + try { + return new window.ActiveXObject( "Microsoft.XMLHTTP" ); + } catch( e ) {} +} + + + + +// Install script dataType +jQuery.ajaxSetup({ + accepts: { + script: "text/javascript, application/javascript, application/ecmascript, application/x-ecmascript" + }, + contents: { + script: /(?:java|ecma)script/ + }, + converters: { + "text script": function( text ) { + jQuery.globalEval( text ); + return text; + } + } +}); + +// Handle cache's special case and global +jQuery.ajaxPrefilter( "script", function( s ) { + if ( s.cache === undefined ) { + s.cache = false; + } + if ( s.crossDomain ) { + s.type = "GET"; + s.global = false; + } +}); + +// Bind script tag hack transport +jQuery.ajaxTransport( "script", function(s) { + + // This transport only deals with cross domain requests + if ( s.crossDomain ) { + + var script, + head = document.head || jQuery("head")[0] || document.documentElement; + + return { + + send: function( _, callback ) { + + script = document.createElement("script"); + + script.async = true; + + if ( s.scriptCharset ) { + script.charset = s.scriptCharset; + } + + script.src = s.url; + + // Attach handlers for all browsers + script.onload = script.onreadystatechange = function( _, isAbort ) { + + if ( isAbort || !script.readyState || /loaded|complete/.test( script.readyState ) ) { + + // Handle memory leak in IE + script.onload = script.onreadystatechange = null; + + // Remove the script + if ( script.parentNode ) { + script.parentNode.removeChild( script ); + } + + // Dereference the script + script = null; + + // Callback if not abort + if ( !isAbort ) { + callback( 200, "success" ); + } + } + }; + + // Circumvent IE6 bugs with base elements (#2709 and #4378) by prepending + // Use native DOM manipulation to avoid our domManip AJAX trickery + head.insertBefore( script, head.firstChild ); + }, + + abort: function() { + if ( script ) { + script.onload( undefined, true ); + } + } + }; + } +}); + + + + +var oldCallbacks = [], + rjsonp = /(=)\?(?=&|$)|\?\?/; + +// Default jsonp settings +jQuery.ajaxSetup({ + jsonp: "callback", + jsonpCallback: function() { + var callback = oldCallbacks.pop() || ( jQuery.expando + "_" + ( nonce++ ) ); + this[ callback ] = true; + return callback; + } +}); + +// Detect, normalize options and install callbacks for jsonp requests +jQuery.ajaxPrefilter( "json jsonp", function( s, originalSettings, jqXHR ) { + + var callbackName, overwritten, responseContainer, + jsonProp = s.jsonp !== false && ( rjsonp.test( s.url ) ? + "url" : + typeof s.data === "string" && !( s.contentType || "" ).indexOf("application/x-www-form-urlencoded") && rjsonp.test( s.data ) && "data" + ); + + // Handle iff the expected data type is "jsonp" or we have a parameter to set + if ( jsonProp || s.dataTypes[ 0 ] === "jsonp" ) { + + // Get callback name, remembering preexisting value associated with it + callbackName = s.jsonpCallback = jQuery.isFunction( s.jsonpCallback ) ? + s.jsonpCallback() : + s.jsonpCallback; + + // Insert callback into url or form data + if ( jsonProp ) { + s[ jsonProp ] = s[ jsonProp ].replace( rjsonp, "$1" + callbackName ); + } else if ( s.jsonp !== false ) { + s.url += ( rquery.test( s.url ) ? "&" : "?" ) + s.jsonp + "=" + callbackName; + } + + // Use data converter to retrieve json after script execution + s.converters["script json"] = function() { + if ( !responseContainer ) { + jQuery.error( callbackName + " was not called" ); + } + return responseContainer[ 0 ]; + }; + + // force json dataType + s.dataTypes[ 0 ] = "json"; + + // Install callback + overwritten = window[ callbackName ]; + window[ callbackName ] = function() { + responseContainer = arguments; + }; + + // Clean-up function (fires after converters) + jqXHR.always(function() { + // Restore preexisting value + window[ callbackName ] = overwritten; + + // Save back as free + if ( s[ callbackName ] ) { + // make sure that re-using the options doesn't screw things around + s.jsonpCallback = originalSettings.jsonpCallback; + + // save the callback name for future use + oldCallbacks.push( callbackName ); + } + + // Call if it was a function and we have a response + if ( responseContainer && jQuery.isFunction( overwritten ) ) { + overwritten( responseContainer[ 0 ] ); + } + + responseContainer = overwritten = undefined; + }); + + // Delegate to script + return "script"; + } +}); + + + + +// data: string of html +// context (optional): If specified, the fragment will be created in this context, defaults to document +// keepScripts (optional): If true, will include scripts passed in the html string +jQuery.parseHTML = function( data, context, keepScripts ) { + if ( !data || typeof data !== "string" ) { + return null; + } + if ( typeof context === "boolean" ) { + keepScripts = context; + context = false; + } + context = context || document; + + var parsed = rsingleTag.exec( data ), + scripts = !keepScripts && []; + + // Single tag + if ( parsed ) { + return [ context.createElement( parsed[1] ) ]; + } + + parsed = jQuery.buildFragment( [ data ], context, scripts ); + + if ( scripts && scripts.length ) { + jQuery( scripts ).remove(); + } + + return jQuery.merge( [], parsed.childNodes ); +}; + + +// Keep a copy of the old load method +var _load = jQuery.fn.load; + +/** + * Load a url into a page + */ +jQuery.fn.load = function( url, params, callback ) { + if ( typeof url !== "string" && _load ) { + return _load.apply( this, arguments ); + } + + var selector, response, type, + self = this, + off = url.indexOf(" "); + + if ( off >= 0 ) { + selector = jQuery.trim( url.slice( off, url.length ) ); + url = url.slice( 0, off ); + } + + // If it's a function + if ( jQuery.isFunction( params ) ) { + + // We assume that it's the callback + callback = params; + params = undefined; + + // Otherwise, build a param string + } else if ( params && typeof params === "object" ) { + type = "POST"; + } + + // If we have elements to modify, make the request + if ( self.length > 0 ) { + jQuery.ajax({ + url: url, + + // if "type" variable is undefined, then "GET" method will be used + type: type, + dataType: "html", + data: params + }).done(function( responseText ) { + + // Save response for use in complete callback + response = arguments; + + self.html( selector ? + + // If a selector was specified, locate the right elements in a dummy div + // Exclude scripts to avoid IE 'Permission Denied' errors + jQuery("<div>").append( jQuery.parseHTML( responseText ) ).find( selector ) : + + // Otherwise use the full result + responseText ); + + }).complete( callback && function( jqXHR, status ) { + self.each( callback, response || [ jqXHR.responseText, status, jqXHR ] ); + }); + } + + return this; +}; + + + + +jQuery.expr.filters.animated = function( elem ) { + return jQuery.grep(jQuery.timers, function( fn ) { + return elem === fn.elem; + }).length; +}; + + + + + +var docElem = window.document.documentElement; + +/** + * Gets a window from an element + */ +function getWindow( elem ) { + return jQuery.isWindow( elem ) ? + elem : + elem.nodeType === 9 ? + elem.defaultView || elem.parentWindow : + false; +} + +jQuery.offset = { + setOffset: function( elem, options, i ) { + var curPosition, curLeft, curCSSTop, curTop, curOffset, curCSSLeft, calculatePosition, + position = jQuery.css( elem, "position" ), + curElem = jQuery( elem ), + props = {}; + + // set position first, in-case top/left are set even on static elem + if ( position === "static" ) { + elem.style.position = "relative"; + } + + curOffset = curElem.offset(); + curCSSTop = jQuery.css( elem, "top" ); + curCSSLeft = jQuery.css( elem, "left" ); + calculatePosition = ( position === "absolute" || position === "fixed" ) && + jQuery.inArray("auto", [ curCSSTop, curCSSLeft ] ) > -1; + + // need to be able to calculate position if either top or left is auto and position is either absolute or fixed + if ( calculatePosition ) { + curPosition = curElem.position(); + curTop = curPosition.top; + curLeft = curPosition.left; + } else { + curTop = parseFloat( curCSSTop ) || 0; + curLeft = parseFloat( curCSSLeft ) || 0; + } + + if ( jQuery.isFunction( options ) ) { + options = options.call( elem, i, curOffset ); + } + + if ( options.top != null ) { + props.top = ( options.top - curOffset.top ) + curTop; + } + if ( options.left != null ) { + props.left = ( options.left - curOffset.left ) + curLeft; + } + + if ( "using" in options ) { + options.using.call( elem, props ); + } else { + curElem.css( props ); + } + } +}; + +jQuery.fn.extend({ + offset: function( options ) { + if ( arguments.length ) { + return options === undefined ? + this : + this.each(function( i ) { + jQuery.offset.setOffset( this, options, i ); + }); + } + + var docElem, win, + box = { top: 0, left: 0 }, + elem = this[ 0 ], + doc = elem && elem.ownerDocument; + + if ( !doc ) { + return; + } + + docElem = doc.documentElement; + + // Make sure it's not a disconnected DOM node + if ( !jQuery.contains( docElem, elem ) ) { + return box; + } + + // If we don't have gBCR, just use 0,0 rather than error + // BlackBerry 5, iOS 3 (original iPhone) + if ( typeof elem.getBoundingClientRect !== strundefined ) { + box = elem.getBoundingClientRect(); + } + win = getWindow( doc ); + return { + top: box.top + ( win.pageYOffset || docElem.scrollTop ) - ( docElem.clientTop || 0 ), + left: box.left + ( win.pageXOffset || docElem.scrollLeft ) - ( docElem.clientLeft || 0 ) + }; + }, + + position: function() { + if ( !this[ 0 ] ) { + return; + } + + var offsetParent, offset, + parentOffset = { top: 0, left: 0 }, + elem = this[ 0 ]; + + // fixed elements are offset from window (parentOffset = {top:0, left: 0}, because it is its only offset parent + if ( jQuery.css( elem, "position" ) === "fixed" ) { + // we assume that getBoundingClientRect is available when computed position is fixed + offset = elem.getBoundingClientRect(); + } else { + // Get *real* offsetParent + offsetParent = this.offsetParent(); + + // Get correct offsets + offset = this.offset(); + if ( !jQuery.nodeName( offsetParent[ 0 ], "html" ) ) { + parentOffset = offsetParent.offset(); + } + + // Add offsetParent borders + parentOffset.top += jQuery.css( offsetParent[ 0 ], "borderTopWidth", true ); + parentOffset.left += jQuery.css( offsetParent[ 0 ], "borderLeftWidth", true ); + } + + // Subtract parent offsets and element margins + // note: when an element has margin: auto the offsetLeft and marginLeft + // are the same in Safari causing offset.left to incorrectly be 0 + return { + top: offset.top - parentOffset.top - jQuery.css( elem, "marginTop", true ), + left: offset.left - parentOffset.left - jQuery.css( elem, "marginLeft", true) + }; + }, + + offsetParent: function() { + return this.map(function() { + var offsetParent = this.offsetParent || docElem; + + while ( offsetParent && ( !jQuery.nodeName( offsetParent, "html" ) && jQuery.css( offsetParent, "position" ) === "static" ) ) { + offsetParent = offsetParent.offsetParent; + } + return offsetParent || docElem; + }); + } +}); + +// Create scrollLeft and scrollTop methods +jQuery.each( { scrollLeft: "pageXOffset", scrollTop: "pageYOffset" }, function( method, prop ) { + var top = /Y/.test( prop ); + + jQuery.fn[ method ] = function( val ) { + return access( this, function( elem, method, val ) { + var win = getWindow( elem ); + + if ( val === undefined ) { + return win ? (prop in win) ? win[ prop ] : + win.document.documentElement[ method ] : + elem[ method ]; + } + + if ( win ) { + win.scrollTo( + !top ? val : jQuery( win ).scrollLeft(), + top ? val : jQuery( win ).scrollTop() + ); + + } else { + elem[ method ] = val; + } + }, method, val, arguments.length, null ); + }; +}); + +// Add the top/left cssHooks using jQuery.fn.position +// Webkit bug: https://bugs.webkit.org/show_bug.cgi?id=29084 +// getComputedStyle returns percent when specified for top/left/bottom/right +// rather than make the css module depend on the offset module, we just check for it here +jQuery.each( [ "top", "left" ], function( i, prop ) { + jQuery.cssHooks[ prop ] = addGetHookIf( support.pixelPosition, + function( elem, computed ) { + if ( computed ) { + computed = curCSS( elem, prop ); + // if curCSS returns percentage, fallback to offset + return rnumnonpx.test( computed ) ? + jQuery( elem ).position()[ prop ] + "px" : + computed; + } + } + ); +}); + + +// Create innerHeight, innerWidth, height, width, outerHeight and outerWidth methods +jQuery.each( { Height: "height", Width: "width" }, function( name, type ) { + jQuery.each( { padding: "inner" + name, content: type, "": "outer" + name }, function( defaultExtra, funcName ) { + // margin is only for outerHeight, outerWidth + jQuery.fn[ funcName ] = function( margin, value ) { + var chainable = arguments.length && ( defaultExtra || typeof margin !== "boolean" ), + extra = defaultExtra || ( margin === true || value === true ? "margin" : "border" ); + + return access( this, function( elem, type, value ) { + var doc; + + if ( jQuery.isWindow( elem ) ) { + // As of 5/8/2012 this will yield incorrect results for Mobile Safari, but there + // isn't a whole lot we can do. See pull request at this URL for discussion: + // https://github.com/jquery/jquery/pull/764 + return elem.document.documentElement[ "client" + name ]; + } + + // Get document width or height + if ( elem.nodeType === 9 ) { + doc = elem.documentElement; + + // Either scroll[Width/Height] or offset[Width/Height] or client[Width/Height], whichever is greatest + // unfortunately, this causes bug #3838 in IE6/8 only, but there is currently no good, small way to fix it. + return Math.max( + elem.body[ "scroll" + name ], doc[ "scroll" + name ], + elem.body[ "offset" + name ], doc[ "offset" + name ], + doc[ "client" + name ] + ); + } + + return value === undefined ? + // Get width or height on the element, requesting but not forcing parseFloat + jQuery.css( elem, type, extra ) : + + // Set width or height on the element + jQuery.style( elem, type, value, extra ); + }, type, chainable ? margin : undefined, chainable, null ); + }; + }); +}); + + +// The number of elements contained in the matched element set +jQuery.fn.size = function() { + return this.length; +}; + +jQuery.fn.andSelf = jQuery.fn.addBack; + + + + +// Register as a named AMD module, since jQuery can be concatenated with other +// files that may use define, but not via a proper concatenation script that +// understands anonymous AMD modules. A named AMD is safest and most robust +// way to register. Lowercase jquery is used because AMD module names are +// derived from file names, and jQuery is normally delivered in a lowercase +// file name. Do this after creating the global so that if an AMD module wants +// to call noConflict to hide this version of jQuery, it will work. + +// Note that for maximum portability, libraries that are not jQuery should +// declare themselves as anonymous modules, and avoid setting a global if an +// AMD loader is present. jQuery is a special case. For more information, see +// https://github.com/jrburke/requirejs/wiki/Updating-existing-libraries#wiki-anon + +if ( typeof define === "function" && define.amd ) { + define( "jquery", [], function() { + return jQuery; + }); +} + + + + +var + // Map over jQuery in case of overwrite + _jQuery = window.jQuery, + + // Map over the $ in case of overwrite + _$ = window.$; + +jQuery.noConflict = function( deep ) { + if ( window.$ === jQuery ) { + window.$ = _$; + } + + if ( deep && window.jQuery === jQuery ) { + window.jQuery = _jQuery; + } + + return jQuery; +}; + +// Expose jQuery and $ identifiers, even in +// AMD (#7102#comment:10, https://github.com/jquery/jquery/pull/557) +// and CommonJS for browser emulators (#13566) +if ( typeof noGlobal === strundefined ) { + window.jQuery = window.$ = jQuery; +} + + + + +return jQuery; + +})); diff --git a/doc/html/_static/jquery.js b/doc/html/_static/jquery.js index 83589daa707a25a1fb3e4112075d382e9a1611ab..ab28a24729b320bffd3d2f60302af949db39ab85 100644 --- a/doc/html/_static/jquery.js +++ b/doc/html/_static/jquery.js @@ -1,2 +1,4 @@ -/*! jQuery v1.8.3 jquery.com | jquery.org/license */ -(function(e,t){function _(e){var t=M[e]={};return v.each(e.split(y),function(e,n){t[n]=!0}),t}function H(e,n,r){if(r===t&&e.nodeType===1){var i="data-"+n.replace(P,"-$1").toLowerCase();r=e.getAttribute(i);if(typeof r=="string"){try{r=r==="true"?!0:r==="false"?!1:r==="null"?null:+r+""===r?+r:D.test(r)?v.parseJSON(r):r}catch(s){}v.data(e,n,r)}else r=t}return r}function B(e){var t;for(t in e){if(t==="data"&&v.isEmptyObject(e[t]))continue;if(t!=="toJSON")return!1}return!0}function et(){return!1}function tt(){return!0}function ut(e){return!e||!e.parentNode||e.parentNode.nodeType===11}function at(e,t){do e=e[t];while(e&&e.nodeType!==1);return e}function ft(e,t,n){t=t||0;if(v.isFunction(t))return v.grep(e,function(e,r){var i=!!t.call(e,r,e);return i===n});if(t.nodeType)return v.grep(e,function(e,r){return e===t===n});if(typeof t=="string"){var r=v.grep(e,function(e){return e.nodeType===1});if(it.test(t))return v.filter(t,r,!n);t=v.filter(t,r)}return v.grep(e,function(e,r){return v.inArray(e,t)>=0===n})}function lt(e){var t=ct.split("|"),n=e.createDocumentFragment();if(n.createElement)while(t.length)n.createElement(t.pop());return n}function Lt(e,t){return e.getElementsByTagName(t)[0]||e.appendChild(e.ownerDocument.createElement(t))}function At(e,t){if(t.nodeType!==1||!v.hasData(e))return;var n,r,i,s=v._data(e),o=v._data(t,s),u=s.events;if(u){delete o.handle,o.events={};for(n in u)for(r=0,i=u[n].length;r<i;r++)v.event.add(t,n,u[n][r])}o.data&&(o.data=v.extend({},o.data))}function Ot(e,t){var n;if(t.nodeType!==1)return;t.clearAttributes&&t.clearAttributes(),t.mergeAttributes&&t.mergeAttributes(e),n=t.nodeName.toLowerCase(),n==="object"?(t.parentNode&&(t.outerHTML=e.outerHTML),v.support.html5Clone&&e.innerHTML&&!v.trim(t.innerHTML)&&(t.innerHTML=e.innerHTML)):n==="input"&&Et.test(e.type)?(t.defaultChecked=t.checked=e.checked,t.value!==e.value&&(t.value=e.value)):n==="option"?t.selected=e.defaultSelected:n==="input"||n==="textarea"?t.defaultValue=e.defaultValue:n==="script"&&t.text!==e.text&&(t.text=e.text),t.removeAttribute(v.expando)}function Mt(e){return typeof e.getElementsByTagName!="undefined"?e.getElementsByTagName("*"):typeof e.querySelectorAll!="undefined"?e.querySelectorAll("*"):[]}function _t(e){Et.test(e.type)&&(e.defaultChecked=e.checked)}function Qt(e,t){if(t in e)return t;var n=t.charAt(0).toUpperCase()+t.slice(1),r=t,i=Jt.length;while(i--){t=Jt[i]+n;if(t in e)return t}return r}function Gt(e,t){return e=t||e,v.css(e,"display")==="none"||!v.contains(e.ownerDocument,e)}function Yt(e,t){var n,r,i=[],s=0,o=e.length;for(;s<o;s++){n=e[s];if(!n.style)continue;i[s]=v._data(n,"olddisplay"),t?(!i[s]&&n.style.display==="none"&&(n.style.display=""),n.style.display===""&&Gt(n)&&(i[s]=v._data(n,"olddisplay",nn(n.nodeName)))):(r=Dt(n,"display"),!i[s]&&r!=="none"&&v._data(n,"olddisplay",r))}for(s=0;s<o;s++){n=e[s];if(!n.style)continue;if(!t||n.style.display==="none"||n.style.display==="")n.style.display=t?i[s]||"":"none"}return e}function Zt(e,t,n){var r=Rt.exec(t);return r?Math.max(0,r[1]-(n||0))+(r[2]||"px"):t}function en(e,t,n,r){var i=n===(r?"border":"content")?4:t==="width"?1:0,s=0;for(;i<4;i+=2)n==="margin"&&(s+=v.css(e,n+$t[i],!0)),r?(n==="content"&&(s-=parseFloat(Dt(e,"padding"+$t[i]))||0),n!=="margin"&&(s-=parseFloat(Dt(e,"border"+$t[i]+"Width"))||0)):(s+=parseFloat(Dt(e,"padding"+$t[i]))||0,n!=="padding"&&(s+=parseFloat(Dt(e,"border"+$t[i]+"Width"))||0));return s}function tn(e,t,n){var r=t==="width"?e.offsetWidth:e.offsetHeight,i=!0,s=v.support.boxSizing&&v.css(e,"boxSizing")==="border-box";if(r<=0||r==null){r=Dt(e,t);if(r<0||r==null)r=e.style[t];if(Ut.test(r))return r;i=s&&(v.support.boxSizingReliable||r===e.style[t]),r=parseFloat(r)||0}return r+en(e,t,n||(s?"border":"content"),i)+"px"}function nn(e){if(Wt[e])return Wt[e];var t=v("<"+e+">").appendTo(i.body),n=t.css("display");t.remove();if(n==="none"||n===""){Pt=i.body.appendChild(Pt||v.extend(i.createElement("iframe"),{frameBorder:0,width:0,height:0}));if(!Ht||!Pt.createElement)Ht=(Pt.contentWindow||Pt.contentDocument).document,Ht.write("<!doctype html><html><body>"),Ht.close();t=Ht.body.appendChild(Ht.createElement(e)),n=Dt(t,"display"),i.body.removeChild(Pt)}return Wt[e]=n,n}function fn(e,t,n,r){var i;if(v.isArray(t))v.each(t,function(t,i){n||sn.test(e)?r(e,i):fn(e+"["+(typeof i=="object"?t:"")+"]",i,n,r)});else if(!n&&v.type(t)==="object")for(i in t)fn(e+"["+i+"]",t[i],n,r);else r(e,t)}function Cn(e){return function(t,n){typeof t!="string"&&(n=t,t="*");var r,i,s,o=t.toLowerCase().split(y),u=0,a=o.length;if(v.isFunction(n))for(;u<a;u++)r=o[u],s=/^\+/.test(r),s&&(r=r.substr(1)||"*"),i=e[r]=e[r]||[],i[s?"unshift":"push"](n)}}function kn(e,n,r,i,s,o){s=s||n.dataTypes[0],o=o||{},o[s]=!0;var u,a=e[s],f=0,l=a?a.length:0,c=e===Sn;for(;f<l&&(c||!u);f++)u=a[f](n,r,i),typeof u=="string"&&(!c||o[u]?u=t:(n.dataTypes.unshift(u),u=kn(e,n,r,i,u,o)));return(c||!u)&&!o["*"]&&(u=kn(e,n,r,i,"*",o)),u}function Ln(e,n){var r,i,s=v.ajaxSettings.flatOptions||{};for(r in n)n[r]!==t&&((s[r]?e:i||(i={}))[r]=n[r]);i&&v.extend(!0,e,i)}function An(e,n,r){var i,s,o,u,a=e.contents,f=e.dataTypes,l=e.responseFields;for(s in l)s in r&&(n[l[s]]=r[s]);while(f[0]==="*")f.shift(),i===t&&(i=e.mimeType||n.getResponseHeader("content-type"));if(i)for(s in a)if(a[s]&&a[s].test(i)){f.unshift(s);break}if(f[0]in r)o=f[0];else{for(s in r){if(!f[0]||e.converters[s+" "+f[0]]){o=s;break}u||(u=s)}o=o||u}if(o)return o!==f[0]&&f.unshift(o),r[o]}function On(e,t){var n,r,i,s,o=e.dataTypes.slice(),u=o[0],a={},f=0;e.dataFilter&&(t=e.dataFilter(t,e.dataType));if(o[1])for(n in e.converters)a[n.toLowerCase()]=e.converters[n];for(;i=o[++f];)if(i!=="*"){if(u!=="*"&&u!==i){n=a[u+" "+i]||a["* "+i];if(!n)for(r in a){s=r.split(" ");if(s[1]===i){n=a[u+" "+s[0]]||a["* "+s[0]];if(n){n===!0?n=a[r]:a[r]!==!0&&(i=s[0],o.splice(f--,0,i));break}}}if(n!==!0)if(n&&e["throws"])t=n(t);else try{t=n(t)}catch(l){return{state:"parsererror",error:n?l:"No conversion from "+u+" to "+i}}}u=i}return{state:"success",data:t}}function Fn(){try{return new e.XMLHttpRequest}catch(t){}}function In(){try{return new e.ActiveXObject("Microsoft.XMLHTTP")}catch(t){}}function $n(){return setTimeout(function(){qn=t},0),qn=v.now()}function Jn(e,t){v.each(t,function(t,n){var r=(Vn[t]||[]).concat(Vn["*"]),i=0,s=r.length;for(;i<s;i++)if(r[i].call(e,t,n))return})}function Kn(e,t,n){var r,i=0,s=0,o=Xn.length,u=v.Deferred().always(function(){delete a.elem}),a=function(){var t=qn||$n(),n=Math.max(0,f.startTime+f.duration-t),r=n/f.duration||0,i=1-r,s=0,o=f.tweens.length;for(;s<o;s++)f.tweens[s].run(i);return u.notifyWith(e,[f,i,n]),i<1&&o?n:(u.resolveWith(e,[f]),!1)},f=u.promise({elem:e,props:v.extend({},t),opts:v.extend(!0,{specialEasing:{}},n),originalProperties:t,originalOptions:n,startTime:qn||$n(),duration:n.duration,tweens:[],createTween:function(t,n,r){var i=v.Tween(e,f.opts,t,n,f.opts.specialEasing[t]||f.opts.easing);return f.tweens.push(i),i},stop:function(t){var n=0,r=t?f.tweens.length:0;for(;n<r;n++)f.tweens[n].run(1);return t?u.resolveWith(e,[f,t]):u.rejectWith(e,[f,t]),this}}),l=f.props;Qn(l,f.opts.specialEasing);for(;i<o;i++){r=Xn[i].call(f,e,l,f.opts);if(r)return r}return Jn(f,l),v.isFunction(f.opts.start)&&f.opts.start.call(e,f),v.fx.timer(v.extend(a,{anim:f,queue:f.opts.queue,elem:e})),f.progress(f.opts.progress).done(f.opts.done,f.opts.complete).fail(f.opts.fail).always(f.opts.always)}function Qn(e,t){var n,r,i,s,o;for(n in e){r=v.camelCase(n),i=t[r],s=e[n],v.isArray(s)&&(i=s[1],s=e[n]=s[0]),n!==r&&(e[r]=s,delete e[n]),o=v.cssHooks[r];if(o&&"expand"in o){s=o.expand(s),delete e[r];for(n in s)n in e||(e[n]=s[n],t[n]=i)}else t[r]=i}}function Gn(e,t,n){var r,i,s,o,u,a,f,l,c,h=this,p=e.style,d={},m=[],g=e.nodeType&&Gt(e);n.queue||(l=v._queueHooks(e,"fx"),l.unqueued==null&&(l.unqueued=0,c=l.empty.fire,l.empty.fire=function(){l.unqueued||c()}),l.unqueued++,h.always(function(){h.always(function(){l.unqueued--,v.queue(e,"fx").length||l.empty.fire()})})),e.nodeType===1&&("height"in t||"width"in t)&&(n.overflow=[p.overflow,p.overflowX,p.overflowY],v.css(e,"display")==="inline"&&v.css(e,"float")==="none"&&(!v.support.inlineBlockNeedsLayout||nn(e.nodeName)==="inline"?p.display="inline-block":p.zoom=1)),n.overflow&&(p.overflow="hidden",v.support.shrinkWrapBlocks||h.done(function(){p.overflow=n.overflow[0],p.overflowX=n.overflow[1],p.overflowY=n.overflow[2]}));for(r in t){s=t[r];if(Un.exec(s)){delete t[r],a=a||s==="toggle";if(s===(g?"hide":"show"))continue;m.push(r)}}o=m.length;if(o){u=v._data(e,"fxshow")||v._data(e,"fxshow",{}),"hidden"in u&&(g=u.hidden),a&&(u.hidden=!g),g?v(e).show():h.done(function(){v(e).hide()}),h.done(function(){var t;v.removeData(e,"fxshow",!0);for(t in d)v.style(e,t,d[t])});for(r=0;r<o;r++)i=m[r],f=h.createTween(i,g?u[i]:0),d[i]=u[i]||v.style(e,i),i in u||(u[i]=f.start,g&&(f.end=f.start,f.start=i==="width"||i==="height"?1:0))}}function Yn(e,t,n,r,i){return new Yn.prototype.init(e,t,n,r,i)}function Zn(e,t){var n,r={height:e},i=0;t=t?1:0;for(;i<4;i+=2-t)n=$t[i],r["margin"+n]=r["padding"+n]=e;return t&&(r.opacity=r.width=e),r}function tr(e){return v.isWindow(e)?e:e.nodeType===9?e.defaultView||e.parentWindow:!1}var n,r,i=e.document,s=e.location,o=e.navigator,u=e.jQuery,a=e.$,f=Array.prototype.push,l=Array.prototype.slice,c=Array.prototype.indexOf,h=Object.prototype.toString,p=Object.prototype.hasOwnProperty,d=String.prototype.trim,v=function(e,t){return new v.fn.init(e,t,n)},m=/[\-+]?(?:\d*\.|)\d+(?:[eE][\-+]?\d+|)/.source,g=/\S/,y=/\s+/,b=/^[\s\uFEFF\xA0]+|[\s\uFEFF\xA0]+$/g,w=/^(?:[^#<]*(<[\w\W]+>)[^>]*$|#([\w\-]*)$)/,E=/^<(\w+)\s*\/?>(?:<\/\1>|)$/,S=/^[\],:{}\s]*$/,x=/(?:^|:|,)(?:\s*\[)+/g,T=/\\(?:["\\\/bfnrt]|u[\da-fA-F]{4})/g,N=/"[^"\\\r\n]*"|true|false|null|-?(?:\d\d*\.|)\d+(?:[eE][\-+]?\d+|)/g,C=/^-ms-/,k=/-([\da-z])/gi,L=function(e,t){return(t+"").toUpperCase()},A=function(){i.addEventListener?(i.removeEventListener("DOMContentLoaded",A,!1),v.ready()):i.readyState==="complete"&&(i.detachEvent("onreadystatechange",A),v.ready())},O={};v.fn=v.prototype={constructor:v,init:function(e,n,r){var s,o,u,a;if(!e)return this;if(e.nodeType)return this.context=this[0]=e,this.length=1,this;if(typeof e=="string"){e.charAt(0)==="<"&&e.charAt(e.length-1)===">"&&e.length>=3?s=[null,e,null]:s=w.exec(e);if(s&&(s[1]||!n)){if(s[1])return n=n instanceof v?n[0]:n,a=n&&n.nodeType?n.ownerDocument||n:i,e=v.parseHTML(s[1],a,!0),E.test(s[1])&&v.isPlainObject(n)&&this.attr.call(e,n,!0),v.merge(this,e);o=i.getElementById(s[2]);if(o&&o.parentNode){if(o.id!==s[2])return r.find(e);this.length=1,this[0]=o}return this.context=i,this.selector=e,this}return!n||n.jquery?(n||r).find(e):this.constructor(n).find(e)}return v.isFunction(e)?r.ready(e):(e.selector!==t&&(this.selector=e.selector,this.context=e.context),v.makeArray(e,this))},selector:"",jquery:"1.8.3",length:0,size:function(){return this.length},toArray:function(){return l.call(this)},get:function(e){return e==null?this.toArray():e<0?this[this.length+e]:this[e]},pushStack:function(e,t,n){var r=v.merge(this.constructor(),e);return r.prevObject=this,r.context=this.context,t==="find"?r.selector=this.selector+(this.selector?" ":"")+n:t&&(r.selector=this.selector+"."+t+"("+n+")"),r},each:function(e,t){return v.each(this,e,t)},ready:function(e){return v.ready.promise().done(e),this},eq:function(e){return e=+e,e===-1?this.slice(e):this.slice(e,e+1)},first:function(){return this.eq(0)},last:function(){return this.eq(-1)},slice:function(){return this.pushStack(l.apply(this,arguments),"slice",l.call(arguments).join(","))},map:function(e){return this.pushStack(v.map(this,function(t,n){return e.call(t,n,t)}))},end:function(){return this.prevObject||this.constructor(null)},push:f,sort:[].sort,splice:[].splice},v.fn.init.prototype=v.fn,v.extend=v.fn.extend=function(){var e,n,r,i,s,o,u=arguments[0]||{},a=1,f=arguments.length,l=!1;typeof u=="boolean"&&(l=u,u=arguments[1]||{},a=2),typeof u!="object"&&!v.isFunction(u)&&(u={}),f===a&&(u=this,--a);for(;a<f;a++)if((e=arguments[a])!=null)for(n in e){r=u[n],i=e[n];if(u===i)continue;l&&i&&(v.isPlainObject(i)||(s=v.isArray(i)))?(s?(s=!1,o=r&&v.isArray(r)?r:[]):o=r&&v.isPlainObject(r)?r:{},u[n]=v.extend(l,o,i)):i!==t&&(u[n]=i)}return u},v.extend({noConflict:function(t){return e.$===v&&(e.$=a),t&&e.jQuery===v&&(e.jQuery=u),v},isReady:!1,readyWait:1,holdReady:function(e){e?v.readyWait++:v.ready(!0)},ready:function(e){if(e===!0?--v.readyWait:v.isReady)return;if(!i.body)return setTimeout(v.ready,1);v.isReady=!0;if(e!==!0&&--v.readyWait>0)return;r.resolveWith(i,[v]),v.fn.trigger&&v(i).trigger("ready").off("ready")},isFunction:function(e){return v.type(e)==="function"},isArray:Array.isArray||function(e){return v.type(e)==="array"},isWindow:function(e){return e!=null&&e==e.window},isNumeric:function(e){return!isNaN(parseFloat(e))&&isFinite(e)},type:function(e){return e==null?String(e):O[h.call(e)]||"object"},isPlainObject:function(e){if(!e||v.type(e)!=="object"||e.nodeType||v.isWindow(e))return!1;try{if(e.constructor&&!p.call(e,"constructor")&&!p.call(e.constructor.prototype,"isPrototypeOf"))return!1}catch(n){return!1}var r;for(r in e);return r===t||p.call(e,r)},isEmptyObject:function(e){var t;for(t in e)return!1;return!0},error:function(e){throw new Error(e)},parseHTML:function(e,t,n){var r;return!e||typeof e!="string"?null:(typeof t=="boolean"&&(n=t,t=0),t=t||i,(r=E.exec(e))?[t.createElement(r[1])]:(r=v.buildFragment([e],t,n?null:[]),v.merge([],(r.cacheable?v.clone(r.fragment):r.fragment).childNodes)))},parseJSON:function(t){if(!t||typeof t!="string")return null;t=v.trim(t);if(e.JSON&&e.JSON.parse)return e.JSON.parse(t);if(S.test(t.replace(T,"@").replace(N,"]").replace(x,"")))return(new Function("return "+t))();v.error("Invalid JSON: "+t)},parseXML:function(n){var r,i;if(!n||typeof n!="string")return null;try{e.DOMParser?(i=new DOMParser,r=i.parseFromString(n,"text/xml")):(r=new ActiveXObject("Microsoft.XMLDOM"),r.async="false",r.loadXML(n))}catch(s){r=t}return(!r||!r.documentElement||r.getElementsByTagName("parsererror").length)&&v.error("Invalid XML: "+n),r},noop:function(){},globalEval:function(t){t&&g.test(t)&&(e.execScript||function(t){e.eval.call(e,t)})(t)},camelCase:function(e){return e.replace(C,"ms-").replace(k,L)},nodeName:function(e,t){return e.nodeName&&e.nodeName.toLowerCase()===t.toLowerCase()},each:function(e,n,r){var i,s=0,o=e.length,u=o===t||v.isFunction(e);if(r){if(u){for(i in e)if(n.apply(e[i],r)===!1)break}else for(;s<o;)if(n.apply(e[s++],r)===!1)break}else if(u){for(i in e)if(n.call(e[i],i,e[i])===!1)break}else for(;s<o;)if(n.call(e[s],s,e[s++])===!1)break;return e},trim:d&&!d.call("\ufeff\u00a0")?function(e){return e==null?"":d.call(e)}:function(e){return e==null?"":(e+"").replace(b,"")},makeArray:function(e,t){var n,r=t||[];return e!=null&&(n=v.type(e),e.length==null||n==="string"||n==="function"||n==="regexp"||v.isWindow(e)?f.call(r,e):v.merge(r,e)),r},inArray:function(e,t,n){var r;if(t){if(c)return c.call(t,e,n);r=t.length,n=n?n<0?Math.max(0,r+n):n:0;for(;n<r;n++)if(n in t&&t[n]===e)return n}return-1},merge:function(e,n){var r=n.length,i=e.length,s=0;if(typeof r=="number")for(;s<r;s++)e[i++]=n[s];else while(n[s]!==t)e[i++]=n[s++];return e.length=i,e},grep:function(e,t,n){var r,i=[],s=0,o=e.length;n=!!n;for(;s<o;s++)r=!!t(e[s],s),n!==r&&i.push(e[s]);return i},map:function(e,n,r){var i,s,o=[],u=0,a=e.length,f=e instanceof v||a!==t&&typeof a=="number"&&(a>0&&e[0]&&e[a-1]||a===0||v.isArray(e));if(f)for(;u<a;u++)i=n(e[u],u,r),i!=null&&(o[o.length]=i);else for(s in e)i=n(e[s],s,r),i!=null&&(o[o.length]=i);return o.concat.apply([],o)},guid:1,proxy:function(e,n){var r,i,s;return typeof n=="string"&&(r=e[n],n=e,e=r),v.isFunction(e)?(i=l.call(arguments,2),s=function(){return e.apply(n,i.concat(l.call(arguments)))},s.guid=e.guid=e.guid||v.guid++,s):t},access:function(e,n,r,i,s,o,u){var a,f=r==null,l=0,c=e.length;if(r&&typeof r=="object"){for(l in r)v.access(e,n,l,r[l],1,o,i);s=1}else if(i!==t){a=u===t&&v.isFunction(i),f&&(a?(a=n,n=function(e,t,n){return a.call(v(e),n)}):(n.call(e,i),n=null));if(n)for(;l<c;l++)n(e[l],r,a?i.call(e[l],l,n(e[l],r)):i,u);s=1}return s?e:f?n.call(e):c?n(e[0],r):o},now:function(){return(new Date).getTime()}}),v.ready.promise=function(t){if(!r){r=v.Deferred();if(i.readyState==="complete")setTimeout(v.ready,1);else if(i.addEventListener)i.addEventListener("DOMContentLoaded",A,!1),e.addEventListener("load",v.ready,!1);else{i.attachEvent("onreadystatechange",A),e.attachEvent("onload",v.ready);var n=!1;try{n=e.frameElement==null&&i.documentElement}catch(s){}n&&n.doScroll&&function o(){if(!v.isReady){try{n.doScroll("left")}catch(e){return setTimeout(o,50)}v.ready()}}()}}return r.promise(t)},v.each("Boolean Number String Function Array Date RegExp Object".split(" "),function(e,t){O["[object "+t+"]"]=t.toLowerCase()}),n=v(i);var M={};v.Callbacks=function(e){e=typeof e=="string"?M[e]||_(e):v.extend({},e);var n,r,i,s,o,u,a=[],f=!e.once&&[],l=function(t){n=e.memory&&t,r=!0,u=s||0,s=0,o=a.length,i=!0;for(;a&&u<o;u++)if(a[u].apply(t[0],t[1])===!1&&e.stopOnFalse){n=!1;break}i=!1,a&&(f?f.length&&l(f.shift()):n?a=[]:c.disable())},c={add:function(){if(a){var t=a.length;(function r(t){v.each(t,function(t,n){var i=v.type(n);i==="function"?(!e.unique||!c.has(n))&&a.push(n):n&&n.length&&i!=="string"&&r(n)})})(arguments),i?o=a.length:n&&(s=t,l(n))}return this},remove:function(){return a&&v.each(arguments,function(e,t){var n;while((n=v.inArray(t,a,n))>-1)a.splice(n,1),i&&(n<=o&&o--,n<=u&&u--)}),this},has:function(e){return v.inArray(e,a)>-1},empty:function(){return a=[],this},disable:function(){return a=f=n=t,this},disabled:function(){return!a},lock:function(){return f=t,n||c.disable(),this},locked:function(){return!f},fireWith:function(e,t){return t=t||[],t=[e,t.slice?t.slice():t],a&&(!r||f)&&(i?f.push(t):l(t)),this},fire:function(){return c.fireWith(this,arguments),this},fired:function(){return!!r}};return c},v.extend({Deferred:function(e){var t=[["resolve","done",v.Callbacks("once memory"),"resolved"],["reject","fail",v.Callbacks("once memory"),"rejected"],["notify","progress",v.Callbacks("memory")]],n="pending",r={state:function(){return n},always:function(){return i.done(arguments).fail(arguments),this},then:function(){var e=arguments;return v.Deferred(function(n){v.each(t,function(t,r){var s=r[0],o=e[t];i[r[1]](v.isFunction(o)?function(){var e=o.apply(this,arguments);e&&v.isFunction(e.promise)?e.promise().done(n.resolve).fail(n.reject).progress(n.notify):n[s+"With"](this===i?n:this,[e])}:n[s])}),e=null}).promise()},promise:function(e){return e!=null?v.extend(e,r):r}},i={};return r.pipe=r.then,v.each(t,function(e,s){var o=s[2],u=s[3];r[s[1]]=o.add,u&&o.add(function(){n=u},t[e^1][2].disable,t[2][2].lock),i[s[0]]=o.fire,i[s[0]+"With"]=o.fireWith}),r.promise(i),e&&e.call(i,i),i},when:function(e){var t=0,n=l.call(arguments),r=n.length,i=r!==1||e&&v.isFunction(e.promise)?r:0,s=i===1?e:v.Deferred(),o=function(e,t,n){return function(r){t[e]=this,n[e]=arguments.length>1?l.call(arguments):r,n===u?s.notifyWith(t,n):--i||s.resolveWith(t,n)}},u,a,f;if(r>1){u=new Array(r),a=new Array(r),f=new Array(r);for(;t<r;t++)n[t]&&v.isFunction(n[t].promise)?n[t].promise().done(o(t,f,n)).fail(s.reject).progress(o(t,a,u)):--i}return i||s.resolveWith(f,n),s.promise()}}),v.support=function(){var t,n,r,s,o,u,a,f,l,c,h,p=i.createElement("div");p.setAttribute("className","t"),p.innerHTML=" <link/><table></table><a href='/a'>a</a><input type='checkbox'/>",n=p.getElementsByTagName("*"),r=p.getElementsByTagName("a")[0];if(!n||!r||!n.length)return{};s=i.createElement("select"),o=s.appendChild(i.createElement("option")),u=p.getElementsByTagName("input")[0],r.style.cssText="top:1px;float:left;opacity:.5",t={leadingWhitespace:p.firstChild.nodeType===3,tbody:!p.getElementsByTagName("tbody").length,htmlSerialize:!!p.getElementsByTagName("link").length,style:/top/.test(r.getAttribute("style")),hrefNormalized:r.getAttribute("href")==="/a",opacity:/^0.5/.test(r.style.opacity),cssFloat:!!r.style.cssFloat,checkOn:u.value==="on",optSelected:o.selected,getSetAttribute:p.className!=="t",enctype:!!i.createElement("form").enctype,html5Clone:i.createElement("nav").cloneNode(!0).outerHTML!=="<:nav></:nav>",boxModel:i.compatMode==="CSS1Compat",submitBubbles:!0,changeBubbles:!0,focusinBubbles:!1,deleteExpando:!0,noCloneEvent:!0,inlineBlockNeedsLayout:!1,shrinkWrapBlocks:!1,reliableMarginRight:!0,boxSizingReliable:!0,pixelPosition:!1},u.checked=!0,t.noCloneChecked=u.cloneNode(!0).checked,s.disabled=!0,t.optDisabled=!o.disabled;try{delete p.test}catch(d){t.deleteExpando=!1}!p.addEventListener&&p.attachEvent&&p.fireEvent&&(p.attachEvent("onclick",h=function(){t.noCloneEvent=!1}),p.cloneNode(!0).fireEvent("onclick"),p.detachEvent("onclick",h)),u=i.createElement("input"),u.value="t",u.setAttribute("type","radio"),t.radioValue=u.value==="t",u.setAttribute("checked","checked"),u.setAttribute("name","t"),p.appendChild(u),a=i.createDocumentFragment(),a.appendChild(p.lastChild),t.checkClone=a.cloneNode(!0).cloneNode(!0).lastChild.checked,t.appendChecked=u.checked,a.removeChild(u),a.appendChild(p);if(p.attachEvent)for(l in{submit:!0,change:!0,focusin:!0})f="on"+l,c=f in p,c||(p.setAttribute(f,"return;"),c=typeof p[f]=="function"),t[l+"Bubbles"]=c;return v(function(){var n,r,s,o,u="padding:0;margin:0;border:0;display:block;overflow:hidden;",a=i.getElementsByTagName("body")[0];if(!a)return;n=i.createElement("div"),n.style.cssText="visibility:hidden;border:0;width:0;height:0;position:static;top:0;margin-top:1px",a.insertBefore(n,a.firstChild),r=i.createElement("div"),n.appendChild(r),r.innerHTML="<table><tr><td></td><td>t</td></tr></table>",s=r.getElementsByTagName("td"),s[0].style.cssText="padding:0;margin:0;border:0;display:none",c=s[0].offsetHeight===0,s[0].style.display="",s[1].style.display="none",t.reliableHiddenOffsets=c&&s[0].offsetHeight===0,r.innerHTML="",r.style.cssText="box-sizing:border-box;-moz-box-sizing:border-box;-webkit-box-sizing:border-box;padding:1px;border:1px;display:block;width:4px;margin-top:1%;position:absolute;top:1%;",t.boxSizing=r.offsetWidth===4,t.doesNotIncludeMarginInBodyOffset=a.offsetTop!==1,e.getComputedStyle&&(t.pixelPosition=(e.getComputedStyle(r,null)||{}).top!=="1%",t.boxSizingReliable=(e.getComputedStyle(r,null)||{width:"4px"}).width==="4px",o=i.createElement("div"),o.style.cssText=r.style.cssText=u,o.style.marginRight=o.style.width="0",r.style.width="1px",r.appendChild(o),t.reliableMarginRight=!parseFloat((e.getComputedStyle(o,null)||{}).marginRight)),typeof r.style.zoom!="undefined"&&(r.innerHTML="",r.style.cssText=u+"width:1px;padding:1px;display:inline;zoom:1",t.inlineBlockNeedsLayout=r.offsetWidth===3,r.style.display="block",r.style.overflow="visible",r.innerHTML="<div></div>",r.firstChild.style.width="5px",t.shrinkWrapBlocks=r.offsetWidth!==3,n.style.zoom=1),a.removeChild(n),n=r=s=o=null}),a.removeChild(p),n=r=s=o=u=a=p=null,t}();var D=/(?:\{[\s\S]*\}|\[[\s\S]*\])$/,P=/([A-Z])/g;v.extend({cache:{},deletedIds:[],uuid:0,expando:"jQuery"+(v.fn.jquery+Math.random()).replace(/\D/g,""),noData:{embed:!0,object:"clsid:D27CDB6E-AE6D-11cf-96B8-444553540000",applet:!0},hasData:function(e){return e=e.nodeType?v.cache[e[v.expando]]:e[v.expando],!!e&&!B(e)},data:function(e,n,r,i){if(!v.acceptData(e))return;var s,o,u=v.expando,a=typeof n=="string",f=e.nodeType,l=f?v.cache:e,c=f?e[u]:e[u]&&u;if((!c||!l[c]||!i&&!l[c].data)&&a&&r===t)return;c||(f?e[u]=c=v.deletedIds.pop()||v.guid++:c=u),l[c]||(l[c]={},f||(l[c].toJSON=v.noop));if(typeof n=="object"||typeof n=="function")i?l[c]=v.extend(l[c],n):l[c].data=v.extend(l[c].data,n);return s=l[c],i||(s.data||(s.data={}),s=s.data),r!==t&&(s[v.camelCase(n)]=r),a?(o=s[n],o==null&&(o=s[v.camelCase(n)])):o=s,o},removeData:function(e,t,n){if(!v.acceptData(e))return;var r,i,s,o=e.nodeType,u=o?v.cache:e,a=o?e[v.expando]:v.expando;if(!u[a])return;if(t){r=n?u[a]:u[a].data;if(r){v.isArray(t)||(t in r?t=[t]:(t=v.camelCase(t),t in r?t=[t]:t=t.split(" ")));for(i=0,s=t.length;i<s;i++)delete r[t[i]];if(!(n?B:v.isEmptyObject)(r))return}}if(!n){delete u[a].data;if(!B(u[a]))return}o?v.cleanData([e],!0):v.support.deleteExpando||u!=u.window?delete u[a]:u[a]=null},_data:function(e,t,n){return v.data(e,t,n,!0)},acceptData:function(e){var t=e.nodeName&&v.noData[e.nodeName.toLowerCase()];return!t||t!==!0&&e.getAttribute("classid")===t}}),v.fn.extend({data:function(e,n){var r,i,s,o,u,a=this[0],f=0,l=null;if(e===t){if(this.length){l=v.data(a);if(a.nodeType===1&&!v._data(a,"parsedAttrs")){s=a.attributes;for(u=s.length;f<u;f++)o=s[f].name,o.indexOf("data-")||(o=v.camelCase(o.substring(5)),H(a,o,l[o]));v._data(a,"parsedAttrs",!0)}}return l}return typeof e=="object"?this.each(function(){v.data(this,e)}):(r=e.split(".",2),r[1]=r[1]?"."+r[1]:"",i=r[1]+"!",v.access(this,function(n){if(n===t)return l=this.triggerHandler("getData"+i,[r[0]]),l===t&&a&&(l=v.data(a,e),l=H(a,e,l)),l===t&&r[1]?this.data(r[0]):l;r[1]=n,this.each(function(){var t=v(this);t.triggerHandler("setData"+i,r),v.data(this,e,n),t.triggerHandler("changeData"+i,r)})},null,n,arguments.length>1,null,!1))},removeData:function(e){return this.each(function(){v.removeData(this,e)})}}),v.extend({queue:function(e,t,n){var r;if(e)return t=(t||"fx")+"queue",r=v._data(e,t),n&&(!r||v.isArray(n)?r=v._data(e,t,v.makeArray(n)):r.push(n)),r||[]},dequeue:function(e,t){t=t||"fx";var n=v.queue(e,t),r=n.length,i=n.shift(),s=v._queueHooks(e,t),o=function(){v.dequeue(e,t)};i==="inprogress"&&(i=n.shift(),r--),i&&(t==="fx"&&n.unshift("inprogress"),delete s.stop,i.call(e,o,s)),!r&&s&&s.empty.fire()},_queueHooks:function(e,t){var n=t+"queueHooks";return v._data(e,n)||v._data(e,n,{empty:v.Callbacks("once memory").add(function(){v.removeData(e,t+"queue",!0),v.removeData(e,n,!0)})})}}),v.fn.extend({queue:function(e,n){var r=2;return typeof e!="string"&&(n=e,e="fx",r--),arguments.length<r?v.queue(this[0],e):n===t?this:this.each(function(){var t=v.queue(this,e,n);v._queueHooks(this,e),e==="fx"&&t[0]!=="inprogress"&&v.dequeue(this,e)})},dequeue:function(e){return this.each(function(){v.dequeue(this,e)})},delay:function(e,t){return e=v.fx?v.fx.speeds[e]||e:e,t=t||"fx",this.queue(t,function(t,n){var r=setTimeout(t,e);n.stop=function(){clearTimeout(r)}})},clearQueue:function(e){return this.queue(e||"fx",[])},promise:function(e,n){var r,i=1,s=v.Deferred(),o=this,u=this.length,a=function(){--i||s.resolveWith(o,[o])};typeof e!="string"&&(n=e,e=t),e=e||"fx";while(u--)r=v._data(o[u],e+"queueHooks"),r&&r.empty&&(i++,r.empty.add(a));return a(),s.promise(n)}});var j,F,I,q=/[\t\r\n]/g,R=/\r/g,U=/^(?:button|input)$/i,z=/^(?:button|input|object|select|textarea)$/i,W=/^a(?:rea|)$/i,X=/^(?:autofocus|autoplay|async|checked|controls|defer|disabled|hidden|loop|multiple|open|readonly|required|scoped|selected)$/i,V=v.support.getSetAttribute;v.fn.extend({attr:function(e,t){return v.access(this,v.attr,e,t,arguments.length>1)},removeAttr:function(e){return this.each(function(){v.removeAttr(this,e)})},prop:function(e,t){return v.access(this,v.prop,e,t,arguments.length>1)},removeProp:function(e){return e=v.propFix[e]||e,this.each(function(){try{this[e]=t,delete this[e]}catch(n){}})},addClass:function(e){var t,n,r,i,s,o,u;if(v.isFunction(e))return this.each(function(t){v(this).addClass(e.call(this,t,this.className))});if(e&&typeof e=="string"){t=e.split(y);for(n=0,r=this.length;n<r;n++){i=this[n];if(i.nodeType===1)if(!i.className&&t.length===1)i.className=e;else{s=" "+i.className+" ";for(o=0,u=t.length;o<u;o++)s.indexOf(" "+t[o]+" ")<0&&(s+=t[o]+" ");i.className=v.trim(s)}}}return this},removeClass:function(e){var n,r,i,s,o,u,a;if(v.isFunction(e))return this.each(function(t){v(this).removeClass(e.call(this,t,this.className))});if(e&&typeof e=="string"||e===t){n=(e||"").split(y);for(u=0,a=this.length;u<a;u++){i=this[u];if(i.nodeType===1&&i.className){r=(" "+i.className+" ").replace(q," ");for(s=0,o=n.length;s<o;s++)while(r.indexOf(" "+n[s]+" ")>=0)r=r.replace(" "+n[s]+" "," ");i.className=e?v.trim(r):""}}}return this},toggleClass:function(e,t){var n=typeof e,r=typeof t=="boolean";return v.isFunction(e)?this.each(function(n){v(this).toggleClass(e.call(this,n,this.className,t),t)}):this.each(function(){if(n==="string"){var i,s=0,o=v(this),u=t,a=e.split(y);while(i=a[s++])u=r?u:!o.hasClass(i),o[u?"addClass":"removeClass"](i)}else if(n==="undefined"||n==="boolean")this.className&&v._data(this,"__className__",this.className),this.className=this.className||e===!1?"":v._data(this,"__className__")||""})},hasClass:function(e){var t=" "+e+" ",n=0,r=this.length;for(;n<r;n++)if(this[n].nodeType===1&&(" "+this[n].className+" ").replace(q," ").indexOf(t)>=0)return!0;return!1},val:function(e){var n,r,i,s=this[0];if(!arguments.length){if(s)return n=v.valHooks[s.type]||v.valHooks[s.nodeName.toLowerCase()],n&&"get"in n&&(r=n.get(s,"value"))!==t?r:(r=s.value,typeof r=="string"?r.replace(R,""):r==null?"":r);return}return i=v.isFunction(e),this.each(function(r){var s,o=v(this);if(this.nodeType!==1)return;i?s=e.call(this,r,o.val()):s=e,s==null?s="":typeof s=="number"?s+="":v.isArray(s)&&(s=v.map(s,function(e){return e==null?"":e+""})),n=v.valHooks[this.type]||v.valHooks[this.nodeName.toLowerCase()];if(!n||!("set"in n)||n.set(this,s,"value")===t)this.value=s})}}),v.extend({valHooks:{option:{get:function(e){var t=e.attributes.value;return!t||t.specified?e.value:e.text}},select:{get:function(e){var t,n,r=e.options,i=e.selectedIndex,s=e.type==="select-one"||i<0,o=s?null:[],u=s?i+1:r.length,a=i<0?u:s?i:0;for(;a<u;a++){n=r[a];if((n.selected||a===i)&&(v.support.optDisabled?!n.disabled:n.getAttribute("disabled")===null)&&(!n.parentNode.disabled||!v.nodeName(n.parentNode,"optgroup"))){t=v(n).val();if(s)return t;o.push(t)}}return o},set:function(e,t){var n=v.makeArray(t);return v(e).find("option").each(function(){this.selected=v.inArray(v(this).val(),n)>=0}),n.length||(e.selectedIndex=-1),n}}},attrFn:{},attr:function(e,n,r,i){var s,o,u,a=e.nodeType;if(!e||a===3||a===8||a===2)return;if(i&&v.isFunction(v.fn[n]))return v(e)[n](r);if(typeof e.getAttribute=="undefined")return v.prop(e,n,r);u=a!==1||!v.isXMLDoc(e),u&&(n=n.toLowerCase(),o=v.attrHooks[n]||(X.test(n)?F:j));if(r!==t){if(r===null){v.removeAttr(e,n);return}return o&&"set"in o&&u&&(s=o.set(e,r,n))!==t?s:(e.setAttribute(n,r+""),r)}return o&&"get"in o&&u&&(s=o.get(e,n))!==null?s:(s=e.getAttribute(n),s===null?t:s)},removeAttr:function(e,t){var n,r,i,s,o=0;if(t&&e.nodeType===1){r=t.split(y);for(;o<r.length;o++)i=r[o],i&&(n=v.propFix[i]||i,s=X.test(i),s||v.attr(e,i,""),e.removeAttribute(V?i:n),s&&n in e&&(e[n]=!1))}},attrHooks:{type:{set:function(e,t){if(U.test(e.nodeName)&&e.parentNode)v.error("type property can't be changed");else if(!v.support.radioValue&&t==="radio"&&v.nodeName(e,"input")){var n=e.value;return e.setAttribute("type",t),n&&(e.value=n),t}}},value:{get:function(e,t){return j&&v.nodeName(e,"button")?j.get(e,t):t in e?e.value:null},set:function(e,t,n){if(j&&v.nodeName(e,"button"))return j.set(e,t,n);e.value=t}}},propFix:{tabindex:"tabIndex",readonly:"readOnly","for":"htmlFor","class":"className",maxlength:"maxLength",cellspacing:"cellSpacing",cellpadding:"cellPadding",rowspan:"rowSpan",colspan:"colSpan",usemap:"useMap",frameborder:"frameBorder",contenteditable:"contentEditable"},prop:function(e,n,r){var i,s,o,u=e.nodeType;if(!e||u===3||u===8||u===2)return;return o=u!==1||!v.isXMLDoc(e),o&&(n=v.propFix[n]||n,s=v.propHooks[n]),r!==t?s&&"set"in s&&(i=s.set(e,r,n))!==t?i:e[n]=r:s&&"get"in s&&(i=s.get(e,n))!==null?i:e[n]},propHooks:{tabIndex:{get:function(e){var n=e.getAttributeNode("tabindex");return n&&n.specified?parseInt(n.value,10):z.test(e.nodeName)||W.test(e.nodeName)&&e.href?0:t}}}}),F={get:function(e,n){var r,i=v.prop(e,n);return i===!0||typeof i!="boolean"&&(r=e.getAttributeNode(n))&&r.nodeValue!==!1?n.toLowerCase():t},set:function(e,t,n){var r;return t===!1?v.removeAttr(e,n):(r=v.propFix[n]||n,r in e&&(e[r]=!0),e.setAttribute(n,n.toLowerCase())),n}},V||(I={name:!0,id:!0,coords:!0},j=v.valHooks.button={get:function(e,n){var r;return r=e.getAttributeNode(n),r&&(I[n]?r.value!=="":r.specified)?r.value:t},set:function(e,t,n){var r=e.getAttributeNode(n);return r||(r=i.createAttribute(n),e.setAttributeNode(r)),r.value=t+""}},v.each(["width","height"],function(e,t){v.attrHooks[t]=v.extend(v.attrHooks[t],{set:function(e,n){if(n==="")return e.setAttribute(t,"auto"),n}})}),v.attrHooks.contenteditable={get:j.get,set:function(e,t,n){t===""&&(t="false"),j.set(e,t,n)}}),v.support.hrefNormalized||v.each(["href","src","width","height"],function(e,n){v.attrHooks[n]=v.extend(v.attrHooks[n],{get:function(e){var r=e.getAttribute(n,2);return r===null?t:r}})}),v.support.style||(v.attrHooks.style={get:function(e){return e.style.cssText.toLowerCase()||t},set:function(e,t){return e.style.cssText=t+""}}),v.support.optSelected||(v.propHooks.selected=v.extend(v.propHooks.selected,{get:function(e){var t=e.parentNode;return t&&(t.selectedIndex,t.parentNode&&t.parentNode.selectedIndex),null}})),v.support.enctype||(v.propFix.enctype="encoding"),v.support.checkOn||v.each(["radio","checkbox"],function(){v.valHooks[this]={get:function(e){return e.getAttribute("value")===null?"on":e.value}}}),v.each(["radio","checkbox"],function(){v.valHooks[this]=v.extend(v.valHooks[this],{set:function(e,t){if(v.isArray(t))return e.checked=v.inArray(v(e).val(),t)>=0}})});var $=/^(?:textarea|input|select)$/i,J=/^([^\.]*|)(?:\.(.+)|)$/,K=/(?:^|\s)hover(\.\S+|)\b/,Q=/^key/,G=/^(?:mouse|contextmenu)|click/,Y=/^(?:focusinfocus|focusoutblur)$/,Z=function(e){return v.event.special.hover?e:e.replace(K,"mouseenter$1 mouseleave$1")};v.event={add:function(e,n,r,i,s){var o,u,a,f,l,c,h,p,d,m,g;if(e.nodeType===3||e.nodeType===8||!n||!r||!(o=v._data(e)))return;r.handler&&(d=r,r=d.handler,s=d.selector),r.guid||(r.guid=v.guid++),a=o.events,a||(o.events=a={}),u=o.handle,u||(o.handle=u=function(e){return typeof v=="undefined"||!!e&&v.event.triggered===e.type?t:v.event.dispatch.apply(u.elem,arguments)},u.elem=e),n=v.trim(Z(n)).split(" ");for(f=0;f<n.length;f++){l=J.exec(n[f])||[],c=l[1],h=(l[2]||"").split(".").sort(),g=v.event.special[c]||{},c=(s?g.delegateType:g.bindType)||c,g=v.event.special[c]||{},p=v.extend({type:c,origType:l[1],data:i,handler:r,guid:r.guid,selector:s,needsContext:s&&v.expr.match.needsContext.test(s),namespace:h.join(".")},d),m=a[c];if(!m){m=a[c]=[],m.delegateCount=0;if(!g.setup||g.setup.call(e,i,h,u)===!1)e.addEventListener?e.addEventListener(c,u,!1):e.attachEvent&&e.attachEvent("on"+c,u)}g.add&&(g.add.call(e,p),p.handler.guid||(p.handler.guid=r.guid)),s?m.splice(m.delegateCount++,0,p):m.push(p),v.event.global[c]=!0}e=null},global:{},remove:function(e,t,n,r,i){var s,o,u,a,f,l,c,h,p,d,m,g=v.hasData(e)&&v._data(e);if(!g||!(h=g.events))return;t=v.trim(Z(t||"")).split(" ");for(s=0;s<t.length;s++){o=J.exec(t[s])||[],u=a=o[1],f=o[2];if(!u){for(u in h)v.event.remove(e,u+t[s],n,r,!0);continue}p=v.event.special[u]||{},u=(r?p.delegateType:p.bindType)||u,d=h[u]||[],l=d.length,f=f?new RegExp("(^|\\.)"+f.split(".").sort().join("\\.(?:.*\\.|)")+"(\\.|$)"):null;for(c=0;c<d.length;c++)m=d[c],(i||a===m.origType)&&(!n||n.guid===m.guid)&&(!f||f.test(m.namespace))&&(!r||r===m.selector||r==="**"&&m.selector)&&(d.splice(c--,1),m.selector&&d.delegateCount--,p.remove&&p.remove.call(e,m));d.length===0&&l!==d.length&&((!p.teardown||p.teardown.call(e,f,g.handle)===!1)&&v.removeEvent(e,u,g.handle),delete h[u])}v.isEmptyObject(h)&&(delete g.handle,v.removeData(e,"events",!0))},customEvent:{getData:!0,setData:!0,changeData:!0},trigger:function(n,r,s,o){if(!s||s.nodeType!==3&&s.nodeType!==8){var u,a,f,l,c,h,p,d,m,g,y=n.type||n,b=[];if(Y.test(y+v.event.triggered))return;y.indexOf("!")>=0&&(y=y.slice(0,-1),a=!0),y.indexOf(".")>=0&&(b=y.split("."),y=b.shift(),b.sort());if((!s||v.event.customEvent[y])&&!v.event.global[y])return;n=typeof n=="object"?n[v.expando]?n:new v.Event(y,n):new v.Event(y),n.type=y,n.isTrigger=!0,n.exclusive=a,n.namespace=b.join("."),n.namespace_re=n.namespace?new RegExp("(^|\\.)"+b.join("\\.(?:.*\\.|)")+"(\\.|$)"):null,h=y.indexOf(":")<0?"on"+y:"";if(!s){u=v.cache;for(f in u)u[f].events&&u[f].events[y]&&v.event.trigger(n,r,u[f].handle.elem,!0);return}n.result=t,n.target||(n.target=s),r=r!=null?v.makeArray(r):[],r.unshift(n),p=v.event.special[y]||{};if(p.trigger&&p.trigger.apply(s,r)===!1)return;m=[[s,p.bindType||y]];if(!o&&!p.noBubble&&!v.isWindow(s)){g=p.delegateType||y,l=Y.test(g+y)?s:s.parentNode;for(c=s;l;l=l.parentNode)m.push([l,g]),c=l;c===(s.ownerDocument||i)&&m.push([c.defaultView||c.parentWindow||e,g])}for(f=0;f<m.length&&!n.isPropagationStopped();f++)l=m[f][0],n.type=m[f][1],d=(v._data(l,"events")||{})[n.type]&&v._data(l,"handle"),d&&d.apply(l,r),d=h&&l[h],d&&v.acceptData(l)&&d.apply&&d.apply(l,r)===!1&&n.preventDefault();return n.type=y,!o&&!n.isDefaultPrevented()&&(!p._default||p._default.apply(s.ownerDocument,r)===!1)&&(y!=="click"||!v.nodeName(s,"a"))&&v.acceptData(s)&&h&&s[y]&&(y!=="focus"&&y!=="blur"||n.target.offsetWidth!==0)&&!v.isWindow(s)&&(c=s[h],c&&(s[h]=null),v.event.triggered=y,s[y](),v.event.triggered=t,c&&(s[h]=c)),n.result}return},dispatch:function(n){n=v.event.fix(n||e.event);var r,i,s,o,u,a,f,c,h,p,d=(v._data(this,"events")||{})[n.type]||[],m=d.delegateCount,g=l.call(arguments),y=!n.exclusive&&!n.namespace,b=v.event.special[n.type]||{},w=[];g[0]=n,n.delegateTarget=this;if(b.preDispatch&&b.preDispatch.call(this,n)===!1)return;if(m&&(!n.button||n.type!=="click"))for(s=n.target;s!=this;s=s.parentNode||this)if(s.disabled!==!0||n.type!=="click"){u={},f=[];for(r=0;r<m;r++)c=d[r],h=c.selector,u[h]===t&&(u[h]=c.needsContext?v(h,this).index(s)>=0:v.find(h,this,null,[s]).length),u[h]&&f.push(c);f.length&&w.push({elem:s,matches:f})}d.length>m&&w.push({elem:this,matches:d.slice(m)});for(r=0;r<w.length&&!n.isPropagationStopped();r++){a=w[r],n.currentTarget=a.elem;for(i=0;i<a.matches.length&&!n.isImmediatePropagationStopped();i++){c=a.matches[i];if(y||!n.namespace&&!c.namespace||n.namespace_re&&n.namespace_re.test(c.namespace))n.data=c.data,n.handleObj=c,o=((v.event.special[c.origType]||{}).handle||c.handler).apply(a.elem,g),o!==t&&(n.result=o,o===!1&&(n.preventDefault(),n.stopPropagation()))}}return b.postDispatch&&b.postDispatch.call(this,n),n.result},props:"attrChange attrName relatedNode srcElement altKey bubbles cancelable ctrlKey currentTarget eventPhase metaKey relatedTarget shiftKey target timeStamp view which".split(" "),fixHooks:{},keyHooks:{props:"char charCode key keyCode".split(" "),filter:function(e,t){return e.which==null&&(e.which=t.charCode!=null?t.charCode:t.keyCode),e}},mouseHooks:{props:"button buttons clientX clientY fromElement offsetX offsetY pageX pageY screenX screenY toElement".split(" "),filter:function(e,n){var r,s,o,u=n.button,a=n.fromElement;return e.pageX==null&&n.clientX!=null&&(r=e.target.ownerDocument||i,s=r.documentElement,o=r.body,e.pageX=n.clientX+(s&&s.scrollLeft||o&&o.scrollLeft||0)-(s&&s.clientLeft||o&&o.clientLeft||0),e.pageY=n.clientY+(s&&s.scrollTop||o&&o.scrollTop||0)-(s&&s.clientTop||o&&o.clientTop||0)),!e.relatedTarget&&a&&(e.relatedTarget=a===e.target?n.toElement:a),!e.which&&u!==t&&(e.which=u&1?1:u&2?3:u&4?2:0),e}},fix:function(e){if(e[v.expando])return e;var t,n,r=e,s=v.event.fixHooks[e.type]||{},o=s.props?this.props.concat(s.props):this.props;e=v.Event(r);for(t=o.length;t;)n=o[--t],e[n]=r[n];return e.target||(e.target=r.srcElement||i),e.target.nodeType===3&&(e.target=e.target.parentNode),e.metaKey=!!e.metaKey,s.filter?s.filter(e,r):e},special:{load:{noBubble:!0},focus:{delegateType:"focusin"},blur:{delegateType:"focusout"},beforeunload:{setup:function(e,t,n){v.isWindow(this)&&(this.onbeforeunload=n)},teardown:function(e,t){this.onbeforeunload===t&&(this.onbeforeunload=null)}}},simulate:function(e,t,n,r){var i=v.extend(new v.Event,n,{type:e,isSimulated:!0,originalEvent:{}});r?v.event.trigger(i,null,t):v.event.dispatch.call(t,i),i.isDefaultPrevented()&&n.preventDefault()}},v.event.handle=v.event.dispatch,v.removeEvent=i.removeEventListener?function(e,t,n){e.removeEventListener&&e.removeEventListener(t,n,!1)}:function(e,t,n){var r="on"+t;e.detachEvent&&(typeof e[r]=="undefined"&&(e[r]=null),e.detachEvent(r,n))},v.Event=function(e,t){if(!(this instanceof v.Event))return new v.Event(e,t);e&&e.type?(this.originalEvent=e,this.type=e.type,this.isDefaultPrevented=e.defaultPrevented||e.returnValue===!1||e.getPreventDefault&&e.getPreventDefault()?tt:et):this.type=e,t&&v.extend(this,t),this.timeStamp=e&&e.timeStamp||v.now(),this[v.expando]=!0},v.Event.prototype={preventDefault:function(){this.isDefaultPrevented=tt;var e=this.originalEvent;if(!e)return;e.preventDefault?e.preventDefault():e.returnValue=!1},stopPropagation:function(){this.isPropagationStopped=tt;var e=this.originalEvent;if(!e)return;e.stopPropagation&&e.stopPropagation(),e.cancelBubble=!0},stopImmediatePropagation:function(){this.isImmediatePropagationStopped=tt,this.stopPropagation()},isDefaultPrevented:et,isPropagationStopped:et,isImmediatePropagationStopped:et},v.each({mouseenter:"mouseover",mouseleave:"mouseout"},function(e,t){v.event.special[e]={delegateType:t,bindType:t,handle:function(e){var n,r=this,i=e.relatedTarget,s=e.handleObj,o=s.selector;if(!i||i!==r&&!v.contains(r,i))e.type=s.origType,n=s.handler.apply(this,arguments),e.type=t;return n}}}),v.support.submitBubbles||(v.event.special.submit={setup:function(){if(v.nodeName(this,"form"))return!1;v.event.add(this,"click._submit keypress._submit",function(e){var n=e.target,r=v.nodeName(n,"input")||v.nodeName(n,"button")?n.form:t;r&&!v._data(r,"_submit_attached")&&(v.event.add(r,"submit._submit",function(e){e._submit_bubble=!0}),v._data(r,"_submit_attached",!0))})},postDispatch:function(e){e._submit_bubble&&(delete e._submit_bubble,this.parentNode&&!e.isTrigger&&v.event.simulate("submit",this.parentNode,e,!0))},teardown:function(){if(v.nodeName(this,"form"))return!1;v.event.remove(this,"._submit")}}),v.support.changeBubbles||(v.event.special.change={setup:function(){if($.test(this.nodeName)){if(this.type==="checkbox"||this.type==="radio")v.event.add(this,"propertychange._change",function(e){e.originalEvent.propertyName==="checked"&&(this._just_changed=!0)}),v.event.add(this,"click._change",function(e){this._just_changed&&!e.isTrigger&&(this._just_changed=!1),v.event.simulate("change",this,e,!0)});return!1}v.event.add(this,"beforeactivate._change",function(e){var t=e.target;$.test(t.nodeName)&&!v._data(t,"_change_attached")&&(v.event.add(t,"change._change",function(e){this.parentNode&&!e.isSimulated&&!e.isTrigger&&v.event.simulate("change",this.parentNode,e,!0)}),v._data(t,"_change_attached",!0))})},handle:function(e){var t=e.target;if(this!==t||e.isSimulated||e.isTrigger||t.type!=="radio"&&t.type!=="checkbox")return e.handleObj.handler.apply(this,arguments)},teardown:function(){return v.event.remove(this,"._change"),!$.test(this.nodeName)}}),v.support.focusinBubbles||v.each({focus:"focusin",blur:"focusout"},function(e,t){var n=0,r=function(e){v.event.simulate(t,e.target,v.event.fix(e),!0)};v.event.special[t]={setup:function(){n++===0&&i.addEventListener(e,r,!0)},teardown:function(){--n===0&&i.removeEventListener(e,r,!0)}}}),v.fn.extend({on:function(e,n,r,i,s){var o,u;if(typeof e=="object"){typeof n!="string"&&(r=r||n,n=t);for(u in e)this.on(u,n,r,e[u],s);return this}r==null&&i==null?(i=n,r=n=t):i==null&&(typeof n=="string"?(i=r,r=t):(i=r,r=n,n=t));if(i===!1)i=et;else if(!i)return this;return s===1&&(o=i,i=function(e){return v().off(e),o.apply(this,arguments)},i.guid=o.guid||(o.guid=v.guid++)),this.each(function(){v.event.add(this,e,i,r,n)})},one:function(e,t,n,r){return this.on(e,t,n,r,1)},off:function(e,n,r){var i,s;if(e&&e.preventDefault&&e.handleObj)return i=e.handleObj,v(e.delegateTarget).off(i.namespace?i.origType+"."+i.namespace:i.origType,i.selector,i.handler),this;if(typeof e=="object"){for(s in e)this.off(s,n,e[s]);return this}if(n===!1||typeof n=="function")r=n,n=t;return r===!1&&(r=et),this.each(function(){v.event.remove(this,e,r,n)})},bind:function(e,t,n){return this.on(e,null,t,n)},unbind:function(e,t){return this.off(e,null,t)},live:function(e,t,n){return v(this.context).on(e,this.selector,t,n),this},die:function(e,t){return v(this.context).off(e,this.selector||"**",t),this},delegate:function(e,t,n,r){return this.on(t,e,n,r)},undelegate:function(e,t,n){return arguments.length===1?this.off(e,"**"):this.off(t,e||"**",n)},trigger:function(e,t){return this.each(function(){v.event.trigger(e,t,this)})},triggerHandler:function(e,t){if(this[0])return v.event.trigger(e,t,this[0],!0)},toggle:function(e){var t=arguments,n=e.guid||v.guid++,r=0,i=function(n){var i=(v._data(this,"lastToggle"+e.guid)||0)%r;return v._data(this,"lastToggle"+e.guid,i+1),n.preventDefault(),t[i].apply(this,arguments)||!1};i.guid=n;while(r<t.length)t[r++].guid=n;return this.click(i)},hover:function(e,t){return this.mouseenter(e).mouseleave(t||e)}}),v.each("blur focus focusin focusout load resize scroll unload click dblclick mousedown mouseup mousemove mouseover mouseout mouseenter mouseleave change select submit keydown keypress keyup error contextmenu".split(" "),function(e,t){v.fn[t]=function(e,n){return n==null&&(n=e,e=null),arguments.length>0?this.on(t,null,e,n):this.trigger(t)},Q.test(t)&&(v.event.fixHooks[t]=v.event.keyHooks),G.test(t)&&(v.event.fixHooks[t]=v.event.mouseHooks)}),function(e,t){function nt(e,t,n,r){n=n||[],t=t||g;var i,s,a,f,l=t.nodeType;if(!e||typeof e!="string")return n;if(l!==1&&l!==9)return[];a=o(t);if(!a&&!r)if(i=R.exec(e))if(f=i[1]){if(l===9){s=t.getElementById(f);if(!s||!s.parentNode)return n;if(s.id===f)return n.push(s),n}else if(t.ownerDocument&&(s=t.ownerDocument.getElementById(f))&&u(t,s)&&s.id===f)return n.push(s),n}else{if(i[2])return S.apply(n,x.call(t.getElementsByTagName(e),0)),n;if((f=i[3])&&Z&&t.getElementsByClassName)return S.apply(n,x.call(t.getElementsByClassName(f),0)),n}return vt(e.replace(j,"$1"),t,n,r,a)}function rt(e){return function(t){var n=t.nodeName.toLowerCase();return n==="input"&&t.type===e}}function it(e){return function(t){var n=t.nodeName.toLowerCase();return(n==="input"||n==="button")&&t.type===e}}function st(e){return N(function(t){return t=+t,N(function(n,r){var i,s=e([],n.length,t),o=s.length;while(o--)n[i=s[o]]&&(n[i]=!(r[i]=n[i]))})})}function ot(e,t,n){if(e===t)return n;var r=e.nextSibling;while(r){if(r===t)return-1;r=r.nextSibling}return 1}function ut(e,t){var n,r,s,o,u,a,f,l=L[d][e+" "];if(l)return t?0:l.slice(0);u=e,a=[],f=i.preFilter;while(u){if(!n||(r=F.exec(u)))r&&(u=u.slice(r[0].length)||u),a.push(s=[]);n=!1;if(r=I.exec(u))s.push(n=new m(r.shift())),u=u.slice(n.length),n.type=r[0].replace(j," ");for(o in i.filter)(r=J[o].exec(u))&&(!f[o]||(r=f[o](r)))&&(s.push(n=new m(r.shift())),u=u.slice(n.length),n.type=o,n.matches=r);if(!n)break}return t?u.length:u?nt.error(e):L(e,a).slice(0)}function at(e,t,r){var i=t.dir,s=r&&t.dir==="parentNode",o=w++;return t.first?function(t,n,r){while(t=t[i])if(s||t.nodeType===1)return e(t,n,r)}:function(t,r,u){if(!u){var a,f=b+" "+o+" ",l=f+n;while(t=t[i])if(s||t.nodeType===1){if((a=t[d])===l)return t.sizset;if(typeof a=="string"&&a.indexOf(f)===0){if(t.sizset)return t}else{t[d]=l;if(e(t,r,u))return t.sizset=!0,t;t.sizset=!1}}}else while(t=t[i])if(s||t.nodeType===1)if(e(t,r,u))return t}}function ft(e){return e.length>1?function(t,n,r){var i=e.length;while(i--)if(!e[i](t,n,r))return!1;return!0}:e[0]}function lt(e,t,n,r,i){var s,o=[],u=0,a=e.length,f=t!=null;for(;u<a;u++)if(s=e[u])if(!n||n(s,r,i))o.push(s),f&&t.push(u);return o}function ct(e,t,n,r,i,s){return r&&!r[d]&&(r=ct(r)),i&&!i[d]&&(i=ct(i,s)),N(function(s,o,u,a){var f,l,c,h=[],p=[],d=o.length,v=s||dt(t||"*",u.nodeType?[u]:u,[]),m=e&&(s||!t)?lt(v,h,e,u,a):v,g=n?i||(s?e:d||r)?[]:o:m;n&&n(m,g,u,a);if(r){f=lt(g,p),r(f,[],u,a),l=f.length;while(l--)if(c=f[l])g[p[l]]=!(m[p[l]]=c)}if(s){if(i||e){if(i){f=[],l=g.length;while(l--)(c=g[l])&&f.push(m[l]=c);i(null,g=[],f,a)}l=g.length;while(l--)(c=g[l])&&(f=i?T.call(s,c):h[l])>-1&&(s[f]=!(o[f]=c))}}else g=lt(g===o?g.splice(d,g.length):g),i?i(null,o,g,a):S.apply(o,g)})}function ht(e){var t,n,r,s=e.length,o=i.relative[e[0].type],u=o||i.relative[" "],a=o?1:0,f=at(function(e){return e===t},u,!0),l=at(function(e){return T.call(t,e)>-1},u,!0),h=[function(e,n,r){return!o&&(r||n!==c)||((t=n).nodeType?f(e,n,r):l(e,n,r))}];for(;a<s;a++)if(n=i.relative[e[a].type])h=[at(ft(h),n)];else{n=i.filter[e[a].type].apply(null,e[a].matches);if(n[d]){r=++a;for(;r<s;r++)if(i.relative[e[r].type])break;return ct(a>1&&ft(h),a>1&&e.slice(0,a-1).join("").replace(j,"$1"),n,a<r&&ht(e.slice(a,r)),r<s&&ht(e=e.slice(r)),r<s&&e.join(""))}h.push(n)}return ft(h)}function pt(e,t){var r=t.length>0,s=e.length>0,o=function(u,a,f,l,h){var p,d,v,m=[],y=0,w="0",x=u&&[],T=h!=null,N=c,C=u||s&&i.find.TAG("*",h&&a.parentNode||a),k=b+=N==null?1:Math.E;T&&(c=a!==g&&a,n=o.el);for(;(p=C[w])!=null;w++){if(s&&p){for(d=0;v=e[d];d++)if(v(p,a,f)){l.push(p);break}T&&(b=k,n=++o.el)}r&&((p=!v&&p)&&y--,u&&x.push(p))}y+=w;if(r&&w!==y){for(d=0;v=t[d];d++)v(x,m,a,f);if(u){if(y>0)while(w--)!x[w]&&!m[w]&&(m[w]=E.call(l));m=lt(m)}S.apply(l,m),T&&!u&&m.length>0&&y+t.length>1&&nt.uniqueSort(l)}return T&&(b=k,c=N),x};return o.el=0,r?N(o):o}function dt(e,t,n){var r=0,i=t.length;for(;r<i;r++)nt(e,t[r],n);return n}function vt(e,t,n,r,s){var o,u,f,l,c,h=ut(e),p=h.length;if(!r&&h.length===1){u=h[0]=h[0].slice(0);if(u.length>2&&(f=u[0]).type==="ID"&&t.nodeType===9&&!s&&i.relative[u[1].type]){t=i.find.ID(f.matches[0].replace($,""),t,s)[0];if(!t)return n;e=e.slice(u.shift().length)}for(o=J.POS.test(e)?-1:u.length-1;o>=0;o--){f=u[o];if(i.relative[l=f.type])break;if(c=i.find[l])if(r=c(f.matches[0].replace($,""),z.test(u[0].type)&&t.parentNode||t,s)){u.splice(o,1),e=r.length&&u.join("");if(!e)return S.apply(n,x.call(r,0)),n;break}}}return a(e,h)(r,t,s,n,z.test(e)),n}function mt(){}var n,r,i,s,o,u,a,f,l,c,h=!0,p="undefined",d=("sizcache"+Math.random()).replace(".",""),m=String,g=e.document,y=g.documentElement,b=0,w=0,E=[].pop,S=[].push,x=[].slice,T=[].indexOf||function(e){var t=0,n=this.length;for(;t<n;t++)if(this[t]===e)return t;return-1},N=function(e,t){return e[d]=t==null||t,e},C=function(){var e={},t=[];return N(function(n,r){return t.push(n)>i.cacheLength&&delete e[t.shift()],e[n+" "]=r},e)},k=C(),L=C(),A=C(),O="[\\x20\\t\\r\\n\\f]",M="(?:\\\\.|[-\\w]|[^\\x00-\\xa0])+",_=M.replace("w","w#"),D="([*^$|!~]?=)",P="\\["+O+"*("+M+")"+O+"*(?:"+D+O+"*(?:(['\"])((?:\\\\.|[^\\\\])*?)\\3|("+_+")|)|)"+O+"*\\]",H=":("+M+")(?:\\((?:(['\"])((?:\\\\.|[^\\\\])*?)\\2|([^()[\\]]*|(?:(?:"+P+")|[^:]|\\\\.)*|.*))\\)|)",B=":(even|odd|eq|gt|lt|nth|first|last)(?:\\("+O+"*((?:-\\d)?\\d*)"+O+"*\\)|)(?=[^-]|$)",j=new RegExp("^"+O+"+|((?:^|[^\\\\])(?:\\\\.)*)"+O+"+$","g"),F=new RegExp("^"+O+"*,"+O+"*"),I=new RegExp("^"+O+"*([\\x20\\t\\r\\n\\f>+~])"+O+"*"),q=new RegExp(H),R=/^(?:#([\w\-]+)|(\w+)|\.([\w\-]+))$/,U=/^:not/,z=/[\x20\t\r\n\f]*[+~]/,W=/:not\($/,X=/h\d/i,V=/input|select|textarea|button/i,$=/\\(?!\\)/g,J={ID:new RegExp("^#("+M+")"),CLASS:new RegExp("^\\.("+M+")"),NAME:new RegExp("^\\[name=['\"]?("+M+")['\"]?\\]"),TAG:new RegExp("^("+M.replace("w","w*")+")"),ATTR:new RegExp("^"+P),PSEUDO:new RegExp("^"+H),POS:new RegExp(B,"i"),CHILD:new RegExp("^:(only|nth|first|last)-child(?:\\("+O+"*(even|odd|(([+-]|)(\\d*)n|)"+O+"*(?:([+-]|)"+O+"*(\\d+)|))"+O+"*\\)|)","i"),needsContext:new RegExp("^"+O+"*[>+~]|"+B,"i")},K=function(e){var t=g.createElement("div");try{return e(t)}catch(n){return!1}finally{t=null}},Q=K(function(e){return e.appendChild(g.createComment("")),!e.getElementsByTagName("*").length}),G=K(function(e){return e.innerHTML="<a href='#'></a>",e.firstChild&&typeof e.firstChild.getAttribute!==p&&e.firstChild.getAttribute("href")==="#"}),Y=K(function(e){e.innerHTML="<select></select>";var t=typeof e.lastChild.getAttribute("multiple");return t!=="boolean"&&t!=="string"}),Z=K(function(e){return e.innerHTML="<div class='hidden e'></div><div class='hidden'></div>",!e.getElementsByClassName||!e.getElementsByClassName("e").length?!1:(e.lastChild.className="e",e.getElementsByClassName("e").length===2)}),et=K(function(e){e.id=d+0,e.innerHTML="<a name='"+d+"'></a><div name='"+d+"'></div>",y.insertBefore(e,y.firstChild);var t=g.getElementsByName&&g.getElementsByName(d).length===2+g.getElementsByName(d+0).length;return r=!g.getElementById(d),y.removeChild(e),t});try{x.call(y.childNodes,0)[0].nodeType}catch(tt){x=function(e){var t,n=[];for(;t=this[e];e++)n.push(t);return n}}nt.matches=function(e,t){return nt(e,null,null,t)},nt.matchesSelector=function(e,t){return nt(t,null,null,[e]).length>0},s=nt.getText=function(e){var t,n="",r=0,i=e.nodeType;if(i){if(i===1||i===9||i===11){if(typeof e.textContent=="string")return e.textContent;for(e=e.firstChild;e;e=e.nextSibling)n+=s(e)}else if(i===3||i===4)return e.nodeValue}else for(;t=e[r];r++)n+=s(t);return n},o=nt.isXML=function(e){var t=e&&(e.ownerDocument||e).documentElement;return t?t.nodeName!=="HTML":!1},u=nt.contains=y.contains?function(e,t){var n=e.nodeType===9?e.documentElement:e,r=t&&t.parentNode;return e===r||!!(r&&r.nodeType===1&&n.contains&&n.contains(r))}:y.compareDocumentPosition?function(e,t){return t&&!!(e.compareDocumentPosition(t)&16)}:function(e,t){while(t=t.parentNode)if(t===e)return!0;return!1},nt.attr=function(e,t){var n,r=o(e);return r||(t=t.toLowerCase()),(n=i.attrHandle[t])?n(e):r||Y?e.getAttribute(t):(n=e.getAttributeNode(t),n?typeof e[t]=="boolean"?e[t]?t:null:n.specified?n.value:null:null)},i=nt.selectors={cacheLength:50,createPseudo:N,match:J,attrHandle:G?{}:{href:function(e){return e.getAttribute("href",2)},type:function(e){return e.getAttribute("type")}},find:{ID:r?function(e,t,n){if(typeof t.getElementById!==p&&!n){var r=t.getElementById(e);return r&&r.parentNode?[r]:[]}}:function(e,n,r){if(typeof n.getElementById!==p&&!r){var i=n.getElementById(e);return i?i.id===e||typeof i.getAttributeNode!==p&&i.getAttributeNode("id").value===e?[i]:t:[]}},TAG:Q?function(e,t){if(typeof t.getElementsByTagName!==p)return t.getElementsByTagName(e)}:function(e,t){var n=t.getElementsByTagName(e);if(e==="*"){var r,i=[],s=0;for(;r=n[s];s++)r.nodeType===1&&i.push(r);return i}return n},NAME:et&&function(e,t){if(typeof t.getElementsByName!==p)return t.getElementsByName(name)},CLASS:Z&&function(e,t,n){if(typeof t.getElementsByClassName!==p&&!n)return t.getElementsByClassName(e)}},relative:{">":{dir:"parentNode",first:!0}," ":{dir:"parentNode"},"+":{dir:"previousSibling",first:!0},"~":{dir:"previousSibling"}},preFilter:{ATTR:function(e){return e[1]=e[1].replace($,""),e[3]=(e[4]||e[5]||"").replace($,""),e[2]==="~="&&(e[3]=" "+e[3]+" "),e.slice(0,4)},CHILD:function(e){return e[1]=e[1].toLowerCase(),e[1]==="nth"?(e[2]||nt.error(e[0]),e[3]=+(e[3]?e[4]+(e[5]||1):2*(e[2]==="even"||e[2]==="odd")),e[4]=+(e[6]+e[7]||e[2]==="odd")):e[2]&&nt.error(e[0]),e},PSEUDO:function(e){var t,n;if(J.CHILD.test(e[0]))return null;if(e[3])e[2]=e[3];else if(t=e[4])q.test(t)&&(n=ut(t,!0))&&(n=t.indexOf(")",t.length-n)-t.length)&&(t=t.slice(0,n),e[0]=e[0].slice(0,n)),e[2]=t;return e.slice(0,3)}},filter:{ID:r?function(e){return e=e.replace($,""),function(t){return t.getAttribute("id")===e}}:function(e){return e=e.replace($,""),function(t){var n=typeof t.getAttributeNode!==p&&t.getAttributeNode("id");return n&&n.value===e}},TAG:function(e){return e==="*"?function(){return!0}:(e=e.replace($,"").toLowerCase(),function(t){return t.nodeName&&t.nodeName.toLowerCase()===e})},CLASS:function(e){var t=k[d][e+" "];return t||(t=new RegExp("(^|"+O+")"+e+"("+O+"|$)"))&&k(e,function(e){return t.test(e.className||typeof e.getAttribute!==p&&e.getAttribute("class")||"")})},ATTR:function(e,t,n){return function(r,i){var s=nt.attr(r,e);return s==null?t==="!=":t?(s+="",t==="="?s===n:t==="!="?s!==n:t==="^="?n&&s.indexOf(n)===0:t==="*="?n&&s.indexOf(n)>-1:t==="$="?n&&s.substr(s.length-n.length)===n:t==="~="?(" "+s+" ").indexOf(n)>-1:t==="|="?s===n||s.substr(0,n.length+1)===n+"-":!1):!0}},CHILD:function(e,t,n,r){return e==="nth"?function(e){var t,i,s=e.parentNode;if(n===1&&r===0)return!0;if(s){i=0;for(t=s.firstChild;t;t=t.nextSibling)if(t.nodeType===1){i++;if(e===t)break}}return i-=r,i===n||i%n===0&&i/n>=0}:function(t){var n=t;switch(e){case"only":case"first":while(n=n.previousSibling)if(n.nodeType===1)return!1;if(e==="first")return!0;n=t;case"last":while(n=n.nextSibling)if(n.nodeType===1)return!1;return!0}}},PSEUDO:function(e,t){var n,r=i.pseudos[e]||i.setFilters[e.toLowerCase()]||nt.error("unsupported pseudo: "+e);return r[d]?r(t):r.length>1?(n=[e,e,"",t],i.setFilters.hasOwnProperty(e.toLowerCase())?N(function(e,n){var i,s=r(e,t),o=s.length;while(o--)i=T.call(e,s[o]),e[i]=!(n[i]=s[o])}):function(e){return r(e,0,n)}):r}},pseudos:{not:N(function(e){var t=[],n=[],r=a(e.replace(j,"$1"));return r[d]?N(function(e,t,n,i){var s,o=r(e,null,i,[]),u=e.length;while(u--)if(s=o[u])e[u]=!(t[u]=s)}):function(e,i,s){return t[0]=e,r(t,null,s,n),!n.pop()}}),has:N(function(e){return function(t){return nt(e,t).length>0}}),contains:N(function(e){return function(t){return(t.textContent||t.innerText||s(t)).indexOf(e)>-1}}),enabled:function(e){return e.disabled===!1},disabled:function(e){return e.disabled===!0},checked:function(e){var t=e.nodeName.toLowerCase();return t==="input"&&!!e.checked||t==="option"&&!!e.selected},selected:function(e){return e.parentNode&&e.parentNode.selectedIndex,e.selected===!0},parent:function(e){return!i.pseudos.empty(e)},empty:function(e){var t;e=e.firstChild;while(e){if(e.nodeName>"@"||(t=e.nodeType)===3||t===4)return!1;e=e.nextSibling}return!0},header:function(e){return X.test(e.nodeName)},text:function(e){var t,n;return e.nodeName.toLowerCase()==="input"&&(t=e.type)==="text"&&((n=e.getAttribute("type"))==null||n.toLowerCase()===t)},radio:rt("radio"),checkbox:rt("checkbox"),file:rt("file"),password:rt("password"),image:rt("image"),submit:it("submit"),reset:it("reset"),button:function(e){var t=e.nodeName.toLowerCase();return t==="input"&&e.type==="button"||t==="button"},input:function(e){return V.test(e.nodeName)},focus:function(e){var t=e.ownerDocument;return e===t.activeElement&&(!t.hasFocus||t.hasFocus())&&!!(e.type||e.href||~e.tabIndex)},active:function(e){return e===e.ownerDocument.activeElement},first:st(function(){return[0]}),last:st(function(e,t){return[t-1]}),eq:st(function(e,t,n){return[n<0?n+t:n]}),even:st(function(e,t){for(var n=0;n<t;n+=2)e.push(n);return e}),odd:st(function(e,t){for(var n=1;n<t;n+=2)e.push(n);return e}),lt:st(function(e,t,n){for(var r=n<0?n+t:n;--r>=0;)e.push(r);return e}),gt:st(function(e,t,n){for(var r=n<0?n+t:n;++r<t;)e.push(r);return e})}},f=y.compareDocumentPosition?function(e,t){return e===t?(l=!0,0):(!e.compareDocumentPosition||!t.compareDocumentPosition?e.compareDocumentPosition:e.compareDocumentPosition(t)&4)?-1:1}:function(e,t){if(e===t)return l=!0,0;if(e.sourceIndex&&t.sourceIndex)return e.sourceIndex-t.sourceIndex;var n,r,i=[],s=[],o=e.parentNode,u=t.parentNode,a=o;if(o===u)return ot(e,t);if(!o)return-1;if(!u)return 1;while(a)i.unshift(a),a=a.parentNode;a=u;while(a)s.unshift(a),a=a.parentNode;n=i.length,r=s.length;for(var f=0;f<n&&f<r;f++)if(i[f]!==s[f])return ot(i[f],s[f]);return f===n?ot(e,s[f],-1):ot(i[f],t,1)},[0,0].sort(f),h=!l,nt.uniqueSort=function(e){var t,n=[],r=1,i=0;l=h,e.sort(f);if(l){for(;t=e[r];r++)t===e[r-1]&&(i=n.push(r));while(i--)e.splice(n[i],1)}return e},nt.error=function(e){throw new Error("Syntax error, unrecognized expression: "+e)},a=nt.compile=function(e,t){var n,r=[],i=[],s=A[d][e+" "];if(!s){t||(t=ut(e)),n=t.length;while(n--)s=ht(t[n]),s[d]?r.push(s):i.push(s);s=A(e,pt(i,r))}return s},g.querySelectorAll&&function(){var e,t=vt,n=/'|\\/g,r=/\=[\x20\t\r\n\f]*([^'"\]]*)[\x20\t\r\n\f]*\]/g,i=[":focus"],s=[":active"],u=y.matchesSelector||y.mozMatchesSelector||y.webkitMatchesSelector||y.oMatchesSelector||y.msMatchesSelector;K(function(e){e.innerHTML="<select><option selected=''></option></select>",e.querySelectorAll("[selected]").length||i.push("\\["+O+"*(?:checked|disabled|ismap|multiple|readonly|selected|value)"),e.querySelectorAll(":checked").length||i.push(":checked")}),K(function(e){e.innerHTML="<p test=''></p>",e.querySelectorAll("[test^='']").length&&i.push("[*^$]="+O+"*(?:\"\"|'')"),e.innerHTML="<input type='hidden'/>",e.querySelectorAll(":enabled").length||i.push(":enabled",":disabled")}),i=new RegExp(i.join("|")),vt=function(e,r,s,o,u){if(!o&&!u&&!i.test(e)){var a,f,l=!0,c=d,h=r,p=r.nodeType===9&&e;if(r.nodeType===1&&r.nodeName.toLowerCase()!=="object"){a=ut(e),(l=r.getAttribute("id"))?c=l.replace(n,"\\$&"):r.setAttribute("id",c),c="[id='"+c+"'] ",f=a.length;while(f--)a[f]=c+a[f].join("");h=z.test(e)&&r.parentNode||r,p=a.join(",")}if(p)try{return S.apply(s,x.call(h.querySelectorAll(p),0)),s}catch(v){}finally{l||r.removeAttribute("id")}}return t(e,r,s,o,u)},u&&(K(function(t){e=u.call(t,"div");try{u.call(t,"[test!='']:sizzle"),s.push("!=",H)}catch(n){}}),s=new RegExp(s.join("|")),nt.matchesSelector=function(t,n){n=n.replace(r,"='$1']");if(!o(t)&&!s.test(n)&&!i.test(n))try{var a=u.call(t,n);if(a||e||t.document&&t.document.nodeType!==11)return a}catch(f){}return nt(n,null,null,[t]).length>0})}(),i.pseudos.nth=i.pseudos.eq,i.filters=mt.prototype=i.pseudos,i.setFilters=new mt,nt.attr=v.attr,v.find=nt,v.expr=nt.selectors,v.expr[":"]=v.expr.pseudos,v.unique=nt.uniqueSort,v.text=nt.getText,v.isXMLDoc=nt.isXML,v.contains=nt.contains}(e);var nt=/Until$/,rt=/^(?:parents|prev(?:Until|All))/,it=/^.[^:#\[\.,]*$/,st=v.expr.match.needsContext,ot={children:!0,contents:!0,next:!0,prev:!0};v.fn.extend({find:function(e){var t,n,r,i,s,o,u=this;if(typeof e!="string")return v(e).filter(function(){for(t=0,n=u.length;t<n;t++)if(v.contains(u[t],this))return!0});o=this.pushStack("","find",e);for(t=0,n=this.length;t<n;t++){r=o.length,v.find(e,this[t],o);if(t>0)for(i=r;i<o.length;i++)for(s=0;s<r;s++)if(o[s]===o[i]){o.splice(i--,1);break}}return o},has:function(e){var t,n=v(e,this),r=n.length;return this.filter(function(){for(t=0;t<r;t++)if(v.contains(this,n[t]))return!0})},not:function(e){return this.pushStack(ft(this,e,!1),"not",e)},filter:function(e){return this.pushStack(ft(this,e,!0),"filter",e)},is:function(e){return!!e&&(typeof e=="string"?st.test(e)?v(e,this.context).index(this[0])>=0:v.filter(e,this).length>0:this.filter(e).length>0)},closest:function(e,t){var n,r=0,i=this.length,s=[],o=st.test(e)||typeof e!="string"?v(e,t||this.context):0;for(;r<i;r++){n=this[r];while(n&&n.ownerDocument&&n!==t&&n.nodeType!==11){if(o?o.index(n)>-1:v.find.matchesSelector(n,e)){s.push(n);break}n=n.parentNode}}return s=s.length>1?v.unique(s):s,this.pushStack(s,"closest",e)},index:function(e){return e?typeof e=="string"?v.inArray(this[0],v(e)):v.inArray(e.jquery?e[0]:e,this):this[0]&&this[0].parentNode?this.prevAll().length:-1},add:function(e,t){var n=typeof e=="string"?v(e,t):v.makeArray(e&&e.nodeType?[e]:e),r=v.merge(this.get(),n);return this.pushStack(ut(n[0])||ut(r[0])?r:v.unique(r))},addBack:function(e){return this.add(e==null?this.prevObject:this.prevObject.filter(e))}}),v.fn.andSelf=v.fn.addBack,v.each({parent:function(e){var t=e.parentNode;return t&&t.nodeType!==11?t:null},parents:function(e){return v.dir(e,"parentNode")},parentsUntil:function(e,t,n){return v.dir(e,"parentNode",n)},next:function(e){return at(e,"nextSibling")},prev:function(e){return at(e,"previousSibling")},nextAll:function(e){return v.dir(e,"nextSibling")},prevAll:function(e){return v.dir(e,"previousSibling")},nextUntil:function(e,t,n){return v.dir(e,"nextSibling",n)},prevUntil:function(e,t,n){return v.dir(e,"previousSibling",n)},siblings:function(e){return v.sibling((e.parentNode||{}).firstChild,e)},children:function(e){return v.sibling(e.firstChild)},contents:function(e){return v.nodeName(e,"iframe")?e.contentDocument||e.contentWindow.document:v.merge([],e.childNodes)}},function(e,t){v.fn[e]=function(n,r){var i=v.map(this,t,n);return nt.test(e)||(r=n),r&&typeof r=="string"&&(i=v.filter(r,i)),i=this.length>1&&!ot[e]?v.unique(i):i,this.length>1&&rt.test(e)&&(i=i.reverse()),this.pushStack(i,e,l.call(arguments).join(","))}}),v.extend({filter:function(e,t,n){return n&&(e=":not("+e+")"),t.length===1?v.find.matchesSelector(t[0],e)?[t[0]]:[]:v.find.matches(e,t)},dir:function(e,n,r){var i=[],s=e[n];while(s&&s.nodeType!==9&&(r===t||s.nodeType!==1||!v(s).is(r)))s.nodeType===1&&i.push(s),s=s[n];return i},sibling:function(e,t){var n=[];for(;e;e=e.nextSibling)e.nodeType===1&&e!==t&&n.push(e);return n}});var ct="abbr|article|aside|audio|bdi|canvas|data|datalist|details|figcaption|figure|footer|header|hgroup|mark|meter|nav|output|progress|section|summary|time|video",ht=/ jQuery\d+="(?:null|\d+)"/g,pt=/^\s+/,dt=/<(?!area|br|col|embed|hr|img|input|link|meta|param)(([\w:]+)[^>]*)\/>/gi,vt=/<([\w:]+)/,mt=/<tbody/i,gt=/<|&#?\w+;/,yt=/<(?:script|style|link)/i,bt=/<(?:script|object|embed|option|style)/i,wt=new RegExp("<(?:"+ct+")[\\s/>]","i"),Et=/^(?:checkbox|radio)$/,St=/checked\s*(?:[^=]|=\s*.checked.)/i,xt=/\/(java|ecma)script/i,Tt=/^\s*<!(?:\[CDATA\[|\-\-)|[\]\-]{2}>\s*$/g,Nt={option:[1,"<select multiple='multiple'>","</select>"],legend:[1,"<fieldset>","</fieldset>"],thead:[1,"<table>","</table>"],tr:[2,"<table><tbody>","</tbody></table>"],td:[3,"<table><tbody><tr>","</tr></tbody></table>"],col:[2,"<table><tbody></tbody><colgroup>","</colgroup></table>"],area:[1,"<map>","</map>"],_default:[0,"",""]},Ct=lt(i),kt=Ct.appendChild(i.createElement("div"));Nt.optgroup=Nt.option,Nt.tbody=Nt.tfoot=Nt.colgroup=Nt.caption=Nt.thead,Nt.th=Nt.td,v.support.htmlSerialize||(Nt._default=[1,"X<div>","</div>"]),v.fn.extend({text:function(e){return v.access(this,function(e){return e===t?v.text(this):this.empty().append((this[0]&&this[0].ownerDocument||i).createTextNode(e))},null,e,arguments.length)},wrapAll:function(e){if(v.isFunction(e))return this.each(function(t){v(this).wrapAll(e.call(this,t))});if(this[0]){var t=v(e,this[0].ownerDocument).eq(0).clone(!0);this[0].parentNode&&t.insertBefore(this[0]),t.map(function(){var e=this;while(e.firstChild&&e.firstChild.nodeType===1)e=e.firstChild;return e}).append(this)}return this},wrapInner:function(e){return v.isFunction(e)?this.each(function(t){v(this).wrapInner(e.call(this,t))}):this.each(function(){var t=v(this),n=t.contents();n.length?n.wrapAll(e):t.append(e)})},wrap:function(e){var t=v.isFunction(e);return this.each(function(n){v(this).wrapAll(t?e.call(this,n):e)})},unwrap:function(){return this.parent().each(function(){v.nodeName(this,"body")||v(this).replaceWith(this.childNodes)}).end()},append:function(){return this.domManip(arguments,!0,function(e){(this.nodeType===1||this.nodeType===11)&&this.appendChild(e)})},prepend:function(){return this.domManip(arguments,!0,function(e){(this.nodeType===1||this.nodeType===11)&&this.insertBefore(e,this.firstChild)})},before:function(){if(!ut(this[0]))return this.domManip(arguments,!1,function(e){this.parentNode.insertBefore(e,this)});if(arguments.length){var e=v.clean(arguments);return this.pushStack(v.merge(e,this),"before",this.selector)}},after:function(){if(!ut(this[0]))return this.domManip(arguments,!1,function(e){this.parentNode.insertBefore(e,this.nextSibling)});if(arguments.length){var e=v.clean(arguments);return this.pushStack(v.merge(this,e),"after",this.selector)}},remove:function(e,t){var n,r=0;for(;(n=this[r])!=null;r++)if(!e||v.filter(e,[n]).length)!t&&n.nodeType===1&&(v.cleanData(n.getElementsByTagName("*")),v.cleanData([n])),n.parentNode&&n.parentNode.removeChild(n);return this},empty:function(){var e,t=0;for(;(e=this[t])!=null;t++){e.nodeType===1&&v.cleanData(e.getElementsByTagName("*"));while(e.firstChild)e.removeChild(e.firstChild)}return this},clone:function(e,t){return e=e==null?!1:e,t=t==null?e:t,this.map(function(){return v.clone(this,e,t)})},html:function(e){return v.access(this,function(e){var n=this[0]||{},r=0,i=this.length;if(e===t)return n.nodeType===1?n.innerHTML.replace(ht,""):t;if(typeof e=="string"&&!yt.test(e)&&(v.support.htmlSerialize||!wt.test(e))&&(v.support.leadingWhitespace||!pt.test(e))&&!Nt[(vt.exec(e)||["",""])[1].toLowerCase()]){e=e.replace(dt,"<$1></$2>");try{for(;r<i;r++)n=this[r]||{},n.nodeType===1&&(v.cleanData(n.getElementsByTagName("*")),n.innerHTML=e);n=0}catch(s){}}n&&this.empty().append(e)},null,e,arguments.length)},replaceWith:function(e){return ut(this[0])?this.length?this.pushStack(v(v.isFunction(e)?e():e),"replaceWith",e):this:v.isFunction(e)?this.each(function(t){var n=v(this),r=n.html();n.replaceWith(e.call(this,t,r))}):(typeof e!="string"&&(e=v(e).detach()),this.each(function(){var t=this.nextSibling,n=this.parentNode;v(this).remove(),t?v(t).before(e):v(n).append(e)}))},detach:function(e){return this.remove(e,!0)},domManip:function(e,n,r){e=[].concat.apply([],e);var i,s,o,u,a=0,f=e[0],l=[],c=this.length;if(!v.support.checkClone&&c>1&&typeof f=="string"&&St.test(f))return this.each(function(){v(this).domManip(e,n,r)});if(v.isFunction(f))return this.each(function(i){var s=v(this);e[0]=f.call(this,i,n?s.html():t),s.domManip(e,n,r)});if(this[0]){i=v.buildFragment(e,this,l),o=i.fragment,s=o.firstChild,o.childNodes.length===1&&(o=s);if(s){n=n&&v.nodeName(s,"tr");for(u=i.cacheable||c-1;a<c;a++)r.call(n&&v.nodeName(this[a],"table")?Lt(this[a],"tbody"):this[a],a===u?o:v.clone(o,!0,!0))}o=s=null,l.length&&v.each(l,function(e,t){t.src?v.ajax?v.ajax({url:t.src,type:"GET",dataType:"script",async:!1,global:!1,"throws":!0}):v.error("no ajax"):v.globalEval((t.text||t.textContent||t.innerHTML||"").replace(Tt,"")),t.parentNode&&t.parentNode.removeChild(t)})}return this}}),v.buildFragment=function(e,n,r){var s,o,u,a=e[0];return n=n||i,n=!n.nodeType&&n[0]||n,n=n.ownerDocument||n,e.length===1&&typeof a=="string"&&a.length<512&&n===i&&a.charAt(0)==="<"&&!bt.test(a)&&(v.support.checkClone||!St.test(a))&&(v.support.html5Clone||!wt.test(a))&&(o=!0,s=v.fragments[a],u=s!==t),s||(s=n.createDocumentFragment(),v.clean(e,n,s,r),o&&(v.fragments[a]=u&&s)),{fragment:s,cacheable:o}},v.fragments={},v.each({appendTo:"append",prependTo:"prepend",insertBefore:"before",insertAfter:"after",replaceAll:"replaceWith"},function(e,t){v.fn[e]=function(n){var r,i=0,s=[],o=v(n),u=o.length,a=this.length===1&&this[0].parentNode;if((a==null||a&&a.nodeType===11&&a.childNodes.length===1)&&u===1)return o[t](this[0]),this;for(;i<u;i++)r=(i>0?this.clone(!0):this).get(),v(o[i])[t](r),s=s.concat(r);return this.pushStack(s,e,o.selector)}}),v.extend({clone:function(e,t,n){var r,i,s,o;v.support.html5Clone||v.isXMLDoc(e)||!wt.test("<"+e.nodeName+">")?o=e.cloneNode(!0):(kt.innerHTML=e.outerHTML,kt.removeChild(o=kt.firstChild));if((!v.support.noCloneEvent||!v.support.noCloneChecked)&&(e.nodeType===1||e.nodeType===11)&&!v.isXMLDoc(e)){Ot(e,o),r=Mt(e),i=Mt(o);for(s=0;r[s];++s)i[s]&&Ot(r[s],i[s])}if(t){At(e,o);if(n){r=Mt(e),i=Mt(o);for(s=0;r[s];++s)At(r[s],i[s])}}return r=i=null,o},clean:function(e,t,n,r){var s,o,u,a,f,l,c,h,p,d,m,g,y=t===i&&Ct,b=[];if(!t||typeof t.createDocumentFragment=="undefined")t=i;for(s=0;(u=e[s])!=null;s++){typeof u=="number"&&(u+="");if(!u)continue;if(typeof u=="string")if(!gt.test(u))u=t.createTextNode(u);else{y=y||lt(t),c=t.createElement("div"),y.appendChild(c),u=u.replace(dt,"<$1></$2>"),a=(vt.exec(u)||["",""])[1].toLowerCase(),f=Nt[a]||Nt._default,l=f[0],c.innerHTML=f[1]+u+f[2];while(l--)c=c.lastChild;if(!v.support.tbody){h=mt.test(u),p=a==="table"&&!h?c.firstChild&&c.firstChild.childNodes:f[1]==="<table>"&&!h?c.childNodes:[];for(o=p.length-1;o>=0;--o)v.nodeName(p[o],"tbody")&&!p[o].childNodes.length&&p[o].parentNode.removeChild(p[o])}!v.support.leadingWhitespace&&pt.test(u)&&c.insertBefore(t.createTextNode(pt.exec(u)[0]),c.firstChild),u=c.childNodes,c.parentNode.removeChild(c)}u.nodeType?b.push(u):v.merge(b,u)}c&&(u=c=y=null);if(!v.support.appendChecked)for(s=0;(u=b[s])!=null;s++)v.nodeName(u,"input")?_t(u):typeof u.getElementsByTagName!="undefined"&&v.grep(u.getElementsByTagName("input"),_t);if(n){m=function(e){if(!e.type||xt.test(e.type))return r?r.push(e.parentNode?e.parentNode.removeChild(e):e):n.appendChild(e)};for(s=0;(u=b[s])!=null;s++)if(!v.nodeName(u,"script")||!m(u))n.appendChild(u),typeof u.getElementsByTagName!="undefined"&&(g=v.grep(v.merge([],u.getElementsByTagName("script")),m),b.splice.apply(b,[s+1,0].concat(g)),s+=g.length)}return b},cleanData:function(e,t){var n,r,i,s,o=0,u=v.expando,a=v.cache,f=v.support.deleteExpando,l=v.event.special;for(;(i=e[o])!=null;o++)if(t||v.acceptData(i)){r=i[u],n=r&&a[r];if(n){if(n.events)for(s in n.events)l[s]?v.event.remove(i,s):v.removeEvent(i,s,n.handle);a[r]&&(delete a[r],f?delete i[u]:i.removeAttribute?i.removeAttribute(u):i[u]=null,v.deletedIds.push(r))}}}}),function(){var e,t;v.uaMatch=function(e){e=e.toLowerCase();var t=/(chrome)[ \/]([\w.]+)/.exec(e)||/(webkit)[ \/]([\w.]+)/.exec(e)||/(opera)(?:.*version|)[ \/]([\w.]+)/.exec(e)||/(msie) ([\w.]+)/.exec(e)||e.indexOf("compatible")<0&&/(mozilla)(?:.*? rv:([\w.]+)|)/.exec(e)||[];return{browser:t[1]||"",version:t[2]||"0"}},e=v.uaMatch(o.userAgent),t={},e.browser&&(t[e.browser]=!0,t.version=e.version),t.chrome?t.webkit=!0:t.webkit&&(t.safari=!0),v.browser=t,v.sub=function(){function e(t,n){return new e.fn.init(t,n)}v.extend(!0,e,this),e.superclass=this,e.fn=e.prototype=this(),e.fn.constructor=e,e.sub=this.sub,e.fn.init=function(r,i){return i&&i instanceof v&&!(i instanceof e)&&(i=e(i)),v.fn.init.call(this,r,i,t)},e.fn.init.prototype=e.fn;var t=e(i);return e}}();var Dt,Pt,Ht,Bt=/alpha\([^)]*\)/i,jt=/opacity=([^)]*)/,Ft=/^(top|right|bottom|left)$/,It=/^(none|table(?!-c[ea]).+)/,qt=/^margin/,Rt=new RegExp("^("+m+")(.*)$","i"),Ut=new RegExp("^("+m+")(?!px)[a-z%]+$","i"),zt=new RegExp("^([-+])=("+m+")","i"),Wt={BODY:"block"},Xt={position:"absolute",visibility:"hidden",display:"block"},Vt={letterSpacing:0,fontWeight:400},$t=["Top","Right","Bottom","Left"],Jt=["Webkit","O","Moz","ms"],Kt=v.fn.toggle;v.fn.extend({css:function(e,n){return v.access(this,function(e,n,r){return r!==t?v.style(e,n,r):v.css(e,n)},e,n,arguments.length>1)},show:function(){return Yt(this,!0)},hide:function(){return Yt(this)},toggle:function(e,t){var n=typeof e=="boolean";return v.isFunction(e)&&v.isFunction(t)?Kt.apply(this,arguments):this.each(function(){(n?e:Gt(this))?v(this).show():v(this).hide()})}}),v.extend({cssHooks:{opacity:{get:function(e,t){if(t){var n=Dt(e,"opacity");return n===""?"1":n}}}},cssNumber:{fillOpacity:!0,fontWeight:!0,lineHeight:!0,opacity:!0,orphans:!0,widows:!0,zIndex:!0,zoom:!0},cssProps:{"float":v.support.cssFloat?"cssFloat":"styleFloat"},style:function(e,n,r,i){if(!e||e.nodeType===3||e.nodeType===8||!e.style)return;var s,o,u,a=v.camelCase(n),f=e.style;n=v.cssProps[a]||(v.cssProps[a]=Qt(f,a)),u=v.cssHooks[n]||v.cssHooks[a];if(r===t)return u&&"get"in u&&(s=u.get(e,!1,i))!==t?s:f[n];o=typeof r,o==="string"&&(s=zt.exec(r))&&(r=(s[1]+1)*s[2]+parseFloat(v.css(e,n)),o="number");if(r==null||o==="number"&&isNaN(r))return;o==="number"&&!v.cssNumber[a]&&(r+="px");if(!u||!("set"in u)||(r=u.set(e,r,i))!==t)try{f[n]=r}catch(l){}},css:function(e,n,r,i){var s,o,u,a=v.camelCase(n);return n=v.cssProps[a]||(v.cssProps[a]=Qt(e.style,a)),u=v.cssHooks[n]||v.cssHooks[a],u&&"get"in u&&(s=u.get(e,!0,i)),s===t&&(s=Dt(e,n)),s==="normal"&&n in Vt&&(s=Vt[n]),r||i!==t?(o=parseFloat(s),r||v.isNumeric(o)?o||0:s):s},swap:function(e,t,n){var r,i,s={};for(i in t)s[i]=e.style[i],e.style[i]=t[i];r=n.call(e);for(i in t)e.style[i]=s[i];return r}}),e.getComputedStyle?Dt=function(t,n){var r,i,s,o,u=e.getComputedStyle(t,null),a=t.style;return u&&(r=u.getPropertyValue(n)||u[n],r===""&&!v.contains(t.ownerDocument,t)&&(r=v.style(t,n)),Ut.test(r)&&qt.test(n)&&(i=a.width,s=a.minWidth,o=a.maxWidth,a.minWidth=a.maxWidth=a.width=r,r=u.width,a.width=i,a.minWidth=s,a.maxWidth=o)),r}:i.documentElement.currentStyle&&(Dt=function(e,t){var n,r,i=e.currentStyle&&e.currentStyle[t],s=e.style;return i==null&&s&&s[t]&&(i=s[t]),Ut.test(i)&&!Ft.test(t)&&(n=s.left,r=e.runtimeStyle&&e.runtimeStyle.left,r&&(e.runtimeStyle.left=e.currentStyle.left),s.left=t==="fontSize"?"1em":i,i=s.pixelLeft+"px",s.left=n,r&&(e.runtimeStyle.left=r)),i===""?"auto":i}),v.each(["height","width"],function(e,t){v.cssHooks[t]={get:function(e,n,r){if(n)return e.offsetWidth===0&&It.test(Dt(e,"display"))?v.swap(e,Xt,function(){return tn(e,t,r)}):tn(e,t,r)},set:function(e,n,r){return Zt(e,n,r?en(e,t,r,v.support.boxSizing&&v.css(e,"boxSizing")==="border-box"):0)}}}),v.support.opacity||(v.cssHooks.opacity={get:function(e,t){return jt.test((t&&e.currentStyle?e.currentStyle.filter:e.style.filter)||"")?.01*parseFloat(RegExp.$1)+"":t?"1":""},set:function(e,t){var n=e.style,r=e.currentStyle,i=v.isNumeric(t)?"alpha(opacity="+t*100+")":"",s=r&&r.filter||n.filter||"";n.zoom=1;if(t>=1&&v.trim(s.replace(Bt,""))===""&&n.removeAttribute){n.removeAttribute("filter");if(r&&!r.filter)return}n.filter=Bt.test(s)?s.replace(Bt,i):s+" "+i}}),v(function(){v.support.reliableMarginRight||(v.cssHooks.marginRight={get:function(e,t){return v.swap(e,{display:"inline-block"},function(){if(t)return Dt(e,"marginRight")})}}),!v.support.pixelPosition&&v.fn.position&&v.each(["top","left"],function(e,t){v.cssHooks[t]={get:function(e,n){if(n){var r=Dt(e,t);return Ut.test(r)?v(e).position()[t]+"px":r}}}})}),v.expr&&v.expr.filters&&(v.expr.filters.hidden=function(e){return e.offsetWidth===0&&e.offsetHeight===0||!v.support.reliableHiddenOffsets&&(e.style&&e.style.display||Dt(e,"display"))==="none"},v.expr.filters.visible=function(e){return!v.expr.filters.hidden(e)}),v.each({margin:"",padding:"",border:"Width"},function(e,t){v.cssHooks[e+t]={expand:function(n){var r,i=typeof n=="string"?n.split(" "):[n],s={};for(r=0;r<4;r++)s[e+$t[r]+t]=i[r]||i[r-2]||i[0];return s}},qt.test(e)||(v.cssHooks[e+t].set=Zt)});var rn=/%20/g,sn=/\[\]$/,on=/\r?\n/g,un=/^(?:color|date|datetime|datetime-local|email|hidden|month|number|password|range|search|tel|text|time|url|week)$/i,an=/^(?:select|textarea)/i;v.fn.extend({serialize:function(){return v.param(this.serializeArray())},serializeArray:function(){return this.map(function(){return this.elements?v.makeArray(this.elements):this}).filter(function(){return this.name&&!this.disabled&&(this.checked||an.test(this.nodeName)||un.test(this.type))}).map(function(e,t){var n=v(this).val();return n==null?null:v.isArray(n)?v.map(n,function(e,n){return{name:t.name,value:e.replace(on,"\r\n")}}):{name:t.name,value:n.replace(on,"\r\n")}}).get()}}),v.param=function(e,n){var r,i=[],s=function(e,t){t=v.isFunction(t)?t():t==null?"":t,i[i.length]=encodeURIComponent(e)+"="+encodeURIComponent(t)};n===t&&(n=v.ajaxSettings&&v.ajaxSettings.traditional);if(v.isArray(e)||e.jquery&&!v.isPlainObject(e))v.each(e,function(){s(this.name,this.value)});else for(r in e)fn(r,e[r],n,s);return i.join("&").replace(rn,"+")};var ln,cn,hn=/#.*$/,pn=/^(.*?):[ \t]*([^\r\n]*)\r?$/mg,dn=/^(?:about|app|app\-storage|.+\-extension|file|res|widget):$/,vn=/^(?:GET|HEAD)$/,mn=/^\/\//,gn=/\?/,yn=/<script\b[^<]*(?:(?!<\/script>)<[^<]*)*<\/script>/gi,bn=/([?&])_=[^&]*/,wn=/^([\w\+\.\-]+:)(?:\/\/([^\/?#:]*)(?::(\d+)|)|)/,En=v.fn.load,Sn={},xn={},Tn=["*/"]+["*"];try{cn=s.href}catch(Nn){cn=i.createElement("a"),cn.href="",cn=cn.href}ln=wn.exec(cn.toLowerCase())||[],v.fn.load=function(e,n,r){if(typeof e!="string"&&En)return En.apply(this,arguments);if(!this.length)return this;var i,s,o,u=this,a=e.indexOf(" ");return a>=0&&(i=e.slice(a,e.length),e=e.slice(0,a)),v.isFunction(n)?(r=n,n=t):n&&typeof n=="object"&&(s="POST"),v.ajax({url:e,type:s,dataType:"html",data:n,complete:function(e,t){r&&u.each(r,o||[e.responseText,t,e])}}).done(function(e){o=arguments,u.html(i?v("<div>").append(e.replace(yn,"")).find(i):e)}),this},v.each("ajaxStart ajaxStop ajaxComplete ajaxError ajaxSuccess ajaxSend".split(" "),function(e,t){v.fn[t]=function(e){return this.on(t,e)}}),v.each(["get","post"],function(e,n){v[n]=function(e,r,i,s){return v.isFunction(r)&&(s=s||i,i=r,r=t),v.ajax({type:n,url:e,data:r,success:i,dataType:s})}}),v.extend({getScript:function(e,n){return v.get(e,t,n,"script")},getJSON:function(e,t,n){return v.get(e,t,n,"json")},ajaxSetup:function(e,t){return t?Ln(e,v.ajaxSettings):(t=e,e=v.ajaxSettings),Ln(e,t),e},ajaxSettings:{url:cn,isLocal:dn.test(ln[1]),global:!0,type:"GET",contentType:"application/x-www-form-urlencoded; charset=UTF-8",processData:!0,async:!0,accepts:{xml:"application/xml, text/xml",html:"text/html",text:"text/plain",json:"application/json, text/javascript","*":Tn},contents:{xml:/xml/,html:/html/,json:/json/},responseFields:{xml:"responseXML",text:"responseText"},converters:{"* text":e.String,"text html":!0,"text json":v.parseJSON,"text xml":v.parseXML},flatOptions:{context:!0,url:!0}},ajaxPrefilter:Cn(Sn),ajaxTransport:Cn(xn),ajax:function(e,n){function T(e,n,s,a){var l,y,b,w,S,T=n;if(E===2)return;E=2,u&&clearTimeout(u),o=t,i=a||"",x.readyState=e>0?4:0,s&&(w=An(c,x,s));if(e>=200&&e<300||e===304)c.ifModified&&(S=x.getResponseHeader("Last-Modified"),S&&(v.lastModified[r]=S),S=x.getResponseHeader("Etag"),S&&(v.etag[r]=S)),e===304?(T="notmodified",l=!0):(l=On(c,w),T=l.state,y=l.data,b=l.error,l=!b);else{b=T;if(!T||e)T="error",e<0&&(e=0)}x.status=e,x.statusText=(n||T)+"",l?d.resolveWith(h,[y,T,x]):d.rejectWith(h,[x,T,b]),x.statusCode(g),g=t,f&&p.trigger("ajax"+(l?"Success":"Error"),[x,c,l?y:b]),m.fireWith(h,[x,T]),f&&(p.trigger("ajaxComplete",[x,c]),--v.active||v.event.trigger("ajaxStop"))}typeof e=="object"&&(n=e,e=t),n=n||{};var r,i,s,o,u,a,f,l,c=v.ajaxSetup({},n),h=c.context||c,p=h!==c&&(h.nodeType||h instanceof v)?v(h):v.event,d=v.Deferred(),m=v.Callbacks("once memory"),g=c.statusCode||{},b={},w={},E=0,S="canceled",x={readyState:0,setRequestHeader:function(e,t){if(!E){var n=e.toLowerCase();e=w[n]=w[n]||e,b[e]=t}return this},getAllResponseHeaders:function(){return E===2?i:null},getResponseHeader:function(e){var n;if(E===2){if(!s){s={};while(n=pn.exec(i))s[n[1].toLowerCase()]=n[2]}n=s[e.toLowerCase()]}return n===t?null:n},overrideMimeType:function(e){return E||(c.mimeType=e),this},abort:function(e){return e=e||S,o&&o.abort(e),T(0,e),this}};d.promise(x),x.success=x.done,x.error=x.fail,x.complete=m.add,x.statusCode=function(e){if(e){var t;if(E<2)for(t in e)g[t]=[g[t],e[t]];else t=e[x.status],x.always(t)}return this},c.url=((e||c.url)+"").replace(hn,"").replace(mn,ln[1]+"//"),c.dataTypes=v.trim(c.dataType||"*").toLowerCase().split(y),c.crossDomain==null&&(a=wn.exec(c.url.toLowerCase()),c.crossDomain=!(!a||a[1]===ln[1]&&a[2]===ln[2]&&(a[3]||(a[1]==="http:"?80:443))==(ln[3]||(ln[1]==="http:"?80:443)))),c.data&&c.processData&&typeof c.data!="string"&&(c.data=v.param(c.data,c.traditional)),kn(Sn,c,n,x);if(E===2)return x;f=c.global,c.type=c.type.toUpperCase(),c.hasContent=!vn.test(c.type),f&&v.active++===0&&v.event.trigger("ajaxStart");if(!c.hasContent){c.data&&(c.url+=(gn.test(c.url)?"&":"?")+c.data,delete c.data),r=c.url;if(c.cache===!1){var N=v.now(),C=c.url.replace(bn,"$1_="+N);c.url=C+(C===c.url?(gn.test(c.url)?"&":"?")+"_="+N:"")}}(c.data&&c.hasContent&&c.contentType!==!1||n.contentType)&&x.setRequestHeader("Content-Type",c.contentType),c.ifModified&&(r=r||c.url,v.lastModified[r]&&x.setRequestHeader("If-Modified-Since",v.lastModified[r]),v.etag[r]&&x.setRequestHeader("If-None-Match",v.etag[r])),x.setRequestHeader("Accept",c.dataTypes[0]&&c.accepts[c.dataTypes[0]]?c.accepts[c.dataTypes[0]]+(c.dataTypes[0]!=="*"?", "+Tn+"; q=0.01":""):c.accepts["*"]);for(l in c.headers)x.setRequestHeader(l,c.headers[l]);if(!c.beforeSend||c.beforeSend.call(h,x,c)!==!1&&E!==2){S="abort";for(l in{success:1,error:1,complete:1})x[l](c[l]);o=kn(xn,c,n,x);if(!o)T(-1,"No Transport");else{x.readyState=1,f&&p.trigger("ajaxSend",[x,c]),c.async&&c.timeout>0&&(u=setTimeout(function(){x.abort("timeout")},c.timeout));try{E=1,o.send(b,T)}catch(k){if(!(E<2))throw k;T(-1,k)}}return x}return x.abort()},active:0,lastModified:{},etag:{}});var Mn=[],_n=/\?/,Dn=/(=)\?(?=&|$)|\?\?/,Pn=v.now();v.ajaxSetup({jsonp:"callback",jsonpCallback:function(){var e=Mn.pop()||v.expando+"_"+Pn++;return this[e]=!0,e}}),v.ajaxPrefilter("json jsonp",function(n,r,i){var s,o,u,a=n.data,f=n.url,l=n.jsonp!==!1,c=l&&Dn.test(f),h=l&&!c&&typeof a=="string"&&!(n.contentType||"").indexOf("application/x-www-form-urlencoded")&&Dn.test(a);if(n.dataTypes[0]==="jsonp"||c||h)return s=n.jsonpCallback=v.isFunction(n.jsonpCallback)?n.jsonpCallback():n.jsonpCallback,o=e[s],c?n.url=f.replace(Dn,"$1"+s):h?n.data=a.replace(Dn,"$1"+s):l&&(n.url+=(_n.test(f)?"&":"?")+n.jsonp+"="+s),n.converters["script json"]=function(){return u||v.error(s+" was not called"),u[0]},n.dataTypes[0]="json",e[s]=function(){u=arguments},i.always(function(){e[s]=o,n[s]&&(n.jsonpCallback=r.jsonpCallback,Mn.push(s)),u&&v.isFunction(o)&&o(u[0]),u=o=t}),"script"}),v.ajaxSetup({accepts:{script:"text/javascript, application/javascript, application/ecmascript, application/x-ecmascript"},contents:{script:/javascript|ecmascript/},converters:{"text script":function(e){return v.globalEval(e),e}}}),v.ajaxPrefilter("script",function(e){e.cache===t&&(e.cache=!1),e.crossDomain&&(e.type="GET",e.global=!1)}),v.ajaxTransport("script",function(e){if(e.crossDomain){var n,r=i.head||i.getElementsByTagName("head")[0]||i.documentElement;return{send:function(s,o){n=i.createElement("script"),n.async="async",e.scriptCharset&&(n.charset=e.scriptCharset),n.src=e.url,n.onload=n.onreadystatechange=function(e,i){if(i||!n.readyState||/loaded|complete/.test(n.readyState))n.onload=n.onreadystatechange=null,r&&n.parentNode&&r.removeChild(n),n=t,i||o(200,"success")},r.insertBefore(n,r.firstChild)},abort:function(){n&&n.onload(0,1)}}}});var Hn,Bn=e.ActiveXObject?function(){for(var e in Hn)Hn[e](0,1)}:!1,jn=0;v.ajaxSettings.xhr=e.ActiveXObject?function(){return!this.isLocal&&Fn()||In()}:Fn,function(e){v.extend(v.support,{ajax:!!e,cors:!!e&&"withCredentials"in e})}(v.ajaxSettings.xhr()),v.support.ajax&&v.ajaxTransport(function(n){if(!n.crossDomain||v.support.cors){var r;return{send:function(i,s){var o,u,a=n.xhr();n.username?a.open(n.type,n.url,n.async,n.username,n.password):a.open(n.type,n.url,n.async);if(n.xhrFields)for(u in n.xhrFields)a[u]=n.xhrFields[u];n.mimeType&&a.overrideMimeType&&a.overrideMimeType(n.mimeType),!n.crossDomain&&!i["X-Requested-With"]&&(i["X-Requested-With"]="XMLHttpRequest");try{for(u in i)a.setRequestHeader(u,i[u])}catch(f){}a.send(n.hasContent&&n.data||null),r=function(e,i){var u,f,l,c,h;try{if(r&&(i||a.readyState===4)){r=t,o&&(a.onreadystatechange=v.noop,Bn&&delete Hn[o]);if(i)a.readyState!==4&&a.abort();else{u=a.status,l=a.getAllResponseHeaders(),c={},h=a.responseXML,h&&h.documentElement&&(c.xml=h);try{c.text=a.responseText}catch(p){}try{f=a.statusText}catch(p){f=""}!u&&n.isLocal&&!n.crossDomain?u=c.text?200:404:u===1223&&(u=204)}}}catch(d){i||s(-1,d)}c&&s(u,f,c,l)},n.async?a.readyState===4?setTimeout(r,0):(o=++jn,Bn&&(Hn||(Hn={},v(e).unload(Bn)),Hn[o]=r),a.onreadystatechange=r):r()},abort:function(){r&&r(0,1)}}}});var qn,Rn,Un=/^(?:toggle|show|hide)$/,zn=new RegExp("^(?:([-+])=|)("+m+")([a-z%]*)$","i"),Wn=/queueHooks$/,Xn=[Gn],Vn={"*":[function(e,t){var n,r,i=this.createTween(e,t),s=zn.exec(t),o=i.cur(),u=+o||0,a=1,f=20;if(s){n=+s[2],r=s[3]||(v.cssNumber[e]?"":"px");if(r!=="px"&&u){u=v.css(i.elem,e,!0)||n||1;do a=a||".5",u/=a,v.style(i.elem,e,u+r);while(a!==(a=i.cur()/o)&&a!==1&&--f)}i.unit=r,i.start=u,i.end=s[1]?u+(s[1]+1)*n:n}return i}]};v.Animation=v.extend(Kn,{tweener:function(e,t){v.isFunction(e)?(t=e,e=["*"]):e=e.split(" ");var n,r=0,i=e.length;for(;r<i;r++)n=e[r],Vn[n]=Vn[n]||[],Vn[n].unshift(t)},prefilter:function(e,t){t?Xn.unshift(e):Xn.push(e)}}),v.Tween=Yn,Yn.prototype={constructor:Yn,init:function(e,t,n,r,i,s){this.elem=e,this.prop=n,this.easing=i||"swing",this.options=t,this.start=this.now=this.cur(),this.end=r,this.unit=s||(v.cssNumber[n]?"":"px")},cur:function(){var e=Yn.propHooks[this.prop];return e&&e.get?e.get(this):Yn.propHooks._default.get(this)},run:function(e){var t,n=Yn.propHooks[this.prop];return this.options.duration?this.pos=t=v.easing[this.easing](e,this.options.duration*e,0,1,this.options.duration):this.pos=t=e,this.now=(this.end-this.start)*t+this.start,this.options.step&&this.options.step.call(this.elem,this.now,this),n&&n.set?n.set(this):Yn.propHooks._default.set(this),this}},Yn.prototype.init.prototype=Yn.prototype,Yn.propHooks={_default:{get:function(e){var t;return e.elem[e.prop]==null||!!e.elem.style&&e.elem.style[e.prop]!=null?(t=v.css(e.elem,e.prop,!1,""),!t||t==="auto"?0:t):e.elem[e.prop]},set:function(e){v.fx.step[e.prop]?v.fx.step[e.prop](e):e.elem.style&&(e.elem.style[v.cssProps[e.prop]]!=null||v.cssHooks[e.prop])?v.style(e.elem,e.prop,e.now+e.unit):e.elem[e.prop]=e.now}}},Yn.propHooks.scrollTop=Yn.propHooks.scrollLeft={set:function(e){e.elem.nodeType&&e.elem.parentNode&&(e.elem[e.prop]=e.now)}},v.each(["toggle","show","hide"],function(e,t){var n=v.fn[t];v.fn[t]=function(r,i,s){return r==null||typeof r=="boolean"||!e&&v.isFunction(r)&&v.isFunction(i)?n.apply(this,arguments):this.animate(Zn(t,!0),r,i,s)}}),v.fn.extend({fadeTo:function(e,t,n,r){return this.filter(Gt).css("opacity",0).show().end().animate({opacity:t},e,n,r)},animate:function(e,t,n,r){var i=v.isEmptyObject(e),s=v.speed(t,n,r),o=function(){var t=Kn(this,v.extend({},e),s);i&&t.stop(!0)};return i||s.queue===!1?this.each(o):this.queue(s.queue,o)},stop:function(e,n,r){var i=function(e){var t=e.stop;delete e.stop,t(r)};return typeof e!="string"&&(r=n,n=e,e=t),n&&e!==!1&&this.queue(e||"fx",[]),this.each(function(){var t=!0,n=e!=null&&e+"queueHooks",s=v.timers,o=v._data(this);if(n)o[n]&&o[n].stop&&i(o[n]);else for(n in o)o[n]&&o[n].stop&&Wn.test(n)&&i(o[n]);for(n=s.length;n--;)s[n].elem===this&&(e==null||s[n].queue===e)&&(s[n].anim.stop(r),t=!1,s.splice(n,1));(t||!r)&&v.dequeue(this,e)})}}),v.each({slideDown:Zn("show"),slideUp:Zn("hide"),slideToggle:Zn("toggle"),fadeIn:{opacity:"show"},fadeOut:{opacity:"hide"},fadeToggle:{opacity:"toggle"}},function(e,t){v.fn[e]=function(e,n,r){return this.animate(t,e,n,r)}}),v.speed=function(e,t,n){var r=e&&typeof e=="object"?v.extend({},e):{complete:n||!n&&t||v.isFunction(e)&&e,duration:e,easing:n&&t||t&&!v.isFunction(t)&&t};r.duration=v.fx.off?0:typeof r.duration=="number"?r.duration:r.duration in v.fx.speeds?v.fx.speeds[r.duration]:v.fx.speeds._default;if(r.queue==null||r.queue===!0)r.queue="fx";return r.old=r.complete,r.complete=function(){v.isFunction(r.old)&&r.old.call(this),r.queue&&v.dequeue(this,r.queue)},r},v.easing={linear:function(e){return e},swing:function(e){return.5-Math.cos(e*Math.PI)/2}},v.timers=[],v.fx=Yn.prototype.init,v.fx.tick=function(){var e,n=v.timers,r=0;qn=v.now();for(;r<n.length;r++)e=n[r],!e()&&n[r]===e&&n.splice(r--,1);n.length||v.fx.stop(),qn=t},v.fx.timer=function(e){e()&&v.timers.push(e)&&!Rn&&(Rn=setInterval(v.fx.tick,v.fx.interval))},v.fx.interval=13,v.fx.stop=function(){clearInterval(Rn),Rn=null},v.fx.speeds={slow:600,fast:200,_default:400},v.fx.step={},v.expr&&v.expr.filters&&(v.expr.filters.animated=function(e){return v.grep(v.timers,function(t){return e===t.elem}).length});var er=/^(?:body|html)$/i;v.fn.offset=function(e){if(arguments.length)return e===t?this:this.each(function(t){v.offset.setOffset(this,e,t)});var n,r,i,s,o,u,a,f={top:0,left:0},l=this[0],c=l&&l.ownerDocument;if(!c)return;return(r=c.body)===l?v.offset.bodyOffset(l):(n=c.documentElement,v.contains(n,l)?(typeof l.getBoundingClientRect!="undefined"&&(f=l.getBoundingClientRect()),i=tr(c),s=n.clientTop||r.clientTop||0,o=n.clientLeft||r.clientLeft||0,u=i.pageYOffset||n.scrollTop,a=i.pageXOffset||n.scrollLeft,{top:f.top+u-s,left:f.left+a-o}):f)},v.offset={bodyOffset:function(e){var t=e.offsetTop,n=e.offsetLeft;return v.support.doesNotIncludeMarginInBodyOffset&&(t+=parseFloat(v.css(e,"marginTop"))||0,n+=parseFloat(v.css(e,"marginLeft"))||0),{top:t,left:n}},setOffset:function(e,t,n){var r=v.css(e,"position");r==="static"&&(e.style.position="relative");var i=v(e),s=i.offset(),o=v.css(e,"top"),u=v.css(e,"left"),a=(r==="absolute"||r==="fixed")&&v.inArray("auto",[o,u])>-1,f={},l={},c,h;a?(l=i.position(),c=l.top,h=l.left):(c=parseFloat(o)||0,h=parseFloat(u)||0),v.isFunction(t)&&(t=t.call(e,n,s)),t.top!=null&&(f.top=t.top-s.top+c),t.left!=null&&(f.left=t.left-s.left+h),"using"in t?t.using.call(e,f):i.css(f)}},v.fn.extend({position:function(){if(!this[0])return;var e=this[0],t=this.offsetParent(),n=this.offset(),r=er.test(t[0].nodeName)?{top:0,left:0}:t.offset();return n.top-=parseFloat(v.css(e,"marginTop"))||0,n.left-=parseFloat(v.css(e,"marginLeft"))||0,r.top+=parseFloat(v.css(t[0],"borderTopWidth"))||0,r.left+=parseFloat(v.css(t[0],"borderLeftWidth"))||0,{top:n.top-r.top,left:n.left-r.left}},offsetParent:function(){return this.map(function(){var e=this.offsetParent||i.body;while(e&&!er.test(e.nodeName)&&v.css(e,"position")==="static")e=e.offsetParent;return e||i.body})}}),v.each({scrollLeft:"pageXOffset",scrollTop:"pageYOffset"},function(e,n){var r=/Y/.test(n);v.fn[e]=function(i){return v.access(this,function(e,i,s){var o=tr(e);if(s===t)return o?n in o?o[n]:o.document.documentElement[i]:e[i];o?o.scrollTo(r?v(o).scrollLeft():s,r?s:v(o).scrollTop()):e[i]=s},e,i,arguments.length,null)}}),v.each({Height:"height",Width:"width"},function(e,n){v.each({padding:"inner"+e,content:n,"":"outer"+e},function(r,i){v.fn[i]=function(i,s){var o=arguments.length&&(r||typeof i!="boolean"),u=r||(i===!0||s===!0?"margin":"border");return v.access(this,function(n,r,i){var s;return v.isWindow(n)?n.document.documentElement["client"+e]:n.nodeType===9?(s=n.documentElement,Math.max(n.body["scroll"+e],s["scroll"+e],n.body["offset"+e],s["offset"+e],s["client"+e])):i===t?v.css(n,r,i,u):v.style(n,r,i,u)},n,o?i:t,o,null)}})}),e.jQuery=e.$=v,typeof define=="function"&&define.amd&&define.amd.jQuery&&define("jquery",[],function(){return v})})(window); \ No newline at end of file +/*! jQuery v1.11.1 | (c) 2005, 2014 jQuery Foundation, Inc. | jquery.org/license */ +!function(a,b){"object"==typeof module&&"object"==typeof module.exports?module.exports=a.document?b(a,!0):function(a){if(!a.document)throw new Error("jQuery requires a window with a document");return b(a)}:b(a)}("undefined"!=typeof window?window:this,function(a,b){var c=[],d=c.slice,e=c.concat,f=c.push,g=c.indexOf,h={},i=h.toString,j=h.hasOwnProperty,k={},l="1.11.1",m=function(a,b){return new m.fn.init(a,b)},n=/^[\s\uFEFF\xA0]+|[\s\uFEFF\xA0]+$/g,o=/^-ms-/,p=/-([\da-z])/gi,q=function(a,b){return b.toUpperCase()};m.fn=m.prototype={jquery:l,constructor:m,selector:"",length:0,toArray:function(){return d.call(this)},get:function(a){return null!=a?0>a?this[a+this.length]:this[a]:d.call(this)},pushStack:function(a){var b=m.merge(this.constructor(),a);return b.prevObject=this,b.context=this.context,b},each:function(a,b){return m.each(this,a,b)},map:function(a){return this.pushStack(m.map(this,function(b,c){return a.call(b,c,b)}))},slice:function(){return this.pushStack(d.apply(this,arguments))},first:function(){return this.eq(0)},last:function(){return this.eq(-1)},eq:function(a){var b=this.length,c=+a+(0>a?b:0);return this.pushStack(c>=0&&b>c?[this[c]]:[])},end:function(){return this.prevObject||this.constructor(null)},push:f,sort:c.sort,splice:c.splice},m.extend=m.fn.extend=function(){var a,b,c,d,e,f,g=arguments[0]||{},h=1,i=arguments.length,j=!1;for("boolean"==typeof g&&(j=g,g=arguments[h]||{},h++),"object"==typeof g||m.isFunction(g)||(g={}),h===i&&(g=this,h--);i>h;h++)if(null!=(e=arguments[h]))for(d in e)a=g[d],c=e[d],g!==c&&(j&&c&&(m.isPlainObject(c)||(b=m.isArray(c)))?(b?(b=!1,f=a&&m.isArray(a)?a:[]):f=a&&m.isPlainObject(a)?a:{},g[d]=m.extend(j,f,c)):void 0!==c&&(g[d]=c));return g},m.extend({expando:"jQuery"+(l+Math.random()).replace(/\D/g,""),isReady:!0,error:function(a){throw new Error(a)},noop:function(){},isFunction:function(a){return"function"===m.type(a)},isArray:Array.isArray||function(a){return"array"===m.type(a)},isWindow:function(a){return null!=a&&a==a.window},isNumeric:function(a){return!m.isArray(a)&&a-parseFloat(a)>=0},isEmptyObject:function(a){var b;for(b in a)return!1;return!0},isPlainObject:function(a){var b;if(!a||"object"!==m.type(a)||a.nodeType||m.isWindow(a))return!1;try{if(a.constructor&&!j.call(a,"constructor")&&!j.call(a.constructor.prototype,"isPrototypeOf"))return!1}catch(c){return!1}if(k.ownLast)for(b in a)return j.call(a,b);for(b in a);return void 0===b||j.call(a,b)},type:function(a){return null==a?a+"":"object"==typeof a||"function"==typeof a?h[i.call(a)]||"object":typeof a},globalEval:function(b){b&&m.trim(b)&&(a.execScript||function(b){a.eval.call(a,b)})(b)},camelCase:function(a){return a.replace(o,"ms-").replace(p,q)},nodeName:function(a,b){return a.nodeName&&a.nodeName.toLowerCase()===b.toLowerCase()},each:function(a,b,c){var d,e=0,f=a.length,g=r(a);if(c){if(g){for(;f>e;e++)if(d=b.apply(a[e],c),d===!1)break}else for(e in a)if(d=b.apply(a[e],c),d===!1)break}else if(g){for(;f>e;e++)if(d=b.call(a[e],e,a[e]),d===!1)break}else for(e in a)if(d=b.call(a[e],e,a[e]),d===!1)break;return a},trim:function(a){return null==a?"":(a+"").replace(n,"")},makeArray:function(a,b){var c=b||[];return null!=a&&(r(Object(a))?m.merge(c,"string"==typeof a?[a]:a):f.call(c,a)),c},inArray:function(a,b,c){var d;if(b){if(g)return g.call(b,a,c);for(d=b.length,c=c?0>c?Math.max(0,d+c):c:0;d>c;c++)if(c in b&&b[c]===a)return c}return-1},merge:function(a,b){var c=+b.length,d=0,e=a.length;while(c>d)a[e++]=b[d++];if(c!==c)while(void 0!==b[d])a[e++]=b[d++];return a.length=e,a},grep:function(a,b,c){for(var d,e=[],f=0,g=a.length,h=!c;g>f;f++)d=!b(a[f],f),d!==h&&e.push(a[f]);return e},map:function(a,b,c){var d,f=0,g=a.length,h=r(a),i=[];if(h)for(;g>f;f++)d=b(a[f],f,c),null!=d&&i.push(d);else for(f in a)d=b(a[f],f,c),null!=d&&i.push(d);return e.apply([],i)},guid:1,proxy:function(a,b){var c,e,f;return"string"==typeof b&&(f=a[b],b=a,a=f),m.isFunction(a)?(c=d.call(arguments,2),e=function(){return a.apply(b||this,c.concat(d.call(arguments)))},e.guid=a.guid=a.guid||m.guid++,e):void 0},now:function(){return+new Date},support:k}),m.each("Boolean Number String Function Array Date RegExp Object Error".split(" "),function(a,b){h["[object "+b+"]"]=b.toLowerCase()});function r(a){var b=a.length,c=m.type(a);return"function"===c||m.isWindow(a)?!1:1===a.nodeType&&b?!0:"array"===c||0===b||"number"==typeof b&&b>0&&b-1 in a}var s=function(a){var b,c,d,e,f,g,h,i,j,k,l,m,n,o,p,q,r,s,t,u="sizzle"+-new Date,v=a.document,w=0,x=0,y=gb(),z=gb(),A=gb(),B=function(a,b){return a===b&&(l=!0),0},C="undefined",D=1<<31,E={}.hasOwnProperty,F=[],G=F.pop,H=F.push,I=F.push,J=F.slice,K=F.indexOf||function(a){for(var b=0,c=this.length;c>b;b++)if(this[b]===a)return b;return-1},L="checked|selected|async|autofocus|autoplay|controls|defer|disabled|hidden|ismap|loop|multiple|open|readonly|required|scoped",M="[\\x20\\t\\r\\n\\f]",N="(?:\\\\.|[\\w-]|[^\\x00-\\xa0])+",O=N.replace("w","w#"),P="\\["+M+"*("+N+")(?:"+M+"*([*^$|!~]?=)"+M+"*(?:'((?:\\\\.|[^\\\\'])*)'|\"((?:\\\\.|[^\\\\\"])*)\"|("+O+"))|)"+M+"*\\]",Q=":("+N+")(?:\\((('((?:\\\\.|[^\\\\'])*)'|\"((?:\\\\.|[^\\\\\"])*)\")|((?:\\\\.|[^\\\\()[\\]]|"+P+")*)|.*)\\)|)",R=new RegExp("^"+M+"+|((?:^|[^\\\\])(?:\\\\.)*)"+M+"+$","g"),S=new RegExp("^"+M+"*,"+M+"*"),T=new RegExp("^"+M+"*([>+~]|"+M+")"+M+"*"),U=new RegExp("="+M+"*([^\\]'\"]*?)"+M+"*\\]","g"),V=new RegExp(Q),W=new RegExp("^"+O+"$"),X={ID:new RegExp("^#("+N+")"),CLASS:new RegExp("^\\.("+N+")"),TAG:new RegExp("^("+N.replace("w","w*")+")"),ATTR:new RegExp("^"+P),PSEUDO:new RegExp("^"+Q),CHILD:new RegExp("^:(only|first|last|nth|nth-last)-(child|of-type)(?:\\("+M+"*(even|odd|(([+-]|)(\\d*)n|)"+M+"*(?:([+-]|)"+M+"*(\\d+)|))"+M+"*\\)|)","i"),bool:new RegExp("^(?:"+L+")$","i"),needsContext:new RegExp("^"+M+"*[>+~]|:(even|odd|eq|gt|lt|nth|first|last)(?:\\("+M+"*((?:-\\d)?\\d*)"+M+"*\\)|)(?=[^-]|$)","i")},Y=/^(?:input|select|textarea|button)$/i,Z=/^h\d$/i,$=/^[^{]+\{\s*\[native \w/,_=/^(?:#([\w-]+)|(\w+)|\.([\w-]+))$/,ab=/[+~]/,bb=/'|\\/g,cb=new RegExp("\\\\([\\da-f]{1,6}"+M+"?|("+M+")|.)","ig"),db=function(a,b,c){var d="0x"+b-65536;return d!==d||c?b:0>d?String.fromCharCode(d+65536):String.fromCharCode(d>>10|55296,1023&d|56320)};try{I.apply(F=J.call(v.childNodes),v.childNodes),F[v.childNodes.length].nodeType}catch(eb){I={apply:F.length?function(a,b){H.apply(a,J.call(b))}:function(a,b){var c=a.length,d=0;while(a[c++]=b[d++]);a.length=c-1}}}function fb(a,b,d,e){var f,h,j,k,l,o,r,s,w,x;if((b?b.ownerDocument||b:v)!==n&&m(b),b=b||n,d=d||[],!a||"string"!=typeof a)return d;if(1!==(k=b.nodeType)&&9!==k)return[];if(p&&!e){if(f=_.exec(a))if(j=f[1]){if(9===k){if(h=b.getElementById(j),!h||!h.parentNode)return d;if(h.id===j)return d.push(h),d}else if(b.ownerDocument&&(h=b.ownerDocument.getElementById(j))&&t(b,h)&&h.id===j)return d.push(h),d}else{if(f[2])return I.apply(d,b.getElementsByTagName(a)),d;if((j=f[3])&&c.getElementsByClassName&&b.getElementsByClassName)return I.apply(d,b.getElementsByClassName(j)),d}if(c.qsa&&(!q||!q.test(a))){if(s=r=u,w=b,x=9===k&&a,1===k&&"object"!==b.nodeName.toLowerCase()){o=g(a),(r=b.getAttribute("id"))?s=r.replace(bb,"\\$&"):b.setAttribute("id",s),s="[id='"+s+"'] ",l=o.length;while(l--)o[l]=s+qb(o[l]);w=ab.test(a)&&ob(b.parentNode)||b,x=o.join(",")}if(x)try{return I.apply(d,w.querySelectorAll(x)),d}catch(y){}finally{r||b.removeAttribute("id")}}}return i(a.replace(R,"$1"),b,d,e)}function gb(){var a=[];function b(c,e){return a.push(c+" ")>d.cacheLength&&delete b[a.shift()],b[c+" "]=e}return b}function hb(a){return a[u]=!0,a}function ib(a){var b=n.createElement("div");try{return!!a(b)}catch(c){return!1}finally{b.parentNode&&b.parentNode.removeChild(b),b=null}}function jb(a,b){var c=a.split("|"),e=a.length;while(e--)d.attrHandle[c[e]]=b}function kb(a,b){var c=b&&a,d=c&&1===a.nodeType&&1===b.nodeType&&(~b.sourceIndex||D)-(~a.sourceIndex||D);if(d)return d;if(c)while(c=c.nextSibling)if(c===b)return-1;return a?1:-1}function lb(a){return function(b){var c=b.nodeName.toLowerCase();return"input"===c&&b.type===a}}function mb(a){return function(b){var c=b.nodeName.toLowerCase();return("input"===c||"button"===c)&&b.type===a}}function nb(a){return hb(function(b){return b=+b,hb(function(c,d){var e,f=a([],c.length,b),g=f.length;while(g--)c[e=f[g]]&&(c[e]=!(d[e]=c[e]))})})}function ob(a){return a&&typeof a.getElementsByTagName!==C&&a}c=fb.support={},f=fb.isXML=function(a){var b=a&&(a.ownerDocument||a).documentElement;return b?"HTML"!==b.nodeName:!1},m=fb.setDocument=function(a){var b,e=a?a.ownerDocument||a:v,g=e.defaultView;return e!==n&&9===e.nodeType&&e.documentElement?(n=e,o=e.documentElement,p=!f(e),g&&g!==g.top&&(g.addEventListener?g.addEventListener("unload",function(){m()},!1):g.attachEvent&&g.attachEvent("onunload",function(){m()})),c.attributes=ib(function(a){return a.className="i",!a.getAttribute("className")}),c.getElementsByTagName=ib(function(a){return a.appendChild(e.createComment("")),!a.getElementsByTagName("*").length}),c.getElementsByClassName=$.test(e.getElementsByClassName)&&ib(function(a){return a.innerHTML="<div class='a'></div><div class='a i'></div>",a.firstChild.className="i",2===a.getElementsByClassName("i").length}),c.getById=ib(function(a){return o.appendChild(a).id=u,!e.getElementsByName||!e.getElementsByName(u).length}),c.getById?(d.find.ID=function(a,b){if(typeof b.getElementById!==C&&p){var c=b.getElementById(a);return c&&c.parentNode?[c]:[]}},d.filter.ID=function(a){var b=a.replace(cb,db);return function(a){return a.getAttribute("id")===b}}):(delete d.find.ID,d.filter.ID=function(a){var b=a.replace(cb,db);return function(a){var c=typeof a.getAttributeNode!==C&&a.getAttributeNode("id");return c&&c.value===b}}),d.find.TAG=c.getElementsByTagName?function(a,b){return typeof b.getElementsByTagName!==C?b.getElementsByTagName(a):void 0}:function(a,b){var c,d=[],e=0,f=b.getElementsByTagName(a);if("*"===a){while(c=f[e++])1===c.nodeType&&d.push(c);return d}return f},d.find.CLASS=c.getElementsByClassName&&function(a,b){return typeof b.getElementsByClassName!==C&&p?b.getElementsByClassName(a):void 0},r=[],q=[],(c.qsa=$.test(e.querySelectorAll))&&(ib(function(a){a.innerHTML="<select msallowclip=''><option selected=''></option></select>",a.querySelectorAll("[msallowclip^='']").length&&q.push("[*^$]="+M+"*(?:''|\"\")"),a.querySelectorAll("[selected]").length||q.push("\\["+M+"*(?:value|"+L+")"),a.querySelectorAll(":checked").length||q.push(":checked")}),ib(function(a){var b=e.createElement("input");b.setAttribute("type","hidden"),a.appendChild(b).setAttribute("name","D"),a.querySelectorAll("[name=d]").length&&q.push("name"+M+"*[*^$|!~]?="),a.querySelectorAll(":enabled").length||q.push(":enabled",":disabled"),a.querySelectorAll("*,:x"),q.push(",.*:")})),(c.matchesSelector=$.test(s=o.matches||o.webkitMatchesSelector||o.mozMatchesSelector||o.oMatchesSelector||o.msMatchesSelector))&&ib(function(a){c.disconnectedMatch=s.call(a,"div"),s.call(a,"[s!='']:x"),r.push("!=",Q)}),q=q.length&&new RegExp(q.join("|")),r=r.length&&new RegExp(r.join("|")),b=$.test(o.compareDocumentPosition),t=b||$.test(o.contains)?function(a,b){var c=9===a.nodeType?a.documentElement:a,d=b&&b.parentNode;return a===d||!(!d||1!==d.nodeType||!(c.contains?c.contains(d):a.compareDocumentPosition&&16&a.compareDocumentPosition(d)))}:function(a,b){if(b)while(b=b.parentNode)if(b===a)return!0;return!1},B=b?function(a,b){if(a===b)return l=!0,0;var d=!a.compareDocumentPosition-!b.compareDocumentPosition;return d?d:(d=(a.ownerDocument||a)===(b.ownerDocument||b)?a.compareDocumentPosition(b):1,1&d||!c.sortDetached&&b.compareDocumentPosition(a)===d?a===e||a.ownerDocument===v&&t(v,a)?-1:b===e||b.ownerDocument===v&&t(v,b)?1:k?K.call(k,a)-K.call(k,b):0:4&d?-1:1)}:function(a,b){if(a===b)return l=!0,0;var c,d=0,f=a.parentNode,g=b.parentNode,h=[a],i=[b];if(!f||!g)return a===e?-1:b===e?1:f?-1:g?1:k?K.call(k,a)-K.call(k,b):0;if(f===g)return kb(a,b);c=a;while(c=c.parentNode)h.unshift(c);c=b;while(c=c.parentNode)i.unshift(c);while(h[d]===i[d])d++;return d?kb(h[d],i[d]):h[d]===v?-1:i[d]===v?1:0},e):n},fb.matches=function(a,b){return fb(a,null,null,b)},fb.matchesSelector=function(a,b){if((a.ownerDocument||a)!==n&&m(a),b=b.replace(U,"='$1']"),!(!c.matchesSelector||!p||r&&r.test(b)||q&&q.test(b)))try{var d=s.call(a,b);if(d||c.disconnectedMatch||a.document&&11!==a.document.nodeType)return d}catch(e){}return fb(b,n,null,[a]).length>0},fb.contains=function(a,b){return(a.ownerDocument||a)!==n&&m(a),t(a,b)},fb.attr=function(a,b){(a.ownerDocument||a)!==n&&m(a);var e=d.attrHandle[b.toLowerCase()],f=e&&E.call(d.attrHandle,b.toLowerCase())?e(a,b,!p):void 0;return void 0!==f?f:c.attributes||!p?a.getAttribute(b):(f=a.getAttributeNode(b))&&f.specified?f.value:null},fb.error=function(a){throw new Error("Syntax error, unrecognized expression: "+a)},fb.uniqueSort=function(a){var b,d=[],e=0,f=0;if(l=!c.detectDuplicates,k=!c.sortStable&&a.slice(0),a.sort(B),l){while(b=a[f++])b===a[f]&&(e=d.push(f));while(e--)a.splice(d[e],1)}return k=null,a},e=fb.getText=function(a){var b,c="",d=0,f=a.nodeType;if(f){if(1===f||9===f||11===f){if("string"==typeof a.textContent)return a.textContent;for(a=a.firstChild;a;a=a.nextSibling)c+=e(a)}else if(3===f||4===f)return a.nodeValue}else while(b=a[d++])c+=e(b);return c},d=fb.selectors={cacheLength:50,createPseudo:hb,match:X,attrHandle:{},find:{},relative:{">":{dir:"parentNode",first:!0}," ":{dir:"parentNode"},"+":{dir:"previousSibling",first:!0},"~":{dir:"previousSibling"}},preFilter:{ATTR:function(a){return a[1]=a[1].replace(cb,db),a[3]=(a[3]||a[4]||a[5]||"").replace(cb,db),"~="===a[2]&&(a[3]=" "+a[3]+" "),a.slice(0,4)},CHILD:function(a){return a[1]=a[1].toLowerCase(),"nth"===a[1].slice(0,3)?(a[3]||fb.error(a[0]),a[4]=+(a[4]?a[5]+(a[6]||1):2*("even"===a[3]||"odd"===a[3])),a[5]=+(a[7]+a[8]||"odd"===a[3])):a[3]&&fb.error(a[0]),a},PSEUDO:function(a){var b,c=!a[6]&&a[2];return X.CHILD.test(a[0])?null:(a[3]?a[2]=a[4]||a[5]||"":c&&V.test(c)&&(b=g(c,!0))&&(b=c.indexOf(")",c.length-b)-c.length)&&(a[0]=a[0].slice(0,b),a[2]=c.slice(0,b)),a.slice(0,3))}},filter:{TAG:function(a){var b=a.replace(cb,db).toLowerCase();return"*"===a?function(){return!0}:function(a){return a.nodeName&&a.nodeName.toLowerCase()===b}},CLASS:function(a){var b=y[a+" "];return b||(b=new RegExp("(^|"+M+")"+a+"("+M+"|$)"))&&y(a,function(a){return b.test("string"==typeof a.className&&a.className||typeof a.getAttribute!==C&&a.getAttribute("class")||"")})},ATTR:function(a,b,c){return function(d){var e=fb.attr(d,a);return null==e?"!="===b:b?(e+="","="===b?e===c:"!="===b?e!==c:"^="===b?c&&0===e.indexOf(c):"*="===b?c&&e.indexOf(c)>-1:"$="===b?c&&e.slice(-c.length)===c:"~="===b?(" "+e+" ").indexOf(c)>-1:"|="===b?e===c||e.slice(0,c.length+1)===c+"-":!1):!0}},CHILD:function(a,b,c,d,e){var f="nth"!==a.slice(0,3),g="last"!==a.slice(-4),h="of-type"===b;return 1===d&&0===e?function(a){return!!a.parentNode}:function(b,c,i){var j,k,l,m,n,o,p=f!==g?"nextSibling":"previousSibling",q=b.parentNode,r=h&&b.nodeName.toLowerCase(),s=!i&&!h;if(q){if(f){while(p){l=b;while(l=l[p])if(h?l.nodeName.toLowerCase()===r:1===l.nodeType)return!1;o=p="only"===a&&!o&&"nextSibling"}return!0}if(o=[g?q.firstChild:q.lastChild],g&&s){k=q[u]||(q[u]={}),j=k[a]||[],n=j[0]===w&&j[1],m=j[0]===w&&j[2],l=n&&q.childNodes[n];while(l=++n&&l&&l[p]||(m=n=0)||o.pop())if(1===l.nodeType&&++m&&l===b){k[a]=[w,n,m];break}}else if(s&&(j=(b[u]||(b[u]={}))[a])&&j[0]===w)m=j[1];else while(l=++n&&l&&l[p]||(m=n=0)||o.pop())if((h?l.nodeName.toLowerCase()===r:1===l.nodeType)&&++m&&(s&&((l[u]||(l[u]={}))[a]=[w,m]),l===b))break;return m-=e,m===d||m%d===0&&m/d>=0}}},PSEUDO:function(a,b){var c,e=d.pseudos[a]||d.setFilters[a.toLowerCase()]||fb.error("unsupported pseudo: "+a);return e[u]?e(b):e.length>1?(c=[a,a,"",b],d.setFilters.hasOwnProperty(a.toLowerCase())?hb(function(a,c){var d,f=e(a,b),g=f.length;while(g--)d=K.call(a,f[g]),a[d]=!(c[d]=f[g])}):function(a){return e(a,0,c)}):e}},pseudos:{not:hb(function(a){var b=[],c=[],d=h(a.replace(R,"$1"));return d[u]?hb(function(a,b,c,e){var f,g=d(a,null,e,[]),h=a.length;while(h--)(f=g[h])&&(a[h]=!(b[h]=f))}):function(a,e,f){return b[0]=a,d(b,null,f,c),!c.pop()}}),has:hb(function(a){return function(b){return fb(a,b).length>0}}),contains:hb(function(a){return function(b){return(b.textContent||b.innerText||e(b)).indexOf(a)>-1}}),lang:hb(function(a){return W.test(a||"")||fb.error("unsupported lang: "+a),a=a.replace(cb,db).toLowerCase(),function(b){var c;do if(c=p?b.lang:b.getAttribute("xml:lang")||b.getAttribute("lang"))return c=c.toLowerCase(),c===a||0===c.indexOf(a+"-");while((b=b.parentNode)&&1===b.nodeType);return!1}}),target:function(b){var c=a.location&&a.location.hash;return c&&c.slice(1)===b.id},root:function(a){return a===o},focus:function(a){return a===n.activeElement&&(!n.hasFocus||n.hasFocus())&&!!(a.type||a.href||~a.tabIndex)},enabled:function(a){return a.disabled===!1},disabled:function(a){return a.disabled===!0},checked:function(a){var b=a.nodeName.toLowerCase();return"input"===b&&!!a.checked||"option"===b&&!!a.selected},selected:function(a){return a.parentNode&&a.parentNode.selectedIndex,a.selected===!0},empty:function(a){for(a=a.firstChild;a;a=a.nextSibling)if(a.nodeType<6)return!1;return!0},parent:function(a){return!d.pseudos.empty(a)},header:function(a){return Z.test(a.nodeName)},input:function(a){return Y.test(a.nodeName)},button:function(a){var b=a.nodeName.toLowerCase();return"input"===b&&"button"===a.type||"button"===b},text:function(a){var b;return"input"===a.nodeName.toLowerCase()&&"text"===a.type&&(null==(b=a.getAttribute("type"))||"text"===b.toLowerCase())},first:nb(function(){return[0]}),last:nb(function(a,b){return[b-1]}),eq:nb(function(a,b,c){return[0>c?c+b:c]}),even:nb(function(a,b){for(var c=0;b>c;c+=2)a.push(c);return a}),odd:nb(function(a,b){for(var c=1;b>c;c+=2)a.push(c);return a}),lt:nb(function(a,b,c){for(var d=0>c?c+b:c;--d>=0;)a.push(d);return a}),gt:nb(function(a,b,c){for(var d=0>c?c+b:c;++d<b;)a.push(d);return a})}},d.pseudos.nth=d.pseudos.eq;for(b in{radio:!0,checkbox:!0,file:!0,password:!0,image:!0})d.pseudos[b]=lb(b);for(b in{submit:!0,reset:!0})d.pseudos[b]=mb(b);function pb(){}pb.prototype=d.filters=d.pseudos,d.setFilters=new pb,g=fb.tokenize=function(a,b){var c,e,f,g,h,i,j,k=z[a+" "];if(k)return b?0:k.slice(0);h=a,i=[],j=d.preFilter;while(h){(!c||(e=S.exec(h)))&&(e&&(h=h.slice(e[0].length)||h),i.push(f=[])),c=!1,(e=T.exec(h))&&(c=e.shift(),f.push({value:c,type:e[0].replace(R," ")}),h=h.slice(c.length));for(g in d.filter)!(e=X[g].exec(h))||j[g]&&!(e=j[g](e))||(c=e.shift(),f.push({value:c,type:g,matches:e}),h=h.slice(c.length));if(!c)break}return b?h.length:h?fb.error(a):z(a,i).slice(0)};function qb(a){for(var b=0,c=a.length,d="";c>b;b++)d+=a[b].value;return d}function rb(a,b,c){var d=b.dir,e=c&&"parentNode"===d,f=x++;return b.first?function(b,c,f){while(b=b[d])if(1===b.nodeType||e)return a(b,c,f)}:function(b,c,g){var h,i,j=[w,f];if(g){while(b=b[d])if((1===b.nodeType||e)&&a(b,c,g))return!0}else while(b=b[d])if(1===b.nodeType||e){if(i=b[u]||(b[u]={}),(h=i[d])&&h[0]===w&&h[1]===f)return j[2]=h[2];if(i[d]=j,j[2]=a(b,c,g))return!0}}}function sb(a){return a.length>1?function(b,c,d){var e=a.length;while(e--)if(!a[e](b,c,d))return!1;return!0}:a[0]}function tb(a,b,c){for(var d=0,e=b.length;e>d;d++)fb(a,b[d],c);return c}function ub(a,b,c,d,e){for(var f,g=[],h=0,i=a.length,j=null!=b;i>h;h++)(f=a[h])&&(!c||c(f,d,e))&&(g.push(f),j&&b.push(h));return g}function vb(a,b,c,d,e,f){return d&&!d[u]&&(d=vb(d)),e&&!e[u]&&(e=vb(e,f)),hb(function(f,g,h,i){var j,k,l,m=[],n=[],o=g.length,p=f||tb(b||"*",h.nodeType?[h]:h,[]),q=!a||!f&&b?p:ub(p,m,a,h,i),r=c?e||(f?a:o||d)?[]:g:q;if(c&&c(q,r,h,i),d){j=ub(r,n),d(j,[],h,i),k=j.length;while(k--)(l=j[k])&&(r[n[k]]=!(q[n[k]]=l))}if(f){if(e||a){if(e){j=[],k=r.length;while(k--)(l=r[k])&&j.push(q[k]=l);e(null,r=[],j,i)}k=r.length;while(k--)(l=r[k])&&(j=e?K.call(f,l):m[k])>-1&&(f[j]=!(g[j]=l))}}else r=ub(r===g?r.splice(o,r.length):r),e?e(null,g,r,i):I.apply(g,r)})}function wb(a){for(var b,c,e,f=a.length,g=d.relative[a[0].type],h=g||d.relative[" "],i=g?1:0,k=rb(function(a){return a===b},h,!0),l=rb(function(a){return K.call(b,a)>-1},h,!0),m=[function(a,c,d){return!g&&(d||c!==j)||((b=c).nodeType?k(a,c,d):l(a,c,d))}];f>i;i++)if(c=d.relative[a[i].type])m=[rb(sb(m),c)];else{if(c=d.filter[a[i].type].apply(null,a[i].matches),c[u]){for(e=++i;f>e;e++)if(d.relative[a[e].type])break;return vb(i>1&&sb(m),i>1&&qb(a.slice(0,i-1).concat({value:" "===a[i-2].type?"*":""})).replace(R,"$1"),c,e>i&&wb(a.slice(i,e)),f>e&&wb(a=a.slice(e)),f>e&&qb(a))}m.push(c)}return sb(m)}function xb(a,b){var c=b.length>0,e=a.length>0,f=function(f,g,h,i,k){var l,m,o,p=0,q="0",r=f&&[],s=[],t=j,u=f||e&&d.find.TAG("*",k),v=w+=null==t?1:Math.random()||.1,x=u.length;for(k&&(j=g!==n&&g);q!==x&&null!=(l=u[q]);q++){if(e&&l){m=0;while(o=a[m++])if(o(l,g,h)){i.push(l);break}k&&(w=v)}c&&((l=!o&&l)&&p--,f&&r.push(l))}if(p+=q,c&&q!==p){m=0;while(o=b[m++])o(r,s,g,h);if(f){if(p>0)while(q--)r[q]||s[q]||(s[q]=G.call(i));s=ub(s)}I.apply(i,s),k&&!f&&s.length>0&&p+b.length>1&&fb.uniqueSort(i)}return k&&(w=v,j=t),r};return c?hb(f):f}return h=fb.compile=function(a,b){var c,d=[],e=[],f=A[a+" "];if(!f){b||(b=g(a)),c=b.length;while(c--)f=wb(b[c]),f[u]?d.push(f):e.push(f);f=A(a,xb(e,d)),f.selector=a}return f},i=fb.select=function(a,b,e,f){var i,j,k,l,m,n="function"==typeof a&&a,o=!f&&g(a=n.selector||a);if(e=e||[],1===o.length){if(j=o[0]=o[0].slice(0),j.length>2&&"ID"===(k=j[0]).type&&c.getById&&9===b.nodeType&&p&&d.relative[j[1].type]){if(b=(d.find.ID(k.matches[0].replace(cb,db),b)||[])[0],!b)return e;n&&(b=b.parentNode),a=a.slice(j.shift().value.length)}i=X.needsContext.test(a)?0:j.length;while(i--){if(k=j[i],d.relative[l=k.type])break;if((m=d.find[l])&&(f=m(k.matches[0].replace(cb,db),ab.test(j[0].type)&&ob(b.parentNode)||b))){if(j.splice(i,1),a=f.length&&qb(j),!a)return I.apply(e,f),e;break}}}return(n||h(a,o))(f,b,!p,e,ab.test(a)&&ob(b.parentNode)||b),e},c.sortStable=u.split("").sort(B).join("")===u,c.detectDuplicates=!!l,m(),c.sortDetached=ib(function(a){return 1&a.compareDocumentPosition(n.createElement("div"))}),ib(function(a){return a.innerHTML="<a href='#'></a>","#"===a.firstChild.getAttribute("href")})||jb("type|href|height|width",function(a,b,c){return c?void 0:a.getAttribute(b,"type"===b.toLowerCase()?1:2)}),c.attributes&&ib(function(a){return a.innerHTML="<input/>",a.firstChild.setAttribute("value",""),""===a.firstChild.getAttribute("value")})||jb("value",function(a,b,c){return c||"input"!==a.nodeName.toLowerCase()?void 0:a.defaultValue}),ib(function(a){return null==a.getAttribute("disabled")})||jb(L,function(a,b,c){var d;return c?void 0:a[b]===!0?b.toLowerCase():(d=a.getAttributeNode(b))&&d.specified?d.value:null}),fb}(a);m.find=s,m.expr=s.selectors,m.expr[":"]=m.expr.pseudos,m.unique=s.uniqueSort,m.text=s.getText,m.isXMLDoc=s.isXML,m.contains=s.contains;var t=m.expr.match.needsContext,u=/^<(\w+)\s*\/?>(?:<\/\1>|)$/,v=/^.[^:#\[\.,]*$/;function w(a,b,c){if(m.isFunction(b))return m.grep(a,function(a,d){return!!b.call(a,d,a)!==c});if(b.nodeType)return m.grep(a,function(a){return a===b!==c});if("string"==typeof b){if(v.test(b))return m.filter(b,a,c);b=m.filter(b,a)}return m.grep(a,function(a){return m.inArray(a,b)>=0!==c})}m.filter=function(a,b,c){var d=b[0];return c&&(a=":not("+a+")"),1===b.length&&1===d.nodeType?m.find.matchesSelector(d,a)?[d]:[]:m.find.matches(a,m.grep(b,function(a){return 1===a.nodeType}))},m.fn.extend({find:function(a){var b,c=[],d=this,e=d.length;if("string"!=typeof a)return this.pushStack(m(a).filter(function(){for(b=0;e>b;b++)if(m.contains(d[b],this))return!0}));for(b=0;e>b;b++)m.find(a,d[b],c);return c=this.pushStack(e>1?m.unique(c):c),c.selector=this.selector?this.selector+" "+a:a,c},filter:function(a){return this.pushStack(w(this,a||[],!1))},not:function(a){return this.pushStack(w(this,a||[],!0))},is:function(a){return!!w(this,"string"==typeof a&&t.test(a)?m(a):a||[],!1).length}});var x,y=a.document,z=/^(?:\s*(<[\w\W]+>)[^>]*|#([\w-]*))$/,A=m.fn.init=function(a,b){var c,d;if(!a)return this;if("string"==typeof a){if(c="<"===a.charAt(0)&&">"===a.charAt(a.length-1)&&a.length>=3?[null,a,null]:z.exec(a),!c||!c[1]&&b)return!b||b.jquery?(b||x).find(a):this.constructor(b).find(a);if(c[1]){if(b=b instanceof m?b[0]:b,m.merge(this,m.parseHTML(c[1],b&&b.nodeType?b.ownerDocument||b:y,!0)),u.test(c[1])&&m.isPlainObject(b))for(c in b)m.isFunction(this[c])?this[c](b[c]):this.attr(c,b[c]);return this}if(d=y.getElementById(c[2]),d&&d.parentNode){if(d.id!==c[2])return x.find(a);this.length=1,this[0]=d}return this.context=y,this.selector=a,this}return a.nodeType?(this.context=this[0]=a,this.length=1,this):m.isFunction(a)?"undefined"!=typeof x.ready?x.ready(a):a(m):(void 0!==a.selector&&(this.selector=a.selector,this.context=a.context),m.makeArray(a,this))};A.prototype=m.fn,x=m(y);var B=/^(?:parents|prev(?:Until|All))/,C={children:!0,contents:!0,next:!0,prev:!0};m.extend({dir:function(a,b,c){var d=[],e=a[b];while(e&&9!==e.nodeType&&(void 0===c||1!==e.nodeType||!m(e).is(c)))1===e.nodeType&&d.push(e),e=e[b];return d},sibling:function(a,b){for(var c=[];a;a=a.nextSibling)1===a.nodeType&&a!==b&&c.push(a);return c}}),m.fn.extend({has:function(a){var b,c=m(a,this),d=c.length;return this.filter(function(){for(b=0;d>b;b++)if(m.contains(this,c[b]))return!0})},closest:function(a,b){for(var c,d=0,e=this.length,f=[],g=t.test(a)||"string"!=typeof a?m(a,b||this.context):0;e>d;d++)for(c=this[d];c&&c!==b;c=c.parentNode)if(c.nodeType<11&&(g?g.index(c)>-1:1===c.nodeType&&m.find.matchesSelector(c,a))){f.push(c);break}return this.pushStack(f.length>1?m.unique(f):f)},index:function(a){return a?"string"==typeof a?m.inArray(this[0],m(a)):m.inArray(a.jquery?a[0]:a,this):this[0]&&this[0].parentNode?this.first().prevAll().length:-1},add:function(a,b){return this.pushStack(m.unique(m.merge(this.get(),m(a,b))))},addBack:function(a){return this.add(null==a?this.prevObject:this.prevObject.filter(a))}});function D(a,b){do a=a[b];while(a&&1!==a.nodeType);return a}m.each({parent:function(a){var b=a.parentNode;return b&&11!==b.nodeType?b:null},parents:function(a){return m.dir(a,"parentNode")},parentsUntil:function(a,b,c){return m.dir(a,"parentNode",c)},next:function(a){return D(a,"nextSibling")},prev:function(a){return D(a,"previousSibling")},nextAll:function(a){return m.dir(a,"nextSibling")},prevAll:function(a){return m.dir(a,"previousSibling")},nextUntil:function(a,b,c){return m.dir(a,"nextSibling",c)},prevUntil:function(a,b,c){return m.dir(a,"previousSibling",c)},siblings:function(a){return m.sibling((a.parentNode||{}).firstChild,a)},children:function(a){return m.sibling(a.firstChild)},contents:function(a){return m.nodeName(a,"iframe")?a.contentDocument||a.contentWindow.document:m.merge([],a.childNodes)}},function(a,b){m.fn[a]=function(c,d){var e=m.map(this,b,c);return"Until"!==a.slice(-5)&&(d=c),d&&"string"==typeof d&&(e=m.filter(d,e)),this.length>1&&(C[a]||(e=m.unique(e)),B.test(a)&&(e=e.reverse())),this.pushStack(e)}});var E=/\S+/g,F={};function G(a){var b=F[a]={};return m.each(a.match(E)||[],function(a,c){b[c]=!0}),b}m.Callbacks=function(a){a="string"==typeof a?F[a]||G(a):m.extend({},a);var b,c,d,e,f,g,h=[],i=!a.once&&[],j=function(l){for(c=a.memory&&l,d=!0,f=g||0,g=0,e=h.length,b=!0;h&&e>f;f++)if(h[f].apply(l[0],l[1])===!1&&a.stopOnFalse){c=!1;break}b=!1,h&&(i?i.length&&j(i.shift()):c?h=[]:k.disable())},k={add:function(){if(h){var d=h.length;!function f(b){m.each(b,function(b,c){var d=m.type(c);"function"===d?a.unique&&k.has(c)||h.push(c):c&&c.length&&"string"!==d&&f(c)})}(arguments),b?e=h.length:c&&(g=d,j(c))}return this},remove:function(){return h&&m.each(arguments,function(a,c){var d;while((d=m.inArray(c,h,d))>-1)h.splice(d,1),b&&(e>=d&&e--,f>=d&&f--)}),this},has:function(a){return a?m.inArray(a,h)>-1:!(!h||!h.length)},empty:function(){return h=[],e=0,this},disable:function(){return h=i=c=void 0,this},disabled:function(){return!h},lock:function(){return i=void 0,c||k.disable(),this},locked:function(){return!i},fireWith:function(a,c){return!h||d&&!i||(c=c||[],c=[a,c.slice?c.slice():c],b?i.push(c):j(c)),this},fire:function(){return k.fireWith(this,arguments),this},fired:function(){return!!d}};return k},m.extend({Deferred:function(a){var b=[["resolve","done",m.Callbacks("once memory"),"resolved"],["reject","fail",m.Callbacks("once memory"),"rejected"],["notify","progress",m.Callbacks("memory")]],c="pending",d={state:function(){return c},always:function(){return e.done(arguments).fail(arguments),this},then:function(){var a=arguments;return m.Deferred(function(c){m.each(b,function(b,f){var g=m.isFunction(a[b])&&a[b];e[f[1]](function(){var a=g&&g.apply(this,arguments);a&&m.isFunction(a.promise)?a.promise().done(c.resolve).fail(c.reject).progress(c.notify):c[f[0]+"With"](this===d?c.promise():this,g?[a]:arguments)})}),a=null}).promise()},promise:function(a){return null!=a?m.extend(a,d):d}},e={};return d.pipe=d.then,m.each(b,function(a,f){var g=f[2],h=f[3];d[f[1]]=g.add,h&&g.add(function(){c=h},b[1^a][2].disable,b[2][2].lock),e[f[0]]=function(){return e[f[0]+"With"](this===e?d:this,arguments),this},e[f[0]+"With"]=g.fireWith}),d.promise(e),a&&a.call(e,e),e},when:function(a){var b=0,c=d.call(arguments),e=c.length,f=1!==e||a&&m.isFunction(a.promise)?e:0,g=1===f?a:m.Deferred(),h=function(a,b,c){return function(e){b[a]=this,c[a]=arguments.length>1?d.call(arguments):e,c===i?g.notifyWith(b,c):--f||g.resolveWith(b,c)}},i,j,k;if(e>1)for(i=new Array(e),j=new Array(e),k=new Array(e);e>b;b++)c[b]&&m.isFunction(c[b].promise)?c[b].promise().done(h(b,k,c)).fail(g.reject).progress(h(b,j,i)):--f;return f||g.resolveWith(k,c),g.promise()}});var H;m.fn.ready=function(a){return m.ready.promise().done(a),this},m.extend({isReady:!1,readyWait:1,holdReady:function(a){a?m.readyWait++:m.ready(!0)},ready:function(a){if(a===!0?!--m.readyWait:!m.isReady){if(!y.body)return setTimeout(m.ready);m.isReady=!0,a!==!0&&--m.readyWait>0||(H.resolveWith(y,[m]),m.fn.triggerHandler&&(m(y).triggerHandler("ready"),m(y).off("ready")))}}});function I(){y.addEventListener?(y.removeEventListener("DOMContentLoaded",J,!1),a.removeEventListener("load",J,!1)):(y.detachEvent("onreadystatechange",J),a.detachEvent("onload",J))}function J(){(y.addEventListener||"load"===event.type||"complete"===y.readyState)&&(I(),m.ready())}m.ready.promise=function(b){if(!H)if(H=m.Deferred(),"complete"===y.readyState)setTimeout(m.ready);else if(y.addEventListener)y.addEventListener("DOMContentLoaded",J,!1),a.addEventListener("load",J,!1);else{y.attachEvent("onreadystatechange",J),a.attachEvent("onload",J);var c=!1;try{c=null==a.frameElement&&y.documentElement}catch(d){}c&&c.doScroll&&!function e(){if(!m.isReady){try{c.doScroll("left")}catch(a){return setTimeout(e,50)}I(),m.ready()}}()}return H.promise(b)};var K="undefined",L;for(L in m(k))break;k.ownLast="0"!==L,k.inlineBlockNeedsLayout=!1,m(function(){var a,b,c,d;c=y.getElementsByTagName("body")[0],c&&c.style&&(b=y.createElement("div"),d=y.createElement("div"),d.style.cssText="position:absolute;border:0;width:0;height:0;top:0;left:-9999px",c.appendChild(d).appendChild(b),typeof b.style.zoom!==K&&(b.style.cssText="display:inline;margin:0;border:0;padding:1px;width:1px;zoom:1",k.inlineBlockNeedsLayout=a=3===b.offsetWidth,a&&(c.style.zoom=1)),c.removeChild(d))}),function(){var a=y.createElement("div");if(null==k.deleteExpando){k.deleteExpando=!0;try{delete a.test}catch(b){k.deleteExpando=!1}}a=null}(),m.acceptData=function(a){var b=m.noData[(a.nodeName+" ").toLowerCase()],c=+a.nodeType||1;return 1!==c&&9!==c?!1:!b||b!==!0&&a.getAttribute("classid")===b};var M=/^(?:\{[\w\W]*\}|\[[\w\W]*\])$/,N=/([A-Z])/g;function O(a,b,c){if(void 0===c&&1===a.nodeType){var d="data-"+b.replace(N,"-$1").toLowerCase();if(c=a.getAttribute(d),"string"==typeof c){try{c="true"===c?!0:"false"===c?!1:"null"===c?null:+c+""===c?+c:M.test(c)?m.parseJSON(c):c}catch(e){}m.data(a,b,c)}else c=void 0}return c}function P(a){var b;for(b in a)if(("data"!==b||!m.isEmptyObject(a[b]))&&"toJSON"!==b)return!1;return!0}function Q(a,b,d,e){if(m.acceptData(a)){var f,g,h=m.expando,i=a.nodeType,j=i?m.cache:a,k=i?a[h]:a[h]&&h; +if(k&&j[k]&&(e||j[k].data)||void 0!==d||"string"!=typeof b)return k||(k=i?a[h]=c.pop()||m.guid++:h),j[k]||(j[k]=i?{}:{toJSON:m.noop}),("object"==typeof b||"function"==typeof b)&&(e?j[k]=m.extend(j[k],b):j[k].data=m.extend(j[k].data,b)),g=j[k],e||(g.data||(g.data={}),g=g.data),void 0!==d&&(g[m.camelCase(b)]=d),"string"==typeof b?(f=g[b],null==f&&(f=g[m.camelCase(b)])):f=g,f}}function R(a,b,c){if(m.acceptData(a)){var d,e,f=a.nodeType,g=f?m.cache:a,h=f?a[m.expando]:m.expando;if(g[h]){if(b&&(d=c?g[h]:g[h].data)){m.isArray(b)?b=b.concat(m.map(b,m.camelCase)):b in d?b=[b]:(b=m.camelCase(b),b=b in d?[b]:b.split(" ")),e=b.length;while(e--)delete d[b[e]];if(c?!P(d):!m.isEmptyObject(d))return}(c||(delete g[h].data,P(g[h])))&&(f?m.cleanData([a],!0):k.deleteExpando||g!=g.window?delete g[h]:g[h]=null)}}}m.extend({cache:{},noData:{"applet ":!0,"embed ":!0,"object ":"clsid:D27CDB6E-AE6D-11cf-96B8-444553540000"},hasData:function(a){return a=a.nodeType?m.cache[a[m.expando]]:a[m.expando],!!a&&!P(a)},data:function(a,b,c){return Q(a,b,c)},removeData:function(a,b){return R(a,b)},_data:function(a,b,c){return Q(a,b,c,!0)},_removeData:function(a,b){return R(a,b,!0)}}),m.fn.extend({data:function(a,b){var c,d,e,f=this[0],g=f&&f.attributes;if(void 0===a){if(this.length&&(e=m.data(f),1===f.nodeType&&!m._data(f,"parsedAttrs"))){c=g.length;while(c--)g[c]&&(d=g[c].name,0===d.indexOf("data-")&&(d=m.camelCase(d.slice(5)),O(f,d,e[d])));m._data(f,"parsedAttrs",!0)}return e}return"object"==typeof a?this.each(function(){m.data(this,a)}):arguments.length>1?this.each(function(){m.data(this,a,b)}):f?O(f,a,m.data(f,a)):void 0},removeData:function(a){return this.each(function(){m.removeData(this,a)})}}),m.extend({queue:function(a,b,c){var d;return a?(b=(b||"fx")+"queue",d=m._data(a,b),c&&(!d||m.isArray(c)?d=m._data(a,b,m.makeArray(c)):d.push(c)),d||[]):void 0},dequeue:function(a,b){b=b||"fx";var c=m.queue(a,b),d=c.length,e=c.shift(),f=m._queueHooks(a,b),g=function(){m.dequeue(a,b)};"inprogress"===e&&(e=c.shift(),d--),e&&("fx"===b&&c.unshift("inprogress"),delete f.stop,e.call(a,g,f)),!d&&f&&f.empty.fire()},_queueHooks:function(a,b){var c=b+"queueHooks";return m._data(a,c)||m._data(a,c,{empty:m.Callbacks("once memory").add(function(){m._removeData(a,b+"queue"),m._removeData(a,c)})})}}),m.fn.extend({queue:function(a,b){var c=2;return"string"!=typeof a&&(b=a,a="fx",c--),arguments.length<c?m.queue(this[0],a):void 0===b?this:this.each(function(){var c=m.queue(this,a,b);m._queueHooks(this,a),"fx"===a&&"inprogress"!==c[0]&&m.dequeue(this,a)})},dequeue:function(a){return this.each(function(){m.dequeue(this,a)})},clearQueue:function(a){return this.queue(a||"fx",[])},promise:function(a,b){var c,d=1,e=m.Deferred(),f=this,g=this.length,h=function(){--d||e.resolveWith(f,[f])};"string"!=typeof a&&(b=a,a=void 0),a=a||"fx";while(g--)c=m._data(f[g],a+"queueHooks"),c&&c.empty&&(d++,c.empty.add(h));return h(),e.promise(b)}});var S=/[+-]?(?:\d*\.|)\d+(?:[eE][+-]?\d+|)/.source,T=["Top","Right","Bottom","Left"],U=function(a,b){return a=b||a,"none"===m.css(a,"display")||!m.contains(a.ownerDocument,a)},V=m.access=function(a,b,c,d,e,f,g){var h=0,i=a.length,j=null==c;if("object"===m.type(c)){e=!0;for(h in c)m.access(a,b,h,c[h],!0,f,g)}else if(void 0!==d&&(e=!0,m.isFunction(d)||(g=!0),j&&(g?(b.call(a,d),b=null):(j=b,b=function(a,b,c){return j.call(m(a),c)})),b))for(;i>h;h++)b(a[h],c,g?d:d.call(a[h],h,b(a[h],c)));return e?a:j?b.call(a):i?b(a[0],c):f},W=/^(?:checkbox|radio)$/i;!function(){var a=y.createElement("input"),b=y.createElement("div"),c=y.createDocumentFragment();if(b.innerHTML=" <link/><table></table><a href='/a'>a</a><input type='checkbox'/>",k.leadingWhitespace=3===b.firstChild.nodeType,k.tbody=!b.getElementsByTagName("tbody").length,k.htmlSerialize=!!b.getElementsByTagName("link").length,k.html5Clone="<:nav></:nav>"!==y.createElement("nav").cloneNode(!0).outerHTML,a.type="checkbox",a.checked=!0,c.appendChild(a),k.appendChecked=a.checked,b.innerHTML="<textarea>x</textarea>",k.noCloneChecked=!!b.cloneNode(!0).lastChild.defaultValue,c.appendChild(b),b.innerHTML="<input type='radio' checked='checked' name='t'/>",k.checkClone=b.cloneNode(!0).cloneNode(!0).lastChild.checked,k.noCloneEvent=!0,b.attachEvent&&(b.attachEvent("onclick",function(){k.noCloneEvent=!1}),b.cloneNode(!0).click()),null==k.deleteExpando){k.deleteExpando=!0;try{delete b.test}catch(d){k.deleteExpando=!1}}}(),function(){var b,c,d=y.createElement("div");for(b in{submit:!0,change:!0,focusin:!0})c="on"+b,(k[b+"Bubbles"]=c in a)||(d.setAttribute(c,"t"),k[b+"Bubbles"]=d.attributes[c].expando===!1);d=null}();var X=/^(?:input|select|textarea)$/i,Y=/^key/,Z=/^(?:mouse|pointer|contextmenu)|click/,$=/^(?:focusinfocus|focusoutblur)$/,_=/^([^.]*)(?:\.(.+)|)$/;function ab(){return!0}function bb(){return!1}function cb(){try{return y.activeElement}catch(a){}}m.event={global:{},add:function(a,b,c,d,e){var f,g,h,i,j,k,l,n,o,p,q,r=m._data(a);if(r){c.handler&&(i=c,c=i.handler,e=i.selector),c.guid||(c.guid=m.guid++),(g=r.events)||(g=r.events={}),(k=r.handle)||(k=r.handle=function(a){return typeof m===K||a&&m.event.triggered===a.type?void 0:m.event.dispatch.apply(k.elem,arguments)},k.elem=a),b=(b||"").match(E)||[""],h=b.length;while(h--)f=_.exec(b[h])||[],o=q=f[1],p=(f[2]||"").split(".").sort(),o&&(j=m.event.special[o]||{},o=(e?j.delegateType:j.bindType)||o,j=m.event.special[o]||{},l=m.extend({type:o,origType:q,data:d,handler:c,guid:c.guid,selector:e,needsContext:e&&m.expr.match.needsContext.test(e),namespace:p.join(".")},i),(n=g[o])||(n=g[o]=[],n.delegateCount=0,j.setup&&j.setup.call(a,d,p,k)!==!1||(a.addEventListener?a.addEventListener(o,k,!1):a.attachEvent&&a.attachEvent("on"+o,k))),j.add&&(j.add.call(a,l),l.handler.guid||(l.handler.guid=c.guid)),e?n.splice(n.delegateCount++,0,l):n.push(l),m.event.global[o]=!0);a=null}},remove:function(a,b,c,d,e){var f,g,h,i,j,k,l,n,o,p,q,r=m.hasData(a)&&m._data(a);if(r&&(k=r.events)){b=(b||"").match(E)||[""],j=b.length;while(j--)if(h=_.exec(b[j])||[],o=q=h[1],p=(h[2]||"").split(".").sort(),o){l=m.event.special[o]||{},o=(d?l.delegateType:l.bindType)||o,n=k[o]||[],h=h[2]&&new RegExp("(^|\\.)"+p.join("\\.(?:.*\\.|)")+"(\\.|$)"),i=f=n.length;while(f--)g=n[f],!e&&q!==g.origType||c&&c.guid!==g.guid||h&&!h.test(g.namespace)||d&&d!==g.selector&&("**"!==d||!g.selector)||(n.splice(f,1),g.selector&&n.delegateCount--,l.remove&&l.remove.call(a,g));i&&!n.length&&(l.teardown&&l.teardown.call(a,p,r.handle)!==!1||m.removeEvent(a,o,r.handle),delete k[o])}else for(o in k)m.event.remove(a,o+b[j],c,d,!0);m.isEmptyObject(k)&&(delete r.handle,m._removeData(a,"events"))}},trigger:function(b,c,d,e){var f,g,h,i,k,l,n,o=[d||y],p=j.call(b,"type")?b.type:b,q=j.call(b,"namespace")?b.namespace.split("."):[];if(h=l=d=d||y,3!==d.nodeType&&8!==d.nodeType&&!$.test(p+m.event.triggered)&&(p.indexOf(".")>=0&&(q=p.split("."),p=q.shift(),q.sort()),g=p.indexOf(":")<0&&"on"+p,b=b[m.expando]?b:new m.Event(p,"object"==typeof b&&b),b.isTrigger=e?2:3,b.namespace=q.join("."),b.namespace_re=b.namespace?new RegExp("(^|\\.)"+q.join("\\.(?:.*\\.|)")+"(\\.|$)"):null,b.result=void 0,b.target||(b.target=d),c=null==c?[b]:m.makeArray(c,[b]),k=m.event.special[p]||{},e||!k.trigger||k.trigger.apply(d,c)!==!1)){if(!e&&!k.noBubble&&!m.isWindow(d)){for(i=k.delegateType||p,$.test(i+p)||(h=h.parentNode);h;h=h.parentNode)o.push(h),l=h;l===(d.ownerDocument||y)&&o.push(l.defaultView||l.parentWindow||a)}n=0;while((h=o[n++])&&!b.isPropagationStopped())b.type=n>1?i:k.bindType||p,f=(m._data(h,"events")||{})[b.type]&&m._data(h,"handle"),f&&f.apply(h,c),f=g&&h[g],f&&f.apply&&m.acceptData(h)&&(b.result=f.apply(h,c),b.result===!1&&b.preventDefault());if(b.type=p,!e&&!b.isDefaultPrevented()&&(!k._default||k._default.apply(o.pop(),c)===!1)&&m.acceptData(d)&&g&&d[p]&&!m.isWindow(d)){l=d[g],l&&(d[g]=null),m.event.triggered=p;try{d[p]()}catch(r){}m.event.triggered=void 0,l&&(d[g]=l)}return b.result}},dispatch:function(a){a=m.event.fix(a);var b,c,e,f,g,h=[],i=d.call(arguments),j=(m._data(this,"events")||{})[a.type]||[],k=m.event.special[a.type]||{};if(i[0]=a,a.delegateTarget=this,!k.preDispatch||k.preDispatch.call(this,a)!==!1){h=m.event.handlers.call(this,a,j),b=0;while((f=h[b++])&&!a.isPropagationStopped()){a.currentTarget=f.elem,g=0;while((e=f.handlers[g++])&&!a.isImmediatePropagationStopped())(!a.namespace_re||a.namespace_re.test(e.namespace))&&(a.handleObj=e,a.data=e.data,c=((m.event.special[e.origType]||{}).handle||e.handler).apply(f.elem,i),void 0!==c&&(a.result=c)===!1&&(a.preventDefault(),a.stopPropagation()))}return k.postDispatch&&k.postDispatch.call(this,a),a.result}},handlers:function(a,b){var c,d,e,f,g=[],h=b.delegateCount,i=a.target;if(h&&i.nodeType&&(!a.button||"click"!==a.type))for(;i!=this;i=i.parentNode||this)if(1===i.nodeType&&(i.disabled!==!0||"click"!==a.type)){for(e=[],f=0;h>f;f++)d=b[f],c=d.selector+" ",void 0===e[c]&&(e[c]=d.needsContext?m(c,this).index(i)>=0:m.find(c,this,null,[i]).length),e[c]&&e.push(d);e.length&&g.push({elem:i,handlers:e})}return h<b.length&&g.push({elem:this,handlers:b.slice(h)}),g},fix:function(a){if(a[m.expando])return a;var b,c,d,e=a.type,f=a,g=this.fixHooks[e];g||(this.fixHooks[e]=g=Z.test(e)?this.mouseHooks:Y.test(e)?this.keyHooks:{}),d=g.props?this.props.concat(g.props):this.props,a=new m.Event(f),b=d.length;while(b--)c=d[b],a[c]=f[c];return a.target||(a.target=f.srcElement||y),3===a.target.nodeType&&(a.target=a.target.parentNode),a.metaKey=!!a.metaKey,g.filter?g.filter(a,f):a},props:"altKey bubbles cancelable ctrlKey currentTarget eventPhase metaKey relatedTarget shiftKey target timeStamp view which".split(" "),fixHooks:{},keyHooks:{props:"char charCode key keyCode".split(" "),filter:function(a,b){return null==a.which&&(a.which=null!=b.charCode?b.charCode:b.keyCode),a}},mouseHooks:{props:"button buttons clientX clientY fromElement offsetX offsetY pageX pageY screenX screenY toElement".split(" "),filter:function(a,b){var c,d,e,f=b.button,g=b.fromElement;return null==a.pageX&&null!=b.clientX&&(d=a.target.ownerDocument||y,e=d.documentElement,c=d.body,a.pageX=b.clientX+(e&&e.scrollLeft||c&&c.scrollLeft||0)-(e&&e.clientLeft||c&&c.clientLeft||0),a.pageY=b.clientY+(e&&e.scrollTop||c&&c.scrollTop||0)-(e&&e.clientTop||c&&c.clientTop||0)),!a.relatedTarget&&g&&(a.relatedTarget=g===a.target?b.toElement:g),a.which||void 0===f||(a.which=1&f?1:2&f?3:4&f?2:0),a}},special:{load:{noBubble:!0},focus:{trigger:function(){if(this!==cb()&&this.focus)try{return this.focus(),!1}catch(a){}},delegateType:"focusin"},blur:{trigger:function(){return this===cb()&&this.blur?(this.blur(),!1):void 0},delegateType:"focusout"},click:{trigger:function(){return m.nodeName(this,"input")&&"checkbox"===this.type&&this.click?(this.click(),!1):void 0},_default:function(a){return m.nodeName(a.target,"a")}},beforeunload:{postDispatch:function(a){void 0!==a.result&&a.originalEvent&&(a.originalEvent.returnValue=a.result)}}},simulate:function(a,b,c,d){var e=m.extend(new m.Event,c,{type:a,isSimulated:!0,originalEvent:{}});d?m.event.trigger(e,null,b):m.event.dispatch.call(b,e),e.isDefaultPrevented()&&c.preventDefault()}},m.removeEvent=y.removeEventListener?function(a,b,c){a.removeEventListener&&a.removeEventListener(b,c,!1)}:function(a,b,c){var d="on"+b;a.detachEvent&&(typeof a[d]===K&&(a[d]=null),a.detachEvent(d,c))},m.Event=function(a,b){return this instanceof m.Event?(a&&a.type?(this.originalEvent=a,this.type=a.type,this.isDefaultPrevented=a.defaultPrevented||void 0===a.defaultPrevented&&a.returnValue===!1?ab:bb):this.type=a,b&&m.extend(this,b),this.timeStamp=a&&a.timeStamp||m.now(),void(this[m.expando]=!0)):new m.Event(a,b)},m.Event.prototype={isDefaultPrevented:bb,isPropagationStopped:bb,isImmediatePropagationStopped:bb,preventDefault:function(){var a=this.originalEvent;this.isDefaultPrevented=ab,a&&(a.preventDefault?a.preventDefault():a.returnValue=!1)},stopPropagation:function(){var a=this.originalEvent;this.isPropagationStopped=ab,a&&(a.stopPropagation&&a.stopPropagation(),a.cancelBubble=!0)},stopImmediatePropagation:function(){var a=this.originalEvent;this.isImmediatePropagationStopped=ab,a&&a.stopImmediatePropagation&&a.stopImmediatePropagation(),this.stopPropagation()}},m.each({mouseenter:"mouseover",mouseleave:"mouseout",pointerenter:"pointerover",pointerleave:"pointerout"},function(a,b){m.event.special[a]={delegateType:b,bindType:b,handle:function(a){var c,d=this,e=a.relatedTarget,f=a.handleObj;return(!e||e!==d&&!m.contains(d,e))&&(a.type=f.origType,c=f.handler.apply(this,arguments),a.type=b),c}}}),k.submitBubbles||(m.event.special.submit={setup:function(){return m.nodeName(this,"form")?!1:void m.event.add(this,"click._submit keypress._submit",function(a){var b=a.target,c=m.nodeName(b,"input")||m.nodeName(b,"button")?b.form:void 0;c&&!m._data(c,"submitBubbles")&&(m.event.add(c,"submit._submit",function(a){a._submit_bubble=!0}),m._data(c,"submitBubbles",!0))})},postDispatch:function(a){a._submit_bubble&&(delete a._submit_bubble,this.parentNode&&!a.isTrigger&&m.event.simulate("submit",this.parentNode,a,!0))},teardown:function(){return m.nodeName(this,"form")?!1:void m.event.remove(this,"._submit")}}),k.changeBubbles||(m.event.special.change={setup:function(){return X.test(this.nodeName)?(("checkbox"===this.type||"radio"===this.type)&&(m.event.add(this,"propertychange._change",function(a){"checked"===a.originalEvent.propertyName&&(this._just_changed=!0)}),m.event.add(this,"click._change",function(a){this._just_changed&&!a.isTrigger&&(this._just_changed=!1),m.event.simulate("change",this,a,!0)})),!1):void m.event.add(this,"beforeactivate._change",function(a){var b=a.target;X.test(b.nodeName)&&!m._data(b,"changeBubbles")&&(m.event.add(b,"change._change",function(a){!this.parentNode||a.isSimulated||a.isTrigger||m.event.simulate("change",this.parentNode,a,!0)}),m._data(b,"changeBubbles",!0))})},handle:function(a){var b=a.target;return this!==b||a.isSimulated||a.isTrigger||"radio"!==b.type&&"checkbox"!==b.type?a.handleObj.handler.apply(this,arguments):void 0},teardown:function(){return m.event.remove(this,"._change"),!X.test(this.nodeName)}}),k.focusinBubbles||m.each({focus:"focusin",blur:"focusout"},function(a,b){var c=function(a){m.event.simulate(b,a.target,m.event.fix(a),!0)};m.event.special[b]={setup:function(){var d=this.ownerDocument||this,e=m._data(d,b);e||d.addEventListener(a,c,!0),m._data(d,b,(e||0)+1)},teardown:function(){var d=this.ownerDocument||this,e=m._data(d,b)-1;e?m._data(d,b,e):(d.removeEventListener(a,c,!0),m._removeData(d,b))}}}),m.fn.extend({on:function(a,b,c,d,e){var f,g;if("object"==typeof a){"string"!=typeof b&&(c=c||b,b=void 0);for(f in a)this.on(f,b,c,a[f],e);return this}if(null==c&&null==d?(d=b,c=b=void 0):null==d&&("string"==typeof b?(d=c,c=void 0):(d=c,c=b,b=void 0)),d===!1)d=bb;else if(!d)return this;return 1===e&&(g=d,d=function(a){return m().off(a),g.apply(this,arguments)},d.guid=g.guid||(g.guid=m.guid++)),this.each(function(){m.event.add(this,a,d,c,b)})},one:function(a,b,c,d){return this.on(a,b,c,d,1)},off:function(a,b,c){var d,e;if(a&&a.preventDefault&&a.handleObj)return d=a.handleObj,m(a.delegateTarget).off(d.namespace?d.origType+"."+d.namespace:d.origType,d.selector,d.handler),this;if("object"==typeof a){for(e in a)this.off(e,b,a[e]);return this}return(b===!1||"function"==typeof b)&&(c=b,b=void 0),c===!1&&(c=bb),this.each(function(){m.event.remove(this,a,c,b)})},trigger:function(a,b){return this.each(function(){m.event.trigger(a,b,this)})},triggerHandler:function(a,b){var c=this[0];return c?m.event.trigger(a,b,c,!0):void 0}});function db(a){var b=eb.split("|"),c=a.createDocumentFragment();if(c.createElement)while(b.length)c.createElement(b.pop());return c}var eb="abbr|article|aside|audio|bdi|canvas|data|datalist|details|figcaption|figure|footer|header|hgroup|mark|meter|nav|output|progress|section|summary|time|video",fb=/ jQuery\d+="(?:null|\d+)"/g,gb=new RegExp("<(?:"+eb+")[\\s/>]","i"),hb=/^\s+/,ib=/<(?!area|br|col|embed|hr|img|input|link|meta|param)(([\w:]+)[^>]*)\/>/gi,jb=/<([\w:]+)/,kb=/<tbody/i,lb=/<|&#?\w+;/,mb=/<(?:script|style|link)/i,nb=/checked\s*(?:[^=]|=\s*.checked.)/i,ob=/^$|\/(?:java|ecma)script/i,pb=/^true\/(.*)/,qb=/^\s*<!(?:\[CDATA\[|--)|(?:\]\]|--)>\s*$/g,rb={option:[1,"<select multiple='multiple'>","</select>"],legend:[1,"<fieldset>","</fieldset>"],area:[1,"<map>","</map>"],param:[1,"<object>","</object>"],thead:[1,"<table>","</table>"],tr:[2,"<table><tbody>","</tbody></table>"],col:[2,"<table><tbody></tbody><colgroup>","</colgroup></table>"],td:[3,"<table><tbody><tr>","</tr></tbody></table>"],_default:k.htmlSerialize?[0,"",""]:[1,"X<div>","</div>"]},sb=db(y),tb=sb.appendChild(y.createElement("div"));rb.optgroup=rb.option,rb.tbody=rb.tfoot=rb.colgroup=rb.caption=rb.thead,rb.th=rb.td;function ub(a,b){var c,d,e=0,f=typeof a.getElementsByTagName!==K?a.getElementsByTagName(b||"*"):typeof a.querySelectorAll!==K?a.querySelectorAll(b||"*"):void 0;if(!f)for(f=[],c=a.childNodes||a;null!=(d=c[e]);e++)!b||m.nodeName(d,b)?f.push(d):m.merge(f,ub(d,b));return void 0===b||b&&m.nodeName(a,b)?m.merge([a],f):f}function vb(a){W.test(a.type)&&(a.defaultChecked=a.checked)}function wb(a,b){return m.nodeName(a,"table")&&m.nodeName(11!==b.nodeType?b:b.firstChild,"tr")?a.getElementsByTagName("tbody")[0]||a.appendChild(a.ownerDocument.createElement("tbody")):a}function xb(a){return a.type=(null!==m.find.attr(a,"type"))+"/"+a.type,a}function yb(a){var b=pb.exec(a.type);return b?a.type=b[1]:a.removeAttribute("type"),a}function zb(a,b){for(var c,d=0;null!=(c=a[d]);d++)m._data(c,"globalEval",!b||m._data(b[d],"globalEval"))}function Ab(a,b){if(1===b.nodeType&&m.hasData(a)){var c,d,e,f=m._data(a),g=m._data(b,f),h=f.events;if(h){delete g.handle,g.events={};for(c in h)for(d=0,e=h[c].length;e>d;d++)m.event.add(b,c,h[c][d])}g.data&&(g.data=m.extend({},g.data))}}function Bb(a,b){var c,d,e;if(1===b.nodeType){if(c=b.nodeName.toLowerCase(),!k.noCloneEvent&&b[m.expando]){e=m._data(b);for(d in e.events)m.removeEvent(b,d,e.handle);b.removeAttribute(m.expando)}"script"===c&&b.text!==a.text?(xb(b).text=a.text,yb(b)):"object"===c?(b.parentNode&&(b.outerHTML=a.outerHTML),k.html5Clone&&a.innerHTML&&!m.trim(b.innerHTML)&&(b.innerHTML=a.innerHTML)):"input"===c&&W.test(a.type)?(b.defaultChecked=b.checked=a.checked,b.value!==a.value&&(b.value=a.value)):"option"===c?b.defaultSelected=b.selected=a.defaultSelected:("input"===c||"textarea"===c)&&(b.defaultValue=a.defaultValue)}}m.extend({clone:function(a,b,c){var d,e,f,g,h,i=m.contains(a.ownerDocument,a);if(k.html5Clone||m.isXMLDoc(a)||!gb.test("<"+a.nodeName+">")?f=a.cloneNode(!0):(tb.innerHTML=a.outerHTML,tb.removeChild(f=tb.firstChild)),!(k.noCloneEvent&&k.noCloneChecked||1!==a.nodeType&&11!==a.nodeType||m.isXMLDoc(a)))for(d=ub(f),h=ub(a),g=0;null!=(e=h[g]);++g)d[g]&&Bb(e,d[g]);if(b)if(c)for(h=h||ub(a),d=d||ub(f),g=0;null!=(e=h[g]);g++)Ab(e,d[g]);else Ab(a,f);return d=ub(f,"script"),d.length>0&&zb(d,!i&&ub(a,"script")),d=h=e=null,f},buildFragment:function(a,b,c,d){for(var e,f,g,h,i,j,l,n=a.length,o=db(b),p=[],q=0;n>q;q++)if(f=a[q],f||0===f)if("object"===m.type(f))m.merge(p,f.nodeType?[f]:f);else if(lb.test(f)){h=h||o.appendChild(b.createElement("div")),i=(jb.exec(f)||["",""])[1].toLowerCase(),l=rb[i]||rb._default,h.innerHTML=l[1]+f.replace(ib,"<$1></$2>")+l[2],e=l[0];while(e--)h=h.lastChild;if(!k.leadingWhitespace&&hb.test(f)&&p.push(b.createTextNode(hb.exec(f)[0])),!k.tbody){f="table"!==i||kb.test(f)?"<table>"!==l[1]||kb.test(f)?0:h:h.firstChild,e=f&&f.childNodes.length;while(e--)m.nodeName(j=f.childNodes[e],"tbody")&&!j.childNodes.length&&f.removeChild(j)}m.merge(p,h.childNodes),h.textContent="";while(h.firstChild)h.removeChild(h.firstChild);h=o.lastChild}else p.push(b.createTextNode(f));h&&o.removeChild(h),k.appendChecked||m.grep(ub(p,"input"),vb),q=0;while(f=p[q++])if((!d||-1===m.inArray(f,d))&&(g=m.contains(f.ownerDocument,f),h=ub(o.appendChild(f),"script"),g&&zb(h),c)){e=0;while(f=h[e++])ob.test(f.type||"")&&c.push(f)}return h=null,o},cleanData:function(a,b){for(var d,e,f,g,h=0,i=m.expando,j=m.cache,l=k.deleteExpando,n=m.event.special;null!=(d=a[h]);h++)if((b||m.acceptData(d))&&(f=d[i],g=f&&j[f])){if(g.events)for(e in g.events)n[e]?m.event.remove(d,e):m.removeEvent(d,e,g.handle);j[f]&&(delete j[f],l?delete d[i]:typeof d.removeAttribute!==K?d.removeAttribute(i):d[i]=null,c.push(f))}}}),m.fn.extend({text:function(a){return V(this,function(a){return void 0===a?m.text(this):this.empty().append((this[0]&&this[0].ownerDocument||y).createTextNode(a))},null,a,arguments.length)},append:function(){return this.domManip(arguments,function(a){if(1===this.nodeType||11===this.nodeType||9===this.nodeType){var b=wb(this,a);b.appendChild(a)}})},prepend:function(){return this.domManip(arguments,function(a){if(1===this.nodeType||11===this.nodeType||9===this.nodeType){var b=wb(this,a);b.insertBefore(a,b.firstChild)}})},before:function(){return this.domManip(arguments,function(a){this.parentNode&&this.parentNode.insertBefore(a,this)})},after:function(){return this.domManip(arguments,function(a){this.parentNode&&this.parentNode.insertBefore(a,this.nextSibling)})},remove:function(a,b){for(var c,d=a?m.filter(a,this):this,e=0;null!=(c=d[e]);e++)b||1!==c.nodeType||m.cleanData(ub(c)),c.parentNode&&(b&&m.contains(c.ownerDocument,c)&&zb(ub(c,"script")),c.parentNode.removeChild(c));return this},empty:function(){for(var a,b=0;null!=(a=this[b]);b++){1===a.nodeType&&m.cleanData(ub(a,!1));while(a.firstChild)a.removeChild(a.firstChild);a.options&&m.nodeName(a,"select")&&(a.options.length=0)}return this},clone:function(a,b){return a=null==a?!1:a,b=null==b?a:b,this.map(function(){return m.clone(this,a,b)})},html:function(a){return V(this,function(a){var b=this[0]||{},c=0,d=this.length;if(void 0===a)return 1===b.nodeType?b.innerHTML.replace(fb,""):void 0;if(!("string"!=typeof a||mb.test(a)||!k.htmlSerialize&&gb.test(a)||!k.leadingWhitespace&&hb.test(a)||rb[(jb.exec(a)||["",""])[1].toLowerCase()])){a=a.replace(ib,"<$1></$2>");try{for(;d>c;c++)b=this[c]||{},1===b.nodeType&&(m.cleanData(ub(b,!1)),b.innerHTML=a);b=0}catch(e){}}b&&this.empty().append(a)},null,a,arguments.length)},replaceWith:function(){var a=arguments[0];return this.domManip(arguments,function(b){a=this.parentNode,m.cleanData(ub(this)),a&&a.replaceChild(b,this)}),a&&(a.length||a.nodeType)?this:this.remove()},detach:function(a){return this.remove(a,!0)},domManip:function(a,b){a=e.apply([],a);var c,d,f,g,h,i,j=0,l=this.length,n=this,o=l-1,p=a[0],q=m.isFunction(p);if(q||l>1&&"string"==typeof p&&!k.checkClone&&nb.test(p))return this.each(function(c){var d=n.eq(c);q&&(a[0]=p.call(this,c,d.html())),d.domManip(a,b)});if(l&&(i=m.buildFragment(a,this[0].ownerDocument,!1,this),c=i.firstChild,1===i.childNodes.length&&(i=c),c)){for(g=m.map(ub(i,"script"),xb),f=g.length;l>j;j++)d=i,j!==o&&(d=m.clone(d,!0,!0),f&&m.merge(g,ub(d,"script"))),b.call(this[j],d,j);if(f)for(h=g[g.length-1].ownerDocument,m.map(g,yb),j=0;f>j;j++)d=g[j],ob.test(d.type||"")&&!m._data(d,"globalEval")&&m.contains(h,d)&&(d.src?m._evalUrl&&m._evalUrl(d.src):m.globalEval((d.text||d.textContent||d.innerHTML||"").replace(qb,"")));i=c=null}return this}}),m.each({appendTo:"append",prependTo:"prepend",insertBefore:"before",insertAfter:"after",replaceAll:"replaceWith"},function(a,b){m.fn[a]=function(a){for(var c,d=0,e=[],g=m(a),h=g.length-1;h>=d;d++)c=d===h?this:this.clone(!0),m(g[d])[b](c),f.apply(e,c.get());return this.pushStack(e)}});var Cb,Db={};function Eb(b,c){var d,e=m(c.createElement(b)).appendTo(c.body),f=a.getDefaultComputedStyle&&(d=a.getDefaultComputedStyle(e[0]))?d.display:m.css(e[0],"display");return e.detach(),f}function Fb(a){var b=y,c=Db[a];return c||(c=Eb(a,b),"none"!==c&&c||(Cb=(Cb||m("<iframe frameborder='0' width='0' height='0'/>")).appendTo(b.documentElement),b=(Cb[0].contentWindow||Cb[0].contentDocument).document,b.write(),b.close(),c=Eb(a,b),Cb.detach()),Db[a]=c),c}!function(){var a;k.shrinkWrapBlocks=function(){if(null!=a)return a;a=!1;var b,c,d;return c=y.getElementsByTagName("body")[0],c&&c.style?(b=y.createElement("div"),d=y.createElement("div"),d.style.cssText="position:absolute;border:0;width:0;height:0;top:0;left:-9999px",c.appendChild(d).appendChild(b),typeof b.style.zoom!==K&&(b.style.cssText="-webkit-box-sizing:content-box;-moz-box-sizing:content-box;box-sizing:content-box;display:block;margin:0;border:0;padding:1px;width:1px;zoom:1",b.appendChild(y.createElement("div")).style.width="5px",a=3!==b.offsetWidth),c.removeChild(d),a):void 0}}();var Gb=/^margin/,Hb=new RegExp("^("+S+")(?!px)[a-z%]+$","i"),Ib,Jb,Kb=/^(top|right|bottom|left)$/;a.getComputedStyle?(Ib=function(a){return a.ownerDocument.defaultView.getComputedStyle(a,null)},Jb=function(a,b,c){var d,e,f,g,h=a.style;return c=c||Ib(a),g=c?c.getPropertyValue(b)||c[b]:void 0,c&&(""!==g||m.contains(a.ownerDocument,a)||(g=m.style(a,b)),Hb.test(g)&&Gb.test(b)&&(d=h.width,e=h.minWidth,f=h.maxWidth,h.minWidth=h.maxWidth=h.width=g,g=c.width,h.width=d,h.minWidth=e,h.maxWidth=f)),void 0===g?g:g+""}):y.documentElement.currentStyle&&(Ib=function(a){return a.currentStyle},Jb=function(a,b,c){var d,e,f,g,h=a.style;return c=c||Ib(a),g=c?c[b]:void 0,null==g&&h&&h[b]&&(g=h[b]),Hb.test(g)&&!Kb.test(b)&&(d=h.left,e=a.runtimeStyle,f=e&&e.left,f&&(e.left=a.currentStyle.left),h.left="fontSize"===b?"1em":g,g=h.pixelLeft+"px",h.left=d,f&&(e.left=f)),void 0===g?g:g+""||"auto"});function Lb(a,b){return{get:function(){var c=a();if(null!=c)return c?void delete this.get:(this.get=b).apply(this,arguments)}}}!function(){var b,c,d,e,f,g,h;if(b=y.createElement("div"),b.innerHTML=" <link/><table></table><a href='/a'>a</a><input type='checkbox'/>",d=b.getElementsByTagName("a")[0],c=d&&d.style){c.cssText="float:left;opacity:.5",k.opacity="0.5"===c.opacity,k.cssFloat=!!c.cssFloat,b.style.backgroundClip="content-box",b.cloneNode(!0).style.backgroundClip="",k.clearCloneStyle="content-box"===b.style.backgroundClip,k.boxSizing=""===c.boxSizing||""===c.MozBoxSizing||""===c.WebkitBoxSizing,m.extend(k,{reliableHiddenOffsets:function(){return null==g&&i(),g},boxSizingReliable:function(){return null==f&&i(),f},pixelPosition:function(){return null==e&&i(),e},reliableMarginRight:function(){return null==h&&i(),h}});function i(){var b,c,d,i;c=y.getElementsByTagName("body")[0],c&&c.style&&(b=y.createElement("div"),d=y.createElement("div"),d.style.cssText="position:absolute;border:0;width:0;height:0;top:0;left:-9999px",c.appendChild(d).appendChild(b),b.style.cssText="-webkit-box-sizing:border-box;-moz-box-sizing:border-box;box-sizing:border-box;display:block;margin-top:1%;top:1%;border:1px;padding:1px;width:4px;position:absolute",e=f=!1,h=!0,a.getComputedStyle&&(e="1%"!==(a.getComputedStyle(b,null)||{}).top,f="4px"===(a.getComputedStyle(b,null)||{width:"4px"}).width,i=b.appendChild(y.createElement("div")),i.style.cssText=b.style.cssText="-webkit-box-sizing:content-box;-moz-box-sizing:content-box;box-sizing:content-box;display:block;margin:0;border:0;padding:0",i.style.marginRight=i.style.width="0",b.style.width="1px",h=!parseFloat((a.getComputedStyle(i,null)||{}).marginRight)),b.innerHTML="<table><tr><td></td><td>t</td></tr></table>",i=b.getElementsByTagName("td"),i[0].style.cssText="margin:0;border:0;padding:0;display:none",g=0===i[0].offsetHeight,g&&(i[0].style.display="",i[1].style.display="none",g=0===i[0].offsetHeight),c.removeChild(d))}}}(),m.swap=function(a,b,c,d){var e,f,g={};for(f in b)g[f]=a.style[f],a.style[f]=b[f];e=c.apply(a,d||[]);for(f in b)a.style[f]=g[f];return e};var Mb=/alpha\([^)]*\)/i,Nb=/opacity\s*=\s*([^)]*)/,Ob=/^(none|table(?!-c[ea]).+)/,Pb=new RegExp("^("+S+")(.*)$","i"),Qb=new RegExp("^([+-])=("+S+")","i"),Rb={position:"absolute",visibility:"hidden",display:"block"},Sb={letterSpacing:"0",fontWeight:"400"},Tb=["Webkit","O","Moz","ms"];function Ub(a,b){if(b in a)return b;var c=b.charAt(0).toUpperCase()+b.slice(1),d=b,e=Tb.length;while(e--)if(b=Tb[e]+c,b in a)return b;return d}function Vb(a,b){for(var c,d,e,f=[],g=0,h=a.length;h>g;g++)d=a[g],d.style&&(f[g]=m._data(d,"olddisplay"),c=d.style.display,b?(f[g]||"none"!==c||(d.style.display=""),""===d.style.display&&U(d)&&(f[g]=m._data(d,"olddisplay",Fb(d.nodeName)))):(e=U(d),(c&&"none"!==c||!e)&&m._data(d,"olddisplay",e?c:m.css(d,"display"))));for(g=0;h>g;g++)d=a[g],d.style&&(b&&"none"!==d.style.display&&""!==d.style.display||(d.style.display=b?f[g]||"":"none"));return a}function Wb(a,b,c){var d=Pb.exec(b);return d?Math.max(0,d[1]-(c||0))+(d[2]||"px"):b}function Xb(a,b,c,d,e){for(var f=c===(d?"border":"content")?4:"width"===b?1:0,g=0;4>f;f+=2)"margin"===c&&(g+=m.css(a,c+T[f],!0,e)),d?("content"===c&&(g-=m.css(a,"padding"+T[f],!0,e)),"margin"!==c&&(g-=m.css(a,"border"+T[f]+"Width",!0,e))):(g+=m.css(a,"padding"+T[f],!0,e),"padding"!==c&&(g+=m.css(a,"border"+T[f]+"Width",!0,e)));return g}function Yb(a,b,c){var d=!0,e="width"===b?a.offsetWidth:a.offsetHeight,f=Ib(a),g=k.boxSizing&&"border-box"===m.css(a,"boxSizing",!1,f);if(0>=e||null==e){if(e=Jb(a,b,f),(0>e||null==e)&&(e=a.style[b]),Hb.test(e))return e;d=g&&(k.boxSizingReliable()||e===a.style[b]),e=parseFloat(e)||0}return e+Xb(a,b,c||(g?"border":"content"),d,f)+"px"}m.extend({cssHooks:{opacity:{get:function(a,b){if(b){var c=Jb(a,"opacity");return""===c?"1":c}}}},cssNumber:{columnCount:!0,fillOpacity:!0,flexGrow:!0,flexShrink:!0,fontWeight:!0,lineHeight:!0,opacity:!0,order:!0,orphans:!0,widows:!0,zIndex:!0,zoom:!0},cssProps:{"float":k.cssFloat?"cssFloat":"styleFloat"},style:function(a,b,c,d){if(a&&3!==a.nodeType&&8!==a.nodeType&&a.style){var e,f,g,h=m.camelCase(b),i=a.style;if(b=m.cssProps[h]||(m.cssProps[h]=Ub(i,h)),g=m.cssHooks[b]||m.cssHooks[h],void 0===c)return g&&"get"in g&&void 0!==(e=g.get(a,!1,d))?e:i[b];if(f=typeof c,"string"===f&&(e=Qb.exec(c))&&(c=(e[1]+1)*e[2]+parseFloat(m.css(a,b)),f="number"),null!=c&&c===c&&("number"!==f||m.cssNumber[h]||(c+="px"),k.clearCloneStyle||""!==c||0!==b.indexOf("background")||(i[b]="inherit"),!(g&&"set"in g&&void 0===(c=g.set(a,c,d)))))try{i[b]=c}catch(j){}}},css:function(a,b,c,d){var e,f,g,h=m.camelCase(b);return b=m.cssProps[h]||(m.cssProps[h]=Ub(a.style,h)),g=m.cssHooks[b]||m.cssHooks[h],g&&"get"in g&&(f=g.get(a,!0,c)),void 0===f&&(f=Jb(a,b,d)),"normal"===f&&b in Sb&&(f=Sb[b]),""===c||c?(e=parseFloat(f),c===!0||m.isNumeric(e)?e||0:f):f}}),m.each(["height","width"],function(a,b){m.cssHooks[b]={get:function(a,c,d){return c?Ob.test(m.css(a,"display"))&&0===a.offsetWidth?m.swap(a,Rb,function(){return Yb(a,b,d)}):Yb(a,b,d):void 0},set:function(a,c,d){var e=d&&Ib(a);return Wb(a,c,d?Xb(a,b,d,k.boxSizing&&"border-box"===m.css(a,"boxSizing",!1,e),e):0)}}}),k.opacity||(m.cssHooks.opacity={get:function(a,b){return Nb.test((b&&a.currentStyle?a.currentStyle.filter:a.style.filter)||"")?.01*parseFloat(RegExp.$1)+"":b?"1":""},set:function(a,b){var c=a.style,d=a.currentStyle,e=m.isNumeric(b)?"alpha(opacity="+100*b+")":"",f=d&&d.filter||c.filter||"";c.zoom=1,(b>=1||""===b)&&""===m.trim(f.replace(Mb,""))&&c.removeAttribute&&(c.removeAttribute("filter"),""===b||d&&!d.filter)||(c.filter=Mb.test(f)?f.replace(Mb,e):f+" "+e)}}),m.cssHooks.marginRight=Lb(k.reliableMarginRight,function(a,b){return b?m.swap(a,{display:"inline-block"},Jb,[a,"marginRight"]):void 0}),m.each({margin:"",padding:"",border:"Width"},function(a,b){m.cssHooks[a+b]={expand:function(c){for(var d=0,e={},f="string"==typeof c?c.split(" "):[c];4>d;d++)e[a+T[d]+b]=f[d]||f[d-2]||f[0];return e}},Gb.test(a)||(m.cssHooks[a+b].set=Wb)}),m.fn.extend({css:function(a,b){return V(this,function(a,b,c){var d,e,f={},g=0;if(m.isArray(b)){for(d=Ib(a),e=b.length;e>g;g++)f[b[g]]=m.css(a,b[g],!1,d);return f}return void 0!==c?m.style(a,b,c):m.css(a,b)},a,b,arguments.length>1)},show:function(){return Vb(this,!0)},hide:function(){return Vb(this)},toggle:function(a){return"boolean"==typeof a?a?this.show():this.hide():this.each(function(){U(this)?m(this).show():m(this).hide()})}});function Zb(a,b,c,d,e){return new Zb.prototype.init(a,b,c,d,e)}m.Tween=Zb,Zb.prototype={constructor:Zb,init:function(a,b,c,d,e,f){this.elem=a,this.prop=c,this.easing=e||"swing",this.options=b,this.start=this.now=this.cur(),this.end=d,this.unit=f||(m.cssNumber[c]?"":"px") +},cur:function(){var a=Zb.propHooks[this.prop];return a&&a.get?a.get(this):Zb.propHooks._default.get(this)},run:function(a){var b,c=Zb.propHooks[this.prop];return this.pos=b=this.options.duration?m.easing[this.easing](a,this.options.duration*a,0,1,this.options.duration):a,this.now=(this.end-this.start)*b+this.start,this.options.step&&this.options.step.call(this.elem,this.now,this),c&&c.set?c.set(this):Zb.propHooks._default.set(this),this}},Zb.prototype.init.prototype=Zb.prototype,Zb.propHooks={_default:{get:function(a){var b;return null==a.elem[a.prop]||a.elem.style&&null!=a.elem.style[a.prop]?(b=m.css(a.elem,a.prop,""),b&&"auto"!==b?b:0):a.elem[a.prop]},set:function(a){m.fx.step[a.prop]?m.fx.step[a.prop](a):a.elem.style&&(null!=a.elem.style[m.cssProps[a.prop]]||m.cssHooks[a.prop])?m.style(a.elem,a.prop,a.now+a.unit):a.elem[a.prop]=a.now}}},Zb.propHooks.scrollTop=Zb.propHooks.scrollLeft={set:function(a){a.elem.nodeType&&a.elem.parentNode&&(a.elem[a.prop]=a.now)}},m.easing={linear:function(a){return a},swing:function(a){return.5-Math.cos(a*Math.PI)/2}},m.fx=Zb.prototype.init,m.fx.step={};var $b,_b,ac=/^(?:toggle|show|hide)$/,bc=new RegExp("^(?:([+-])=|)("+S+")([a-z%]*)$","i"),cc=/queueHooks$/,dc=[ic],ec={"*":[function(a,b){var c=this.createTween(a,b),d=c.cur(),e=bc.exec(b),f=e&&e[3]||(m.cssNumber[a]?"":"px"),g=(m.cssNumber[a]||"px"!==f&&+d)&&bc.exec(m.css(c.elem,a)),h=1,i=20;if(g&&g[3]!==f){f=f||g[3],e=e||[],g=+d||1;do h=h||".5",g/=h,m.style(c.elem,a,g+f);while(h!==(h=c.cur()/d)&&1!==h&&--i)}return e&&(g=c.start=+g||+d||0,c.unit=f,c.end=e[1]?g+(e[1]+1)*e[2]:+e[2]),c}]};function fc(){return setTimeout(function(){$b=void 0}),$b=m.now()}function gc(a,b){var c,d={height:a},e=0;for(b=b?1:0;4>e;e+=2-b)c=T[e],d["margin"+c]=d["padding"+c]=a;return b&&(d.opacity=d.width=a),d}function hc(a,b,c){for(var d,e=(ec[b]||[]).concat(ec["*"]),f=0,g=e.length;g>f;f++)if(d=e[f].call(c,b,a))return d}function ic(a,b,c){var d,e,f,g,h,i,j,l,n=this,o={},p=a.style,q=a.nodeType&&U(a),r=m._data(a,"fxshow");c.queue||(h=m._queueHooks(a,"fx"),null==h.unqueued&&(h.unqueued=0,i=h.empty.fire,h.empty.fire=function(){h.unqueued||i()}),h.unqueued++,n.always(function(){n.always(function(){h.unqueued--,m.queue(a,"fx").length||h.empty.fire()})})),1===a.nodeType&&("height"in b||"width"in b)&&(c.overflow=[p.overflow,p.overflowX,p.overflowY],j=m.css(a,"display"),l="none"===j?m._data(a,"olddisplay")||Fb(a.nodeName):j,"inline"===l&&"none"===m.css(a,"float")&&(k.inlineBlockNeedsLayout&&"inline"!==Fb(a.nodeName)?p.zoom=1:p.display="inline-block")),c.overflow&&(p.overflow="hidden",k.shrinkWrapBlocks()||n.always(function(){p.overflow=c.overflow[0],p.overflowX=c.overflow[1],p.overflowY=c.overflow[2]}));for(d in b)if(e=b[d],ac.exec(e)){if(delete b[d],f=f||"toggle"===e,e===(q?"hide":"show")){if("show"!==e||!r||void 0===r[d])continue;q=!0}o[d]=r&&r[d]||m.style(a,d)}else j=void 0;if(m.isEmptyObject(o))"inline"===("none"===j?Fb(a.nodeName):j)&&(p.display=j);else{r?"hidden"in r&&(q=r.hidden):r=m._data(a,"fxshow",{}),f&&(r.hidden=!q),q?m(a).show():n.done(function(){m(a).hide()}),n.done(function(){var b;m._removeData(a,"fxshow");for(b in o)m.style(a,b,o[b])});for(d in o)g=hc(q?r[d]:0,d,n),d in r||(r[d]=g.start,q&&(g.end=g.start,g.start="width"===d||"height"===d?1:0))}}function jc(a,b){var c,d,e,f,g;for(c in a)if(d=m.camelCase(c),e=b[d],f=a[c],m.isArray(f)&&(e=f[1],f=a[c]=f[0]),c!==d&&(a[d]=f,delete a[c]),g=m.cssHooks[d],g&&"expand"in g){f=g.expand(f),delete a[d];for(c in f)c in a||(a[c]=f[c],b[c]=e)}else b[d]=e}function kc(a,b,c){var d,e,f=0,g=dc.length,h=m.Deferred().always(function(){delete i.elem}),i=function(){if(e)return!1;for(var b=$b||fc(),c=Math.max(0,j.startTime+j.duration-b),d=c/j.duration||0,f=1-d,g=0,i=j.tweens.length;i>g;g++)j.tweens[g].run(f);return h.notifyWith(a,[j,f,c]),1>f&&i?c:(h.resolveWith(a,[j]),!1)},j=h.promise({elem:a,props:m.extend({},b),opts:m.extend(!0,{specialEasing:{}},c),originalProperties:b,originalOptions:c,startTime:$b||fc(),duration:c.duration,tweens:[],createTween:function(b,c){var d=m.Tween(a,j.opts,b,c,j.opts.specialEasing[b]||j.opts.easing);return j.tweens.push(d),d},stop:function(b){var c=0,d=b?j.tweens.length:0;if(e)return this;for(e=!0;d>c;c++)j.tweens[c].run(1);return b?h.resolveWith(a,[j,b]):h.rejectWith(a,[j,b]),this}}),k=j.props;for(jc(k,j.opts.specialEasing);g>f;f++)if(d=dc[f].call(j,a,k,j.opts))return d;return m.map(k,hc,j),m.isFunction(j.opts.start)&&j.opts.start.call(a,j),m.fx.timer(m.extend(i,{elem:a,anim:j,queue:j.opts.queue})),j.progress(j.opts.progress).done(j.opts.done,j.opts.complete).fail(j.opts.fail).always(j.opts.always)}m.Animation=m.extend(kc,{tweener:function(a,b){m.isFunction(a)?(b=a,a=["*"]):a=a.split(" ");for(var c,d=0,e=a.length;e>d;d++)c=a[d],ec[c]=ec[c]||[],ec[c].unshift(b)},prefilter:function(a,b){b?dc.unshift(a):dc.push(a)}}),m.speed=function(a,b,c){var d=a&&"object"==typeof a?m.extend({},a):{complete:c||!c&&b||m.isFunction(a)&&a,duration:a,easing:c&&b||b&&!m.isFunction(b)&&b};return d.duration=m.fx.off?0:"number"==typeof d.duration?d.duration:d.duration in m.fx.speeds?m.fx.speeds[d.duration]:m.fx.speeds._default,(null==d.queue||d.queue===!0)&&(d.queue="fx"),d.old=d.complete,d.complete=function(){m.isFunction(d.old)&&d.old.call(this),d.queue&&m.dequeue(this,d.queue)},d},m.fn.extend({fadeTo:function(a,b,c,d){return this.filter(U).css("opacity",0).show().end().animate({opacity:b},a,c,d)},animate:function(a,b,c,d){var e=m.isEmptyObject(a),f=m.speed(b,c,d),g=function(){var b=kc(this,m.extend({},a),f);(e||m._data(this,"finish"))&&b.stop(!0)};return g.finish=g,e||f.queue===!1?this.each(g):this.queue(f.queue,g)},stop:function(a,b,c){var d=function(a){var b=a.stop;delete a.stop,b(c)};return"string"!=typeof a&&(c=b,b=a,a=void 0),b&&a!==!1&&this.queue(a||"fx",[]),this.each(function(){var b=!0,e=null!=a&&a+"queueHooks",f=m.timers,g=m._data(this);if(e)g[e]&&g[e].stop&&d(g[e]);else for(e in g)g[e]&&g[e].stop&&cc.test(e)&&d(g[e]);for(e=f.length;e--;)f[e].elem!==this||null!=a&&f[e].queue!==a||(f[e].anim.stop(c),b=!1,f.splice(e,1));(b||!c)&&m.dequeue(this,a)})},finish:function(a){return a!==!1&&(a=a||"fx"),this.each(function(){var b,c=m._data(this),d=c[a+"queue"],e=c[a+"queueHooks"],f=m.timers,g=d?d.length:0;for(c.finish=!0,m.queue(this,a,[]),e&&e.stop&&e.stop.call(this,!0),b=f.length;b--;)f[b].elem===this&&f[b].queue===a&&(f[b].anim.stop(!0),f.splice(b,1));for(b=0;g>b;b++)d[b]&&d[b].finish&&d[b].finish.call(this);delete c.finish})}}),m.each(["toggle","show","hide"],function(a,b){var c=m.fn[b];m.fn[b]=function(a,d,e){return null==a||"boolean"==typeof a?c.apply(this,arguments):this.animate(gc(b,!0),a,d,e)}}),m.each({slideDown:gc("show"),slideUp:gc("hide"),slideToggle:gc("toggle"),fadeIn:{opacity:"show"},fadeOut:{opacity:"hide"},fadeToggle:{opacity:"toggle"}},function(a,b){m.fn[a]=function(a,c,d){return this.animate(b,a,c,d)}}),m.timers=[],m.fx.tick=function(){var a,b=m.timers,c=0;for($b=m.now();c<b.length;c++)a=b[c],a()||b[c]!==a||b.splice(c--,1);b.length||m.fx.stop(),$b=void 0},m.fx.timer=function(a){m.timers.push(a),a()?m.fx.start():m.timers.pop()},m.fx.interval=13,m.fx.start=function(){_b||(_b=setInterval(m.fx.tick,m.fx.interval))},m.fx.stop=function(){clearInterval(_b),_b=null},m.fx.speeds={slow:600,fast:200,_default:400},m.fn.delay=function(a,b){return a=m.fx?m.fx.speeds[a]||a:a,b=b||"fx",this.queue(b,function(b,c){var d=setTimeout(b,a);c.stop=function(){clearTimeout(d)}})},function(){var a,b,c,d,e;b=y.createElement("div"),b.setAttribute("className","t"),b.innerHTML=" <link/><table></table><a href='/a'>a</a><input type='checkbox'/>",d=b.getElementsByTagName("a")[0],c=y.createElement("select"),e=c.appendChild(y.createElement("option")),a=b.getElementsByTagName("input")[0],d.style.cssText="top:1px",k.getSetAttribute="t"!==b.className,k.style=/top/.test(d.getAttribute("style")),k.hrefNormalized="/a"===d.getAttribute("href"),k.checkOn=!!a.value,k.optSelected=e.selected,k.enctype=!!y.createElement("form").enctype,c.disabled=!0,k.optDisabled=!e.disabled,a=y.createElement("input"),a.setAttribute("value",""),k.input=""===a.getAttribute("value"),a.value="t",a.setAttribute("type","radio"),k.radioValue="t"===a.value}();var lc=/\r/g;m.fn.extend({val:function(a){var b,c,d,e=this[0];{if(arguments.length)return d=m.isFunction(a),this.each(function(c){var e;1===this.nodeType&&(e=d?a.call(this,c,m(this).val()):a,null==e?e="":"number"==typeof e?e+="":m.isArray(e)&&(e=m.map(e,function(a){return null==a?"":a+""})),b=m.valHooks[this.type]||m.valHooks[this.nodeName.toLowerCase()],b&&"set"in b&&void 0!==b.set(this,e,"value")||(this.value=e))});if(e)return b=m.valHooks[e.type]||m.valHooks[e.nodeName.toLowerCase()],b&&"get"in b&&void 0!==(c=b.get(e,"value"))?c:(c=e.value,"string"==typeof c?c.replace(lc,""):null==c?"":c)}}}),m.extend({valHooks:{option:{get:function(a){var b=m.find.attr(a,"value");return null!=b?b:m.trim(m.text(a))}},select:{get:function(a){for(var b,c,d=a.options,e=a.selectedIndex,f="select-one"===a.type||0>e,g=f?null:[],h=f?e+1:d.length,i=0>e?h:f?e:0;h>i;i++)if(c=d[i],!(!c.selected&&i!==e||(k.optDisabled?c.disabled:null!==c.getAttribute("disabled"))||c.parentNode.disabled&&m.nodeName(c.parentNode,"optgroup"))){if(b=m(c).val(),f)return b;g.push(b)}return g},set:function(a,b){var c,d,e=a.options,f=m.makeArray(b),g=e.length;while(g--)if(d=e[g],m.inArray(m.valHooks.option.get(d),f)>=0)try{d.selected=c=!0}catch(h){d.scrollHeight}else d.selected=!1;return c||(a.selectedIndex=-1),e}}}}),m.each(["radio","checkbox"],function(){m.valHooks[this]={set:function(a,b){return m.isArray(b)?a.checked=m.inArray(m(a).val(),b)>=0:void 0}},k.checkOn||(m.valHooks[this].get=function(a){return null===a.getAttribute("value")?"on":a.value})});var mc,nc,oc=m.expr.attrHandle,pc=/^(?:checked|selected)$/i,qc=k.getSetAttribute,rc=k.input;m.fn.extend({attr:function(a,b){return V(this,m.attr,a,b,arguments.length>1)},removeAttr:function(a){return this.each(function(){m.removeAttr(this,a)})}}),m.extend({attr:function(a,b,c){var d,e,f=a.nodeType;if(a&&3!==f&&8!==f&&2!==f)return typeof a.getAttribute===K?m.prop(a,b,c):(1===f&&m.isXMLDoc(a)||(b=b.toLowerCase(),d=m.attrHooks[b]||(m.expr.match.bool.test(b)?nc:mc)),void 0===c?d&&"get"in d&&null!==(e=d.get(a,b))?e:(e=m.find.attr(a,b),null==e?void 0:e):null!==c?d&&"set"in d&&void 0!==(e=d.set(a,c,b))?e:(a.setAttribute(b,c+""),c):void m.removeAttr(a,b))},removeAttr:function(a,b){var c,d,e=0,f=b&&b.match(E);if(f&&1===a.nodeType)while(c=f[e++])d=m.propFix[c]||c,m.expr.match.bool.test(c)?rc&&qc||!pc.test(c)?a[d]=!1:a[m.camelCase("default-"+c)]=a[d]=!1:m.attr(a,c,""),a.removeAttribute(qc?c:d)},attrHooks:{type:{set:function(a,b){if(!k.radioValue&&"radio"===b&&m.nodeName(a,"input")){var c=a.value;return a.setAttribute("type",b),c&&(a.value=c),b}}}}}),nc={set:function(a,b,c){return b===!1?m.removeAttr(a,c):rc&&qc||!pc.test(c)?a.setAttribute(!qc&&m.propFix[c]||c,c):a[m.camelCase("default-"+c)]=a[c]=!0,c}},m.each(m.expr.match.bool.source.match(/\w+/g),function(a,b){var c=oc[b]||m.find.attr;oc[b]=rc&&qc||!pc.test(b)?function(a,b,d){var e,f;return d||(f=oc[b],oc[b]=e,e=null!=c(a,b,d)?b.toLowerCase():null,oc[b]=f),e}:function(a,b,c){return c?void 0:a[m.camelCase("default-"+b)]?b.toLowerCase():null}}),rc&&qc||(m.attrHooks.value={set:function(a,b,c){return m.nodeName(a,"input")?void(a.defaultValue=b):mc&&mc.set(a,b,c)}}),qc||(mc={set:function(a,b,c){var d=a.getAttributeNode(c);return d||a.setAttributeNode(d=a.ownerDocument.createAttribute(c)),d.value=b+="","value"===c||b===a.getAttribute(c)?b:void 0}},oc.id=oc.name=oc.coords=function(a,b,c){var d;return c?void 0:(d=a.getAttributeNode(b))&&""!==d.value?d.value:null},m.valHooks.button={get:function(a,b){var c=a.getAttributeNode(b);return c&&c.specified?c.value:void 0},set:mc.set},m.attrHooks.contenteditable={set:function(a,b,c){mc.set(a,""===b?!1:b,c)}},m.each(["width","height"],function(a,b){m.attrHooks[b]={set:function(a,c){return""===c?(a.setAttribute(b,"auto"),c):void 0}}})),k.style||(m.attrHooks.style={get:function(a){return a.style.cssText||void 0},set:function(a,b){return a.style.cssText=b+""}});var sc=/^(?:input|select|textarea|button|object)$/i,tc=/^(?:a|area)$/i;m.fn.extend({prop:function(a,b){return V(this,m.prop,a,b,arguments.length>1)},removeProp:function(a){return a=m.propFix[a]||a,this.each(function(){try{this[a]=void 0,delete this[a]}catch(b){}})}}),m.extend({propFix:{"for":"htmlFor","class":"className"},prop:function(a,b,c){var d,e,f,g=a.nodeType;if(a&&3!==g&&8!==g&&2!==g)return f=1!==g||!m.isXMLDoc(a),f&&(b=m.propFix[b]||b,e=m.propHooks[b]),void 0!==c?e&&"set"in e&&void 0!==(d=e.set(a,c,b))?d:a[b]=c:e&&"get"in e&&null!==(d=e.get(a,b))?d:a[b]},propHooks:{tabIndex:{get:function(a){var b=m.find.attr(a,"tabindex");return b?parseInt(b,10):sc.test(a.nodeName)||tc.test(a.nodeName)&&a.href?0:-1}}}}),k.hrefNormalized||m.each(["href","src"],function(a,b){m.propHooks[b]={get:function(a){return a.getAttribute(b,4)}}}),k.optSelected||(m.propHooks.selected={get:function(a){var b=a.parentNode;return b&&(b.selectedIndex,b.parentNode&&b.parentNode.selectedIndex),null}}),m.each(["tabIndex","readOnly","maxLength","cellSpacing","cellPadding","rowSpan","colSpan","useMap","frameBorder","contentEditable"],function(){m.propFix[this.toLowerCase()]=this}),k.enctype||(m.propFix.enctype="encoding");var uc=/[\t\r\n\f]/g;m.fn.extend({addClass:function(a){var b,c,d,e,f,g,h=0,i=this.length,j="string"==typeof a&&a;if(m.isFunction(a))return this.each(function(b){m(this).addClass(a.call(this,b,this.className))});if(j)for(b=(a||"").match(E)||[];i>h;h++)if(c=this[h],d=1===c.nodeType&&(c.className?(" "+c.className+" ").replace(uc," "):" ")){f=0;while(e=b[f++])d.indexOf(" "+e+" ")<0&&(d+=e+" ");g=m.trim(d),c.className!==g&&(c.className=g)}return this},removeClass:function(a){var b,c,d,e,f,g,h=0,i=this.length,j=0===arguments.length||"string"==typeof a&&a;if(m.isFunction(a))return this.each(function(b){m(this).removeClass(a.call(this,b,this.className))});if(j)for(b=(a||"").match(E)||[];i>h;h++)if(c=this[h],d=1===c.nodeType&&(c.className?(" "+c.className+" ").replace(uc," "):"")){f=0;while(e=b[f++])while(d.indexOf(" "+e+" ")>=0)d=d.replace(" "+e+" "," ");g=a?m.trim(d):"",c.className!==g&&(c.className=g)}return this},toggleClass:function(a,b){var c=typeof a;return"boolean"==typeof b&&"string"===c?b?this.addClass(a):this.removeClass(a):this.each(m.isFunction(a)?function(c){m(this).toggleClass(a.call(this,c,this.className,b),b)}:function(){if("string"===c){var b,d=0,e=m(this),f=a.match(E)||[];while(b=f[d++])e.hasClass(b)?e.removeClass(b):e.addClass(b)}else(c===K||"boolean"===c)&&(this.className&&m._data(this,"__className__",this.className),this.className=this.className||a===!1?"":m._data(this,"__className__")||"")})},hasClass:function(a){for(var b=" "+a+" ",c=0,d=this.length;d>c;c++)if(1===this[c].nodeType&&(" "+this[c].className+" ").replace(uc," ").indexOf(b)>=0)return!0;return!1}}),m.each("blur focus focusin focusout load resize scroll unload click dblclick mousedown mouseup mousemove mouseover mouseout mouseenter mouseleave change select submit keydown keypress keyup error contextmenu".split(" "),function(a,b){m.fn[b]=function(a,c){return arguments.length>0?this.on(b,null,a,c):this.trigger(b)}}),m.fn.extend({hover:function(a,b){return this.mouseenter(a).mouseleave(b||a)},bind:function(a,b,c){return this.on(a,null,b,c)},unbind:function(a,b){return this.off(a,null,b)},delegate:function(a,b,c,d){return this.on(b,a,c,d)},undelegate:function(a,b,c){return 1===arguments.length?this.off(a,"**"):this.off(b,a||"**",c)}});var vc=m.now(),wc=/\?/,xc=/(,)|(\[|{)|(}|])|"(?:[^"\\\r\n]|\\["\\\/bfnrt]|\\u[\da-fA-F]{4})*"\s*:?|true|false|null|-?(?!0\d)\d+(?:\.\d+|)(?:[eE][+-]?\d+|)/g;m.parseJSON=function(b){if(a.JSON&&a.JSON.parse)return a.JSON.parse(b+"");var c,d=null,e=m.trim(b+"");return e&&!m.trim(e.replace(xc,function(a,b,e,f){return c&&b&&(d=0),0===d?a:(c=e||b,d+=!f-!e,"")}))?Function("return "+e)():m.error("Invalid JSON: "+b)},m.parseXML=function(b){var c,d;if(!b||"string"!=typeof b)return null;try{a.DOMParser?(d=new DOMParser,c=d.parseFromString(b,"text/xml")):(c=new ActiveXObject("Microsoft.XMLDOM"),c.async="false",c.loadXML(b))}catch(e){c=void 0}return c&&c.documentElement&&!c.getElementsByTagName("parsererror").length||m.error("Invalid XML: "+b),c};var yc,zc,Ac=/#.*$/,Bc=/([?&])_=[^&]*/,Cc=/^(.*?):[ \t]*([^\r\n]*)\r?$/gm,Dc=/^(?:about|app|app-storage|.+-extension|file|res|widget):$/,Ec=/^(?:GET|HEAD)$/,Fc=/^\/\//,Gc=/^([\w.+-]+:)(?:\/\/(?:[^\/?#]*@|)([^\/?#:]*)(?::(\d+)|)|)/,Hc={},Ic={},Jc="*/".concat("*");try{zc=location.href}catch(Kc){zc=y.createElement("a"),zc.href="",zc=zc.href}yc=Gc.exec(zc.toLowerCase())||[];function Lc(a){return function(b,c){"string"!=typeof b&&(c=b,b="*");var d,e=0,f=b.toLowerCase().match(E)||[];if(m.isFunction(c))while(d=f[e++])"+"===d.charAt(0)?(d=d.slice(1)||"*",(a[d]=a[d]||[]).unshift(c)):(a[d]=a[d]||[]).push(c)}}function Mc(a,b,c,d){var e={},f=a===Ic;function g(h){var i;return e[h]=!0,m.each(a[h]||[],function(a,h){var j=h(b,c,d);return"string"!=typeof j||f||e[j]?f?!(i=j):void 0:(b.dataTypes.unshift(j),g(j),!1)}),i}return g(b.dataTypes[0])||!e["*"]&&g("*")}function Nc(a,b){var c,d,e=m.ajaxSettings.flatOptions||{};for(d in b)void 0!==b[d]&&((e[d]?a:c||(c={}))[d]=b[d]);return c&&m.extend(!0,a,c),a}function Oc(a,b,c){var d,e,f,g,h=a.contents,i=a.dataTypes;while("*"===i[0])i.shift(),void 0===e&&(e=a.mimeType||b.getResponseHeader("Content-Type"));if(e)for(g in h)if(h[g]&&h[g].test(e)){i.unshift(g);break}if(i[0]in c)f=i[0];else{for(g in c){if(!i[0]||a.converters[g+" "+i[0]]){f=g;break}d||(d=g)}f=f||d}return f?(f!==i[0]&&i.unshift(f),c[f]):void 0}function Pc(a,b,c,d){var e,f,g,h,i,j={},k=a.dataTypes.slice();if(k[1])for(g in a.converters)j[g.toLowerCase()]=a.converters[g];f=k.shift();while(f)if(a.responseFields[f]&&(c[a.responseFields[f]]=b),!i&&d&&a.dataFilter&&(b=a.dataFilter(b,a.dataType)),i=f,f=k.shift())if("*"===f)f=i;else if("*"!==i&&i!==f){if(g=j[i+" "+f]||j["* "+f],!g)for(e in j)if(h=e.split(" "),h[1]===f&&(g=j[i+" "+h[0]]||j["* "+h[0]])){g===!0?g=j[e]:j[e]!==!0&&(f=h[0],k.unshift(h[1]));break}if(g!==!0)if(g&&a["throws"])b=g(b);else try{b=g(b)}catch(l){return{state:"parsererror",error:g?l:"No conversion from "+i+" to "+f}}}return{state:"success",data:b}}m.extend({active:0,lastModified:{},etag:{},ajaxSettings:{url:zc,type:"GET",isLocal:Dc.test(yc[1]),global:!0,processData:!0,async:!0,contentType:"application/x-www-form-urlencoded; charset=UTF-8",accepts:{"*":Jc,text:"text/plain",html:"text/html",xml:"application/xml, text/xml",json:"application/json, text/javascript"},contents:{xml:/xml/,html:/html/,json:/json/},responseFields:{xml:"responseXML",text:"responseText",json:"responseJSON"},converters:{"* text":String,"text html":!0,"text json":m.parseJSON,"text xml":m.parseXML},flatOptions:{url:!0,context:!0}},ajaxSetup:function(a,b){return b?Nc(Nc(a,m.ajaxSettings),b):Nc(m.ajaxSettings,a)},ajaxPrefilter:Lc(Hc),ajaxTransport:Lc(Ic),ajax:function(a,b){"object"==typeof a&&(b=a,a=void 0),b=b||{};var c,d,e,f,g,h,i,j,k=m.ajaxSetup({},b),l=k.context||k,n=k.context&&(l.nodeType||l.jquery)?m(l):m.event,o=m.Deferred(),p=m.Callbacks("once memory"),q=k.statusCode||{},r={},s={},t=0,u="canceled",v={readyState:0,getResponseHeader:function(a){var b;if(2===t){if(!j){j={};while(b=Cc.exec(f))j[b[1].toLowerCase()]=b[2]}b=j[a.toLowerCase()]}return null==b?null:b},getAllResponseHeaders:function(){return 2===t?f:null},setRequestHeader:function(a,b){var c=a.toLowerCase();return t||(a=s[c]=s[c]||a,r[a]=b),this},overrideMimeType:function(a){return t||(k.mimeType=a),this},statusCode:function(a){var b;if(a)if(2>t)for(b in a)q[b]=[q[b],a[b]];else v.always(a[v.status]);return this},abort:function(a){var b=a||u;return i&&i.abort(b),x(0,b),this}};if(o.promise(v).complete=p.add,v.success=v.done,v.error=v.fail,k.url=((a||k.url||zc)+"").replace(Ac,"").replace(Fc,yc[1]+"//"),k.type=b.method||b.type||k.method||k.type,k.dataTypes=m.trim(k.dataType||"*").toLowerCase().match(E)||[""],null==k.crossDomain&&(c=Gc.exec(k.url.toLowerCase()),k.crossDomain=!(!c||c[1]===yc[1]&&c[2]===yc[2]&&(c[3]||("http:"===c[1]?"80":"443"))===(yc[3]||("http:"===yc[1]?"80":"443")))),k.data&&k.processData&&"string"!=typeof k.data&&(k.data=m.param(k.data,k.traditional)),Mc(Hc,k,b,v),2===t)return v;h=k.global,h&&0===m.active++&&m.event.trigger("ajaxStart"),k.type=k.type.toUpperCase(),k.hasContent=!Ec.test(k.type),e=k.url,k.hasContent||(k.data&&(e=k.url+=(wc.test(e)?"&":"?")+k.data,delete k.data),k.cache===!1&&(k.url=Bc.test(e)?e.replace(Bc,"$1_="+vc++):e+(wc.test(e)?"&":"?")+"_="+vc++)),k.ifModified&&(m.lastModified[e]&&v.setRequestHeader("If-Modified-Since",m.lastModified[e]),m.etag[e]&&v.setRequestHeader("If-None-Match",m.etag[e])),(k.data&&k.hasContent&&k.contentType!==!1||b.contentType)&&v.setRequestHeader("Content-Type",k.contentType),v.setRequestHeader("Accept",k.dataTypes[0]&&k.accepts[k.dataTypes[0]]?k.accepts[k.dataTypes[0]]+("*"!==k.dataTypes[0]?", "+Jc+"; q=0.01":""):k.accepts["*"]);for(d in k.headers)v.setRequestHeader(d,k.headers[d]);if(k.beforeSend&&(k.beforeSend.call(l,v,k)===!1||2===t))return v.abort();u="abort";for(d in{success:1,error:1,complete:1})v[d](k[d]);if(i=Mc(Ic,k,b,v)){v.readyState=1,h&&n.trigger("ajaxSend",[v,k]),k.async&&k.timeout>0&&(g=setTimeout(function(){v.abort("timeout")},k.timeout));try{t=1,i.send(r,x)}catch(w){if(!(2>t))throw w;x(-1,w)}}else x(-1,"No Transport");function x(a,b,c,d){var j,r,s,u,w,x=b;2!==t&&(t=2,g&&clearTimeout(g),i=void 0,f=d||"",v.readyState=a>0?4:0,j=a>=200&&300>a||304===a,c&&(u=Oc(k,v,c)),u=Pc(k,u,v,j),j?(k.ifModified&&(w=v.getResponseHeader("Last-Modified"),w&&(m.lastModified[e]=w),w=v.getResponseHeader("etag"),w&&(m.etag[e]=w)),204===a||"HEAD"===k.type?x="nocontent":304===a?x="notmodified":(x=u.state,r=u.data,s=u.error,j=!s)):(s=x,(a||!x)&&(x="error",0>a&&(a=0))),v.status=a,v.statusText=(b||x)+"",j?o.resolveWith(l,[r,x,v]):o.rejectWith(l,[v,x,s]),v.statusCode(q),q=void 0,h&&n.trigger(j?"ajaxSuccess":"ajaxError",[v,k,j?r:s]),p.fireWith(l,[v,x]),h&&(n.trigger("ajaxComplete",[v,k]),--m.active||m.event.trigger("ajaxStop")))}return v},getJSON:function(a,b,c){return m.get(a,b,c,"json")},getScript:function(a,b){return m.get(a,void 0,b,"script")}}),m.each(["get","post"],function(a,b){m[b]=function(a,c,d,e){return m.isFunction(c)&&(e=e||d,d=c,c=void 0),m.ajax({url:a,type:b,dataType:e,data:c,success:d})}}),m.each(["ajaxStart","ajaxStop","ajaxComplete","ajaxError","ajaxSuccess","ajaxSend"],function(a,b){m.fn[b]=function(a){return this.on(b,a)}}),m._evalUrl=function(a){return m.ajax({url:a,type:"GET",dataType:"script",async:!1,global:!1,"throws":!0})},m.fn.extend({wrapAll:function(a){if(m.isFunction(a))return this.each(function(b){m(this).wrapAll(a.call(this,b))});if(this[0]){var b=m(a,this[0].ownerDocument).eq(0).clone(!0);this[0].parentNode&&b.insertBefore(this[0]),b.map(function(){var a=this;while(a.firstChild&&1===a.firstChild.nodeType)a=a.firstChild;return a}).append(this)}return this},wrapInner:function(a){return this.each(m.isFunction(a)?function(b){m(this).wrapInner(a.call(this,b))}:function(){var b=m(this),c=b.contents();c.length?c.wrapAll(a):b.append(a)})},wrap:function(a){var b=m.isFunction(a);return this.each(function(c){m(this).wrapAll(b?a.call(this,c):a)})},unwrap:function(){return this.parent().each(function(){m.nodeName(this,"body")||m(this).replaceWith(this.childNodes)}).end()}}),m.expr.filters.hidden=function(a){return a.offsetWidth<=0&&a.offsetHeight<=0||!k.reliableHiddenOffsets()&&"none"===(a.style&&a.style.display||m.css(a,"display"))},m.expr.filters.visible=function(a){return!m.expr.filters.hidden(a)};var Qc=/%20/g,Rc=/\[\]$/,Sc=/\r?\n/g,Tc=/^(?:submit|button|image|reset|file)$/i,Uc=/^(?:input|select|textarea|keygen)/i;function Vc(a,b,c,d){var e;if(m.isArray(b))m.each(b,function(b,e){c||Rc.test(a)?d(a,e):Vc(a+"["+("object"==typeof e?b:"")+"]",e,c,d)});else if(c||"object"!==m.type(b))d(a,b);else for(e in b)Vc(a+"["+e+"]",b[e],c,d)}m.param=function(a,b){var c,d=[],e=function(a,b){b=m.isFunction(b)?b():null==b?"":b,d[d.length]=encodeURIComponent(a)+"="+encodeURIComponent(b)};if(void 0===b&&(b=m.ajaxSettings&&m.ajaxSettings.traditional),m.isArray(a)||a.jquery&&!m.isPlainObject(a))m.each(a,function(){e(this.name,this.value)});else for(c in a)Vc(c,a[c],b,e);return d.join("&").replace(Qc,"+")},m.fn.extend({serialize:function(){return m.param(this.serializeArray())},serializeArray:function(){return this.map(function(){var a=m.prop(this,"elements");return a?m.makeArray(a):this}).filter(function(){var a=this.type;return this.name&&!m(this).is(":disabled")&&Uc.test(this.nodeName)&&!Tc.test(a)&&(this.checked||!W.test(a))}).map(function(a,b){var c=m(this).val();return null==c?null:m.isArray(c)?m.map(c,function(a){return{name:b.name,value:a.replace(Sc,"\r\n")}}):{name:b.name,value:c.replace(Sc,"\r\n")}}).get()}}),m.ajaxSettings.xhr=void 0!==a.ActiveXObject?function(){return!this.isLocal&&/^(get|post|head|put|delete|options)$/i.test(this.type)&&Zc()||$c()}:Zc;var Wc=0,Xc={},Yc=m.ajaxSettings.xhr();a.ActiveXObject&&m(a).on("unload",function(){for(var a in Xc)Xc[a](void 0,!0)}),k.cors=!!Yc&&"withCredentials"in Yc,Yc=k.ajax=!!Yc,Yc&&m.ajaxTransport(function(a){if(!a.crossDomain||k.cors){var b;return{send:function(c,d){var e,f=a.xhr(),g=++Wc;if(f.open(a.type,a.url,a.async,a.username,a.password),a.xhrFields)for(e in a.xhrFields)f[e]=a.xhrFields[e];a.mimeType&&f.overrideMimeType&&f.overrideMimeType(a.mimeType),a.crossDomain||c["X-Requested-With"]||(c["X-Requested-With"]="XMLHttpRequest");for(e in c)void 0!==c[e]&&f.setRequestHeader(e,c[e]+"");f.send(a.hasContent&&a.data||null),b=function(c,e){var h,i,j;if(b&&(e||4===f.readyState))if(delete Xc[g],b=void 0,f.onreadystatechange=m.noop,e)4!==f.readyState&&f.abort();else{j={},h=f.status,"string"==typeof f.responseText&&(j.text=f.responseText);try{i=f.statusText}catch(k){i=""}h||!a.isLocal||a.crossDomain?1223===h&&(h=204):h=j.text?200:404}j&&d(h,i,j,f.getAllResponseHeaders())},a.async?4===f.readyState?setTimeout(b):f.onreadystatechange=Xc[g]=b:b()},abort:function(){b&&b(void 0,!0)}}}});function Zc(){try{return new a.XMLHttpRequest}catch(b){}}function $c(){try{return new a.ActiveXObject("Microsoft.XMLHTTP")}catch(b){}}m.ajaxSetup({accepts:{script:"text/javascript, application/javascript, application/ecmascript, application/x-ecmascript"},contents:{script:/(?:java|ecma)script/},converters:{"text script":function(a){return m.globalEval(a),a}}}),m.ajaxPrefilter("script",function(a){void 0===a.cache&&(a.cache=!1),a.crossDomain&&(a.type="GET",a.global=!1)}),m.ajaxTransport("script",function(a){if(a.crossDomain){var b,c=y.head||m("head")[0]||y.documentElement;return{send:function(d,e){b=y.createElement("script"),b.async=!0,a.scriptCharset&&(b.charset=a.scriptCharset),b.src=a.url,b.onload=b.onreadystatechange=function(a,c){(c||!b.readyState||/loaded|complete/.test(b.readyState))&&(b.onload=b.onreadystatechange=null,b.parentNode&&b.parentNode.removeChild(b),b=null,c||e(200,"success"))},c.insertBefore(b,c.firstChild)},abort:function(){b&&b.onload(void 0,!0)}}}});var _c=[],ad=/(=)\?(?=&|$)|\?\?/;m.ajaxSetup({jsonp:"callback",jsonpCallback:function(){var a=_c.pop()||m.expando+"_"+vc++;return this[a]=!0,a}}),m.ajaxPrefilter("json jsonp",function(b,c,d){var e,f,g,h=b.jsonp!==!1&&(ad.test(b.url)?"url":"string"==typeof b.data&&!(b.contentType||"").indexOf("application/x-www-form-urlencoded")&&ad.test(b.data)&&"data");return h||"jsonp"===b.dataTypes[0]?(e=b.jsonpCallback=m.isFunction(b.jsonpCallback)?b.jsonpCallback():b.jsonpCallback,h?b[h]=b[h].replace(ad,"$1"+e):b.jsonp!==!1&&(b.url+=(wc.test(b.url)?"&":"?")+b.jsonp+"="+e),b.converters["script json"]=function(){return g||m.error(e+" was not called"),g[0]},b.dataTypes[0]="json",f=a[e],a[e]=function(){g=arguments},d.always(function(){a[e]=f,b[e]&&(b.jsonpCallback=c.jsonpCallback,_c.push(e)),g&&m.isFunction(f)&&f(g[0]),g=f=void 0}),"script"):void 0}),m.parseHTML=function(a,b,c){if(!a||"string"!=typeof a)return null;"boolean"==typeof b&&(c=b,b=!1),b=b||y;var d=u.exec(a),e=!c&&[];return d?[b.createElement(d[1])]:(d=m.buildFragment([a],b,e),e&&e.length&&m(e).remove(),m.merge([],d.childNodes))};var bd=m.fn.load;m.fn.load=function(a,b,c){if("string"!=typeof a&&bd)return bd.apply(this,arguments);var d,e,f,g=this,h=a.indexOf(" ");return h>=0&&(d=m.trim(a.slice(h,a.length)),a=a.slice(0,h)),m.isFunction(b)?(c=b,b=void 0):b&&"object"==typeof b&&(f="POST"),g.length>0&&m.ajax({url:a,type:f,dataType:"html",data:b}).done(function(a){e=arguments,g.html(d?m("<div>").append(m.parseHTML(a)).find(d):a)}).complete(c&&function(a,b){g.each(c,e||[a.responseText,b,a])}),this},m.expr.filters.animated=function(a){return m.grep(m.timers,function(b){return a===b.elem}).length};var cd=a.document.documentElement;function dd(a){return m.isWindow(a)?a:9===a.nodeType?a.defaultView||a.parentWindow:!1}m.offset={setOffset:function(a,b,c){var d,e,f,g,h,i,j,k=m.css(a,"position"),l=m(a),n={};"static"===k&&(a.style.position="relative"),h=l.offset(),f=m.css(a,"top"),i=m.css(a,"left"),j=("absolute"===k||"fixed"===k)&&m.inArray("auto",[f,i])>-1,j?(d=l.position(),g=d.top,e=d.left):(g=parseFloat(f)||0,e=parseFloat(i)||0),m.isFunction(b)&&(b=b.call(a,c,h)),null!=b.top&&(n.top=b.top-h.top+g),null!=b.left&&(n.left=b.left-h.left+e),"using"in b?b.using.call(a,n):l.css(n)}},m.fn.extend({offset:function(a){if(arguments.length)return void 0===a?this:this.each(function(b){m.offset.setOffset(this,a,b)});var b,c,d={top:0,left:0},e=this[0],f=e&&e.ownerDocument;if(f)return b=f.documentElement,m.contains(b,e)?(typeof e.getBoundingClientRect!==K&&(d=e.getBoundingClientRect()),c=dd(f),{top:d.top+(c.pageYOffset||b.scrollTop)-(b.clientTop||0),left:d.left+(c.pageXOffset||b.scrollLeft)-(b.clientLeft||0)}):d},position:function(){if(this[0]){var a,b,c={top:0,left:0},d=this[0];return"fixed"===m.css(d,"position")?b=d.getBoundingClientRect():(a=this.offsetParent(),b=this.offset(),m.nodeName(a[0],"html")||(c=a.offset()),c.top+=m.css(a[0],"borderTopWidth",!0),c.left+=m.css(a[0],"borderLeftWidth",!0)),{top:b.top-c.top-m.css(d,"marginTop",!0),left:b.left-c.left-m.css(d,"marginLeft",!0)}}},offsetParent:function(){return this.map(function(){var a=this.offsetParent||cd;while(a&&!m.nodeName(a,"html")&&"static"===m.css(a,"position"))a=a.offsetParent;return a||cd})}}),m.each({scrollLeft:"pageXOffset",scrollTop:"pageYOffset"},function(a,b){var c=/Y/.test(b);m.fn[a]=function(d){return V(this,function(a,d,e){var f=dd(a);return void 0===e?f?b in f?f[b]:f.document.documentElement[d]:a[d]:void(f?f.scrollTo(c?m(f).scrollLeft():e,c?e:m(f).scrollTop()):a[d]=e)},a,d,arguments.length,null)}}),m.each(["top","left"],function(a,b){m.cssHooks[b]=Lb(k.pixelPosition,function(a,c){return c?(c=Jb(a,b),Hb.test(c)?m(a).position()[b]+"px":c):void 0})}),m.each({Height:"height",Width:"width"},function(a,b){m.each({padding:"inner"+a,content:b,"":"outer"+a},function(c,d){m.fn[d]=function(d,e){var f=arguments.length&&(c||"boolean"!=typeof d),g=c||(d===!0||e===!0?"margin":"border");return V(this,function(b,c,d){var e;return m.isWindow(b)?b.document.documentElement["client"+a]:9===b.nodeType?(e=b.documentElement,Math.max(b.body["scroll"+a],e["scroll"+a],b.body["offset"+a],e["offset"+a],e["client"+a])):void 0===d?m.css(b,c,g):m.style(b,c,d,g)},b,f?d:void 0,f,null)}})}),m.fn.size=function(){return this.length},m.fn.andSelf=m.fn.addBack,"function"==typeof define&&define.amd&&define("jquery",[],function(){return m});var ed=a.jQuery,fd=a.$;return m.noConflict=function(b){return a.$===m&&(a.$=fd),b&&a.jQuery===m&&(a.jQuery=ed),m},typeof b===K&&(a.jQuery=a.$=m),m}); diff --git a/doc/html/_static/minus.png b/doc/html/_static/minus.png index da1c5620d10c047525a467a425abe9ff5269cfc2..0f22b16b038f9578a40314ff2b5acb88402a1496 100644 Binary files a/doc/html/_static/minus.png and b/doc/html/_static/minus.png differ diff --git a/doc/html/_static/plus.png b/doc/html/_static/plus.png index b3cb37425ea68b39ffa7b2e5fb69161275a87541..0cfe084cfc8d10d7151a0f00faee3667afe0b24b 100644 Binary files a/doc/html/_static/plus.png and b/doc/html/_static/plus.png differ diff --git a/doc/html/_static/pygments.css b/doc/html/_static/pygments.css index d79caa151c28f0b24a636319b0d9d732f6c597b5..57eadc030ea86ea65a3747c27dfa3ef334f8f79a 100644 --- a/doc/html/_static/pygments.css +++ b/doc/html/_static/pygments.css @@ -40,6 +40,7 @@ .highlight .nv { color: #bb60d5 } /* Name.Variable */ .highlight .ow { color: #007020; font-weight: bold } /* Operator.Word */ .highlight .w { color: #bbbbbb } /* Text.Whitespace */ +.highlight .mb { color: #208050 } /* Literal.Number.Bin */ .highlight .mf { color: #208050 } /* Literal.Number.Float */ .highlight .mh { color: #208050 } /* Literal.Number.Hex */ .highlight .mi { color: #208050 } /* Literal.Number.Integer */ diff --git a/doc/html/_static/searchtools.js b/doc/html/_static/searchtools.js index 6e1f06bd1b9b1e3969cbd453a4ed16eb31f7977d..0e794fd3e906970a10812199e11f9f159ab906b5 100644 --- a/doc/html/_static/searchtools.js +++ b/doc/html/_static/searchtools.js @@ -4,7 +4,7 @@ * * Sphinx JavaScript utilties for the full-text search. * - * :copyright: Copyright 2007-2014 by the Sphinx team, see AUTHORS. + * :copyright: Copyright 2007-2015 by the Sphinx team, see AUTHORS. * :license: BSD, see LICENSE for details. * */ @@ -439,7 +439,7 @@ var Search = { dataType: "text", complete: function(jqxhr, textstatus) { var data = jqxhr.responseText; - if (data !== '') { + if (data !== '' && data !== undefined) { listItem.append(Search.makeSearchSummary(data, searchterms, hlterms)); } Search.output.append(listItem); diff --git a/doc/html/_static/sidebar.js b/doc/html/_static/sidebar.js deleted file mode 100644 index 4f09a0df1f433af4e045a62871ebb12169557710..0000000000000000000000000000000000000000 --- a/doc/html/_static/sidebar.js +++ /dev/null @@ -1,159 +0,0 @@ -/* - * sidebar.js - * ~~~~~~~~~~ - * - * This script makes the Sphinx sidebar collapsible. - * - * .sphinxsidebar contains .sphinxsidebarwrapper. This script adds - * in .sphixsidebar, after .sphinxsidebarwrapper, the #sidebarbutton - * used to collapse and expand the sidebar. - * - * When the sidebar is collapsed the .sphinxsidebarwrapper is hidden - * and the width of the sidebar and the margin-left of the document - * are decreased. When the sidebar is expanded the opposite happens. - * This script saves a per-browser/per-session cookie used to - * remember the position of the sidebar among the pages. - * Once the browser is closed the cookie is deleted and the position - * reset to the default (expanded). - * - * :copyright: Copyright 2007-2014 by the Sphinx team, see AUTHORS. - * :license: BSD, see LICENSE for details. - * - */ - -$(function() { - - - - - - - - - // global elements used by the functions. - // the 'sidebarbutton' element is defined as global after its - // creation, in the add_sidebar_button function - var bodywrapper = $('.bodywrapper'); - var sidebar = $('.sphinxsidebar'); - var sidebarwrapper = $('.sphinxsidebarwrapper'); - - // for some reason, the document has no sidebar; do not run into errors - if (!sidebar.length) return; - - // original margin-left of the bodywrapper and width of the sidebar - // with the sidebar expanded - var bw_margin_expanded = bodywrapper.css('margin-left'); - var ssb_width_expanded = sidebar.width(); - - // margin-left of the bodywrapper and width of the sidebar - // with the sidebar collapsed - var bw_margin_collapsed = '.8em'; - var ssb_width_collapsed = '.8em'; - - // colors used by the current theme - var dark_color = $('.related').css('background-color'); - var light_color = $('.document').css('background-color'); - - function sidebar_is_collapsed() { - return sidebarwrapper.is(':not(:visible)'); - } - - function toggle_sidebar() { - if (sidebar_is_collapsed()) - expand_sidebar(); - else - collapse_sidebar(); - } - - function collapse_sidebar() { - sidebarwrapper.hide(); - sidebar.css('width', ssb_width_collapsed); - bodywrapper.css('margin-left', bw_margin_collapsed); - sidebarbutton.css({ - 'margin-left': '0', - 'height': bodywrapper.height() - }); - sidebarbutton.find('span').text('»'); - sidebarbutton.attr('title', _('Expand sidebar')); - document.cookie = 'sidebar=collapsed'; - } - - function expand_sidebar() { - bodywrapper.css('margin-left', bw_margin_expanded); - sidebar.css('width', ssb_width_expanded); - sidebarwrapper.show(); - sidebarbutton.css({ - 'margin-left': ssb_width_expanded-12, - 'height': bodywrapper.height() - }); - sidebarbutton.find('span').text('«'); - sidebarbutton.attr('title', _('Collapse sidebar')); - document.cookie = 'sidebar=expanded'; - } - - function add_sidebar_button() { - sidebarwrapper.css({ - 'float': 'left', - 'margin-right': '0', - 'width': ssb_width_expanded - 28 - }); - // create the button - sidebar.append( - '<div id="sidebarbutton"><span>«</span></div>' - ); - var sidebarbutton = $('#sidebarbutton'); - light_color = sidebarbutton.css('background-color'); - // find the height of the viewport to center the '<<' in the page - var viewport_height; - if (window.innerHeight) - viewport_height = window.innerHeight; - else - viewport_height = $(window).height(); - sidebarbutton.find('span').css({ - 'display': 'block', - 'margin-top': (viewport_height - sidebar.position().top - 20) / 2 - }); - - sidebarbutton.click(toggle_sidebar); - sidebarbutton.attr('title', _('Collapse sidebar')); - sidebarbutton.css({ - 'color': '#FFFFFF', - 'border-left': '1px solid ' + dark_color, - 'font-size': '1.2em', - 'cursor': 'pointer', - 'height': bodywrapper.height(), - 'padding-top': '1px', - 'margin-left': ssb_width_expanded - 12 - }); - - sidebarbutton.hover( - function () { - $(this).css('background-color', dark_color); - }, - function () { - $(this).css('background-color', light_color); - } - ); - } - - function set_position_from_cookie() { - if (!document.cookie) - return; - var items = document.cookie.split(';'); - for(var k=0; k<items.length; k++) { - var key_val = items[k].split('='); - var key = key_val[0].replace(/ /, ""); // strip leading spaces - if (key == 'sidebar') { - var value = key_val[1]; - if ((value == 'collapsed') && (!sidebar_is_collapsed())) - collapse_sidebar(); - else if ((value == 'expanded') && (sidebar_is_collapsed())) - expand_sidebar(); - } - } - } - - add_sidebar_button(); - var sidebarbutton = $('#sidebarbutton'); - set_position_from_cookie(); -}); \ No newline at end of file diff --git a/doc/html/_static/underscore-1.3.1.js b/doc/html/_static/underscore-1.3.1.js new file mode 100644 index 0000000000000000000000000000000000000000..208d4cd890c3183d946092ebe982738ade565061 --- /dev/null +++ b/doc/html/_static/underscore-1.3.1.js @@ -0,0 +1,999 @@ +// Underscore.js 1.3.1 +// (c) 2009-2012 Jeremy Ashkenas, DocumentCloud Inc. +// Underscore is freely distributable under the MIT license. +// Portions of Underscore are inspired or borrowed from Prototype, +// Oliver Steele's Functional, and John Resig's Micro-Templating. +// For all details and documentation: +// http://documentcloud.github.com/underscore + +(function() { + + // Baseline setup + // -------------- + + // Establish the root object, `window` in the browser, or `global` on the server. + var root = this; + + // Save the previous value of the `_` variable. + var previousUnderscore = root._; + + // Establish the object that gets returned to break out of a loop iteration. + var breaker = {}; + + // Save bytes in the minified (but not gzipped) version: + var ArrayProto = Array.prototype, ObjProto = Object.prototype, FuncProto = Function.prototype; + + // Create quick reference variables for speed access to core prototypes. + var slice = ArrayProto.slice, + unshift = ArrayProto.unshift, + toString = ObjProto.toString, + hasOwnProperty = ObjProto.hasOwnProperty; + + // All **ECMAScript 5** native function implementations that we hope to use + // are declared here. + var + nativeForEach = ArrayProto.forEach, + nativeMap = ArrayProto.map, + nativeReduce = ArrayProto.reduce, + nativeReduceRight = ArrayProto.reduceRight, + nativeFilter = ArrayProto.filter, + nativeEvery = ArrayProto.every, + nativeSome = ArrayProto.some, + nativeIndexOf = ArrayProto.indexOf, + nativeLastIndexOf = ArrayProto.lastIndexOf, + nativeIsArray = Array.isArray, + nativeKeys = Object.keys, + nativeBind = FuncProto.bind; + + // Create a safe reference to the Underscore object for use below. + var _ = function(obj) { return new wrapper(obj); }; + + // Export the Underscore object for **Node.js**, with + // backwards-compatibility for the old `require()` API. If we're in + // the browser, add `_` as a global object via a string identifier, + // for Closure Compiler "advanced" mode. + if (typeof exports !== 'undefined') { + if (typeof module !== 'undefined' && module.exports) { + exports = module.exports = _; + } + exports._ = _; + } else { + root['_'] = _; + } + + // Current version. + _.VERSION = '1.3.1'; + + // Collection Functions + // -------------------- + + // The cornerstone, an `each` implementation, aka `forEach`. + // Handles objects with the built-in `forEach`, arrays, and raw objects. + // Delegates to **ECMAScript 5**'s native `forEach` if available. + var each = _.each = _.forEach = function(obj, iterator, context) { + if (obj == null) return; + if (nativeForEach && obj.forEach === nativeForEach) { + obj.forEach(iterator, context); + } else if (obj.length === +obj.length) { + for (var i = 0, l = obj.length; i < l; i++) { + if (i in obj && iterator.call(context, obj[i], i, obj) === breaker) return; + } + } else { + for (var key in obj) { + if (_.has(obj, key)) { + if (iterator.call(context, obj[key], key, obj) === breaker) return; + } + } + } + }; + + // Return the results of applying the iterator to each element. + // Delegates to **ECMAScript 5**'s native `map` if available. + _.map = _.collect = function(obj, iterator, context) { + var results = []; + if (obj == null) return results; + if (nativeMap && obj.map === nativeMap) return obj.map(iterator, context); + each(obj, function(value, index, list) { + results[results.length] = iterator.call(context, value, index, list); + }); + if (obj.length === +obj.length) results.length = obj.length; + return results; + }; + + // **Reduce** builds up a single result from a list of values, aka `inject`, + // or `foldl`. Delegates to **ECMAScript 5**'s native `reduce` if available. + _.reduce = _.foldl = _.inject = function(obj, iterator, memo, context) { + var initial = arguments.length > 2; + if (obj == null) obj = []; + if (nativeReduce && obj.reduce === nativeReduce) { + if (context) iterator = _.bind(iterator, context); + return initial ? obj.reduce(iterator, memo) : obj.reduce(iterator); + } + each(obj, function(value, index, list) { + if (!initial) { + memo = value; + initial = true; + } else { + memo = iterator.call(context, memo, value, index, list); + } + }); + if (!initial) throw new TypeError('Reduce of empty array with no initial value'); + return memo; + }; + + // The right-associative version of reduce, also known as `foldr`. + // Delegates to **ECMAScript 5**'s native `reduceRight` if available. + _.reduceRight = _.foldr = function(obj, iterator, memo, context) { + var initial = arguments.length > 2; + if (obj == null) obj = []; + if (nativeReduceRight && obj.reduceRight === nativeReduceRight) { + if (context) iterator = _.bind(iterator, context); + return initial ? obj.reduceRight(iterator, memo) : obj.reduceRight(iterator); + } + var reversed = _.toArray(obj).reverse(); + if (context && !initial) iterator = _.bind(iterator, context); + return initial ? _.reduce(reversed, iterator, memo, context) : _.reduce(reversed, iterator); + }; + + // Return the first value which passes a truth test. Aliased as `detect`. + _.find = _.detect = function(obj, iterator, context) { + var result; + any(obj, function(value, index, list) { + if (iterator.call(context, value, index, list)) { + result = value; + return true; + } + }); + return result; + }; + + // Return all the elements that pass a truth test. + // Delegates to **ECMAScript 5**'s native `filter` if available. + // Aliased as `select`. + _.filter = _.select = function(obj, iterator, context) { + var results = []; + if (obj == null) return results; + if (nativeFilter && obj.filter === nativeFilter) return obj.filter(iterator, context); + each(obj, function(value, index, list) { + if (iterator.call(context, value, index, list)) results[results.length] = value; + }); + return results; + }; + + // Return all the elements for which a truth test fails. + _.reject = function(obj, iterator, context) { + var results = []; + if (obj == null) return results; + each(obj, function(value, index, list) { + if (!iterator.call(context, value, index, list)) results[results.length] = value; + }); + return results; + }; + + // Determine whether all of the elements match a truth test. + // Delegates to **ECMAScript 5**'s native `every` if available. + // Aliased as `all`. + _.every = _.all = function(obj, iterator, context) { + var result = true; + if (obj == null) return result; + if (nativeEvery && obj.every === nativeEvery) return obj.every(iterator, context); + each(obj, function(value, index, list) { + if (!(result = result && iterator.call(context, value, index, list))) return breaker; + }); + return result; + }; + + // Determine if at least one element in the object matches a truth test. + // Delegates to **ECMAScript 5**'s native `some` if available. + // Aliased as `any`. + var any = _.some = _.any = function(obj, iterator, context) { + iterator || (iterator = _.identity); + var result = false; + if (obj == null) return result; + if (nativeSome && obj.some === nativeSome) return obj.some(iterator, context); + each(obj, function(value, index, list) { + if (result || (result = iterator.call(context, value, index, list))) return breaker; + }); + return !!result; + }; + + // Determine if a given value is included in the array or object using `===`. + // Aliased as `contains`. + _.include = _.contains = function(obj, target) { + var found = false; + if (obj == null) return found; + if (nativeIndexOf && obj.indexOf === nativeIndexOf) return obj.indexOf(target) != -1; + found = any(obj, function(value) { + return value === target; + }); + return found; + }; + + // Invoke a method (with arguments) on every item in a collection. + _.invoke = function(obj, method) { + var args = slice.call(arguments, 2); + return _.map(obj, function(value) { + return (_.isFunction(method) ? method || value : value[method]).apply(value, args); + }); + }; + + // Convenience version of a common use case of `map`: fetching a property. + _.pluck = function(obj, key) { + return _.map(obj, function(value){ return value[key]; }); + }; + + // Return the maximum element or (element-based computation). + _.max = function(obj, iterator, context) { + if (!iterator && _.isArray(obj)) return Math.max.apply(Math, obj); + if (!iterator && _.isEmpty(obj)) return -Infinity; + var result = {computed : -Infinity}; + each(obj, function(value, index, list) { + var computed = iterator ? iterator.call(context, value, index, list) : value; + computed >= result.computed && (result = {value : value, computed : computed}); + }); + return result.value; + }; + + // Return the minimum element (or element-based computation). + _.min = function(obj, iterator, context) { + if (!iterator && _.isArray(obj)) return Math.min.apply(Math, obj); + if (!iterator && _.isEmpty(obj)) return Infinity; + var result = {computed : Infinity}; + each(obj, function(value, index, list) { + var computed = iterator ? iterator.call(context, value, index, list) : value; + computed < result.computed && (result = {value : value, computed : computed}); + }); + return result.value; + }; + + // Shuffle an array. + _.shuffle = function(obj) { + var shuffled = [], rand; + each(obj, function(value, index, list) { + if (index == 0) { + shuffled[0] = value; + } else { + rand = Math.floor(Math.random() * (index + 1)); + shuffled[index] = shuffled[rand]; + shuffled[rand] = value; + } + }); + return shuffled; + }; + + // Sort the object's values by a criterion produced by an iterator. + _.sortBy = function(obj, iterator, context) { + return _.pluck(_.map(obj, function(value, index, list) { + return { + value : value, + criteria : iterator.call(context, value, index, list) + }; + }).sort(function(left, right) { + var a = left.criteria, b = right.criteria; + return a < b ? -1 : a > b ? 1 : 0; + }), 'value'); + }; + + // Groups the object's values by a criterion. Pass either a string attribute + // to group by, or a function that returns the criterion. + _.groupBy = function(obj, val) { + var result = {}; + var iterator = _.isFunction(val) ? val : function(obj) { return obj[val]; }; + each(obj, function(value, index) { + var key = iterator(value, index); + (result[key] || (result[key] = [])).push(value); + }); + return result; + }; + + // Use a comparator function to figure out at what index an object should + // be inserted so as to maintain order. Uses binary search. + _.sortedIndex = function(array, obj, iterator) { + iterator || (iterator = _.identity); + var low = 0, high = array.length; + while (low < high) { + var mid = (low + high) >> 1; + iterator(array[mid]) < iterator(obj) ? low = mid + 1 : high = mid; + } + return low; + }; + + // Safely convert anything iterable into a real, live array. + _.toArray = function(iterable) { + if (!iterable) return []; + if (iterable.toArray) return iterable.toArray(); + if (_.isArray(iterable)) return slice.call(iterable); + if (_.isArguments(iterable)) return slice.call(iterable); + return _.values(iterable); + }; + + // Return the number of elements in an object. + _.size = function(obj) { + return _.toArray(obj).length; + }; + + // Array Functions + // --------------- + + // Get the first element of an array. Passing **n** will return the first N + // values in the array. Aliased as `head`. The **guard** check allows it to work + // with `_.map`. + _.first = _.head = function(array, n, guard) { + return (n != null) && !guard ? slice.call(array, 0, n) : array[0]; + }; + + // Returns everything but the last entry of the array. Especcialy useful on + // the arguments object. Passing **n** will return all the values in + // the array, excluding the last N. The **guard** check allows it to work with + // `_.map`. + _.initial = function(array, n, guard) { + return slice.call(array, 0, array.length - ((n == null) || guard ? 1 : n)); + }; + + // Get the last element of an array. Passing **n** will return the last N + // values in the array. The **guard** check allows it to work with `_.map`. + _.last = function(array, n, guard) { + if ((n != null) && !guard) { + return slice.call(array, Math.max(array.length - n, 0)); + } else { + return array[array.length - 1]; + } + }; + + // Returns everything but the first entry of the array. Aliased as `tail`. + // Especially useful on the arguments object. Passing an **index** will return + // the rest of the values in the array from that index onward. The **guard** + // check allows it to work with `_.map`. + _.rest = _.tail = function(array, index, guard) { + return slice.call(array, (index == null) || guard ? 1 : index); + }; + + // Trim out all falsy values from an array. + _.compact = function(array) { + return _.filter(array, function(value){ return !!value; }); + }; + + // Return a completely flattened version of an array. + _.flatten = function(array, shallow) { + return _.reduce(array, function(memo, value) { + if (_.isArray(value)) return memo.concat(shallow ? value : _.flatten(value)); + memo[memo.length] = value; + return memo; + }, []); + }; + + // Return a version of the array that does not contain the specified value(s). + _.without = function(array) { + return _.difference(array, slice.call(arguments, 1)); + }; + + // Produce a duplicate-free version of the array. If the array has already + // been sorted, you have the option of using a faster algorithm. + // Aliased as `unique`. + _.uniq = _.unique = function(array, isSorted, iterator) { + var initial = iterator ? _.map(array, iterator) : array; + var result = []; + _.reduce(initial, function(memo, el, i) { + if (0 == i || (isSorted === true ? _.last(memo) != el : !_.include(memo, el))) { + memo[memo.length] = el; + result[result.length] = array[i]; + } + return memo; + }, []); + return result; + }; + + // Produce an array that contains the union: each distinct element from all of + // the passed-in arrays. + _.union = function() { + return _.uniq(_.flatten(arguments, true)); + }; + + // Produce an array that contains every item shared between all the + // passed-in arrays. (Aliased as "intersect" for back-compat.) + _.intersection = _.intersect = function(array) { + var rest = slice.call(arguments, 1); + return _.filter(_.uniq(array), function(item) { + return _.every(rest, function(other) { + return _.indexOf(other, item) >= 0; + }); + }); + }; + + // Take the difference between one array and a number of other arrays. + // Only the elements present in just the first array will remain. + _.difference = function(array) { + var rest = _.flatten(slice.call(arguments, 1)); + return _.filter(array, function(value){ return !_.include(rest, value); }); + }; + + // Zip together multiple lists into a single array -- elements that share + // an index go together. + _.zip = function() { + var args = slice.call(arguments); + var length = _.max(_.pluck(args, 'length')); + var results = new Array(length); + for (var i = 0; i < length; i++) results[i] = _.pluck(args, "" + i); + return results; + }; + + // If the browser doesn't supply us with indexOf (I'm looking at you, **MSIE**), + // we need this function. Return the position of the first occurrence of an + // item in an array, or -1 if the item is not included in the array. + // Delegates to **ECMAScript 5**'s native `indexOf` if available. + // If the array is large and already in sort order, pass `true` + // for **isSorted** to use binary search. + _.indexOf = function(array, item, isSorted) { + if (array == null) return -1; + var i, l; + if (isSorted) { + i = _.sortedIndex(array, item); + return array[i] === item ? i : -1; + } + if (nativeIndexOf && array.indexOf === nativeIndexOf) return array.indexOf(item); + for (i = 0, l = array.length; i < l; i++) if (i in array && array[i] === item) return i; + return -1; + }; + + // Delegates to **ECMAScript 5**'s native `lastIndexOf` if available. + _.lastIndexOf = function(array, item) { + if (array == null) return -1; + if (nativeLastIndexOf && array.lastIndexOf === nativeLastIndexOf) return array.lastIndexOf(item); + var i = array.length; + while (i--) if (i in array && array[i] === item) return i; + return -1; + }; + + // Generate an integer Array containing an arithmetic progression. A port of + // the native Python `range()` function. See + // [the Python documentation](http://docs.python.org/library/functions.html#range). + _.range = function(start, stop, step) { + if (arguments.length <= 1) { + stop = start || 0; + start = 0; + } + step = arguments[2] || 1; + + var len = Math.max(Math.ceil((stop - start) / step), 0); + var idx = 0; + var range = new Array(len); + + while(idx < len) { + range[idx++] = start; + start += step; + } + + return range; + }; + + // Function (ahem) Functions + // ------------------ + + // Reusable constructor function for prototype setting. + var ctor = function(){}; + + // Create a function bound to a given object (assigning `this`, and arguments, + // optionally). Binding with arguments is also known as `curry`. + // Delegates to **ECMAScript 5**'s native `Function.bind` if available. + // We check for `func.bind` first, to fail fast when `func` is undefined. + _.bind = function bind(func, context) { + var bound, args; + if (func.bind === nativeBind && nativeBind) return nativeBind.apply(func, slice.call(arguments, 1)); + if (!_.isFunction(func)) throw new TypeError; + args = slice.call(arguments, 2); + return bound = function() { + if (!(this instanceof bound)) return func.apply(context, args.concat(slice.call(arguments))); + ctor.prototype = func.prototype; + var self = new ctor; + var result = func.apply(self, args.concat(slice.call(arguments))); + if (Object(result) === result) return result; + return self; + }; + }; + + // Bind all of an object's methods to that object. Useful for ensuring that + // all callbacks defined on an object belong to it. + _.bindAll = function(obj) { + var funcs = slice.call(arguments, 1); + if (funcs.length == 0) funcs = _.functions(obj); + each(funcs, function(f) { obj[f] = _.bind(obj[f], obj); }); + return obj; + }; + + // Memoize an expensive function by storing its results. + _.memoize = function(func, hasher) { + var memo = {}; + hasher || (hasher = _.identity); + return function() { + var key = hasher.apply(this, arguments); + return _.has(memo, key) ? memo[key] : (memo[key] = func.apply(this, arguments)); + }; + }; + + // Delays a function for the given number of milliseconds, and then calls + // it with the arguments supplied. + _.delay = function(func, wait) { + var args = slice.call(arguments, 2); + return setTimeout(function(){ return func.apply(func, args); }, wait); + }; + + // Defers a function, scheduling it to run after the current call stack has + // cleared. + _.defer = function(func) { + return _.delay.apply(_, [func, 1].concat(slice.call(arguments, 1))); + }; + + // Returns a function, that, when invoked, will only be triggered at most once + // during a given window of time. + _.throttle = function(func, wait) { + var context, args, timeout, throttling, more; + var whenDone = _.debounce(function(){ more = throttling = false; }, wait); + return function() { + context = this; args = arguments; + var later = function() { + timeout = null; + if (more) func.apply(context, args); + whenDone(); + }; + if (!timeout) timeout = setTimeout(later, wait); + if (throttling) { + more = true; + } else { + func.apply(context, args); + } + whenDone(); + throttling = true; + }; + }; + + // Returns a function, that, as long as it continues to be invoked, will not + // be triggered. The function will be called after it stops being called for + // N milliseconds. + _.debounce = function(func, wait) { + var timeout; + return function() { + var context = this, args = arguments; + var later = function() { + timeout = null; + func.apply(context, args); + }; + clearTimeout(timeout); + timeout = setTimeout(later, wait); + }; + }; + + // Returns a function that will be executed at most one time, no matter how + // often you call it. Useful for lazy initialization. + _.once = function(func) { + var ran = false, memo; + return function() { + if (ran) return memo; + ran = true; + return memo = func.apply(this, arguments); + }; + }; + + // Returns the first function passed as an argument to the second, + // allowing you to adjust arguments, run code before and after, and + // conditionally execute the original function. + _.wrap = function(func, wrapper) { + return function() { + var args = [func].concat(slice.call(arguments, 0)); + return wrapper.apply(this, args); + }; + }; + + // Returns a function that is the composition of a list of functions, each + // consuming the return value of the function that follows. + _.compose = function() { + var funcs = arguments; + return function() { + var args = arguments; + for (var i = funcs.length - 1; i >= 0; i--) { + args = [funcs[i].apply(this, args)]; + } + return args[0]; + }; + }; + + // Returns a function that will only be executed after being called N times. + _.after = function(times, func) { + if (times <= 0) return func(); + return function() { + if (--times < 1) { return func.apply(this, arguments); } + }; + }; + + // Object Functions + // ---------------- + + // Retrieve the names of an object's properties. + // Delegates to **ECMAScript 5**'s native `Object.keys` + _.keys = nativeKeys || function(obj) { + if (obj !== Object(obj)) throw new TypeError('Invalid object'); + var keys = []; + for (var key in obj) if (_.has(obj, key)) keys[keys.length] = key; + return keys; + }; + + // Retrieve the values of an object's properties. + _.values = function(obj) { + return _.map(obj, _.identity); + }; + + // Return a sorted list of the function names available on the object. + // Aliased as `methods` + _.functions = _.methods = function(obj) { + var names = []; + for (var key in obj) { + if (_.isFunction(obj[key])) names.push(key); + } + return names.sort(); + }; + + // Extend a given object with all the properties in passed-in object(s). + _.extend = function(obj) { + each(slice.call(arguments, 1), function(source) { + for (var prop in source) { + obj[prop] = source[prop]; + } + }); + return obj; + }; + + // Fill in a given object with default properties. + _.defaults = function(obj) { + each(slice.call(arguments, 1), function(source) { + for (var prop in source) { + if (obj[prop] == null) obj[prop] = source[prop]; + } + }); + return obj; + }; + + // Create a (shallow-cloned) duplicate of an object. + _.clone = function(obj) { + if (!_.isObject(obj)) return obj; + return _.isArray(obj) ? obj.slice() : _.extend({}, obj); + }; + + // Invokes interceptor with the obj, and then returns obj. + // The primary purpose of this method is to "tap into" a method chain, in + // order to perform operations on intermediate results within the chain. + _.tap = function(obj, interceptor) { + interceptor(obj); + return obj; + }; + + // Internal recursive comparison function. + function eq(a, b, stack) { + // Identical objects are equal. `0 === -0`, but they aren't identical. + // See the Harmony `egal` proposal: http://wiki.ecmascript.org/doku.php?id=harmony:egal. + if (a === b) return a !== 0 || 1 / a == 1 / b; + // A strict comparison is necessary because `null == undefined`. + if (a == null || b == null) return a === b; + // Unwrap any wrapped objects. + if (a._chain) a = a._wrapped; + if (b._chain) b = b._wrapped; + // Invoke a custom `isEqual` method if one is provided. + if (a.isEqual && _.isFunction(a.isEqual)) return a.isEqual(b); + if (b.isEqual && _.isFunction(b.isEqual)) return b.isEqual(a); + // Compare `[[Class]]` names. + var className = toString.call(a); + if (className != toString.call(b)) return false; + switch (className) { + // Strings, numbers, dates, and booleans are compared by value. + case '[object String]': + // Primitives and their corresponding object wrappers are equivalent; thus, `"5"` is + // equivalent to `new String("5")`. + return a == String(b); + case '[object Number]': + // `NaN`s are equivalent, but non-reflexive. An `egal` comparison is performed for + // other numeric values. + return a != +a ? b != +b : (a == 0 ? 1 / a == 1 / b : a == +b); + case '[object Date]': + case '[object Boolean]': + // Coerce dates and booleans to numeric primitive values. Dates are compared by their + // millisecond representations. Note that invalid dates with millisecond representations + // of `NaN` are not equivalent. + return +a == +b; + // RegExps are compared by their source patterns and flags. + case '[object RegExp]': + return a.source == b.source && + a.global == b.global && + a.multiline == b.multiline && + a.ignoreCase == b.ignoreCase; + } + if (typeof a != 'object' || typeof b != 'object') return false; + // Assume equality for cyclic structures. The algorithm for detecting cyclic + // structures is adapted from ES 5.1 section 15.12.3, abstract operation `JO`. + var length = stack.length; + while (length--) { + // Linear search. Performance is inversely proportional to the number of + // unique nested structures. + if (stack[length] == a) return true; + } + // Add the first object to the stack of traversed objects. + stack.push(a); + var size = 0, result = true; + // Recursively compare objects and arrays. + if (className == '[object Array]') { + // Compare array lengths to determine if a deep comparison is necessary. + size = a.length; + result = size == b.length; + if (result) { + // Deep compare the contents, ignoring non-numeric properties. + while (size--) { + // Ensure commutative equality for sparse arrays. + if (!(result = size in a == size in b && eq(a[size], b[size], stack))) break; + } + } + } else { + // Objects with different constructors are not equivalent. + if ('constructor' in a != 'constructor' in b || a.constructor != b.constructor) return false; + // Deep compare objects. + for (var key in a) { + if (_.has(a, key)) { + // Count the expected number of properties. + size++; + // Deep compare each member. + if (!(result = _.has(b, key) && eq(a[key], b[key], stack))) break; + } + } + // Ensure that both objects contain the same number of properties. + if (result) { + for (key in b) { + if (_.has(b, key) && !(size--)) break; + } + result = !size; + } + } + // Remove the first object from the stack of traversed objects. + stack.pop(); + return result; + } + + // Perform a deep comparison to check if two objects are equal. + _.isEqual = function(a, b) { + return eq(a, b, []); + }; + + // Is a given array, string, or object empty? + // An "empty" object has no enumerable own-properties. + _.isEmpty = function(obj) { + if (_.isArray(obj) || _.isString(obj)) return obj.length === 0; + for (var key in obj) if (_.has(obj, key)) return false; + return true; + }; + + // Is a given value a DOM element? + _.isElement = function(obj) { + return !!(obj && obj.nodeType == 1); + }; + + // Is a given value an array? + // Delegates to ECMA5's native Array.isArray + _.isArray = nativeIsArray || function(obj) { + return toString.call(obj) == '[object Array]'; + }; + + // Is a given variable an object? + _.isObject = function(obj) { + return obj === Object(obj); + }; + + // Is a given variable an arguments object? + _.isArguments = function(obj) { + return toString.call(obj) == '[object Arguments]'; + }; + if (!_.isArguments(arguments)) { + _.isArguments = function(obj) { + return !!(obj && _.has(obj, 'callee')); + }; + } + + // Is a given value a function? + _.isFunction = function(obj) { + return toString.call(obj) == '[object Function]'; + }; + + // Is a given value a string? + _.isString = function(obj) { + return toString.call(obj) == '[object String]'; + }; + + // Is a given value a number? + _.isNumber = function(obj) { + return toString.call(obj) == '[object Number]'; + }; + + // Is the given value `NaN`? + _.isNaN = function(obj) { + // `NaN` is the only value for which `===` is not reflexive. + return obj !== obj; + }; + + // Is a given value a boolean? + _.isBoolean = function(obj) { + return obj === true || obj === false || toString.call(obj) == '[object Boolean]'; + }; + + // Is a given value a date? + _.isDate = function(obj) { + return toString.call(obj) == '[object Date]'; + }; + + // Is the given value a regular expression? + _.isRegExp = function(obj) { + return toString.call(obj) == '[object RegExp]'; + }; + + // Is a given value equal to null? + _.isNull = function(obj) { + return obj === null; + }; + + // Is a given variable undefined? + _.isUndefined = function(obj) { + return obj === void 0; + }; + + // Has own property? + _.has = function(obj, key) { + return hasOwnProperty.call(obj, key); + }; + + // Utility Functions + // ----------------- + + // Run Underscore.js in *noConflict* mode, returning the `_` variable to its + // previous owner. Returns a reference to the Underscore object. + _.noConflict = function() { + root._ = previousUnderscore; + return this; + }; + + // Keep the identity function around for default iterators. + _.identity = function(value) { + return value; + }; + + // Run a function **n** times. + _.times = function (n, iterator, context) { + for (var i = 0; i < n; i++) iterator.call(context, i); + }; + + // Escape a string for HTML interpolation. + _.escape = function(string) { + return (''+string).replace(/&/g, '&').replace(/</g, '<').replace(/>/g, '>').replace(/"/g, '"').replace(/'/g, ''').replace(/\//g,'/'); + }; + + // Add your own custom functions to the Underscore object, ensuring that + // they're correctly added to the OOP wrapper as well. + _.mixin = function(obj) { + each(_.functions(obj), function(name){ + addToWrapper(name, _[name] = obj[name]); + }); + }; + + // Generate a unique integer id (unique within the entire client session). + // Useful for temporary DOM ids. + var idCounter = 0; + _.uniqueId = function(prefix) { + var id = idCounter++; + return prefix ? prefix + id : id; + }; + + // By default, Underscore uses ERB-style template delimiters, change the + // following template settings to use alternative delimiters. + _.templateSettings = { + evaluate : /<%([\s\S]+?)%>/g, + interpolate : /<%=([\s\S]+?)%>/g, + escape : /<%-([\s\S]+?)%>/g + }; + + // When customizing `templateSettings`, if you don't want to define an + // interpolation, evaluation or escaping regex, we need one that is + // guaranteed not to match. + var noMatch = /.^/; + + // Within an interpolation, evaluation, or escaping, remove HTML escaping + // that had been previously added. + var unescape = function(code) { + return code.replace(/\\\\/g, '\\').replace(/\\'/g, "'"); + }; + + // JavaScript micro-templating, similar to John Resig's implementation. + // Underscore templating handles arbitrary delimiters, preserves whitespace, + // and correctly escapes quotes within interpolated code. + _.template = function(str, data) { + var c = _.templateSettings; + var tmpl = 'var __p=[],print=function(){__p.push.apply(__p,arguments);};' + + 'with(obj||{}){__p.push(\'' + + str.replace(/\\/g, '\\\\') + .replace(/'/g, "\\'") + .replace(c.escape || noMatch, function(match, code) { + return "',_.escape(" + unescape(code) + "),'"; + }) + .replace(c.interpolate || noMatch, function(match, code) { + return "'," + unescape(code) + ",'"; + }) + .replace(c.evaluate || noMatch, function(match, code) { + return "');" + unescape(code).replace(/[\r\n\t]/g, ' ') + ";__p.push('"; + }) + .replace(/\r/g, '\\r') + .replace(/\n/g, '\\n') + .replace(/\t/g, '\\t') + + "');}return __p.join('');"; + var func = new Function('obj', '_', tmpl); + if (data) return func(data, _); + return function(data) { + return func.call(this, data, _); + }; + }; + + // Add a "chain" function, which will delegate to the wrapper. + _.chain = function(obj) { + return _(obj).chain(); + }; + + // The OOP Wrapper + // --------------- + + // If Underscore is called as a function, it returns a wrapped object that + // can be used OO-style. This wrapper holds altered versions of all the + // underscore functions. Wrapped objects may be chained. + var wrapper = function(obj) { this._wrapped = obj; }; + + // Expose `wrapper.prototype` as `_.prototype` + _.prototype = wrapper.prototype; + + // Helper function to continue chaining intermediate results. + var result = function(obj, chain) { + return chain ? _(obj).chain() : obj; + }; + + // A method to easily add functions to the OOP wrapper. + var addToWrapper = function(name, func) { + wrapper.prototype[name] = function() { + var args = slice.call(arguments); + unshift.call(args, this._wrapped); + return result(func.apply(_, args), this._chain); + }; + }; + + // Add all of the Underscore functions to the wrapper object. + _.mixin(_); + + // Add all mutator Array functions to the wrapper. + each(['pop', 'push', 'reverse', 'shift', 'sort', 'splice', 'unshift'], function(name) { + var method = ArrayProto[name]; + wrapper.prototype[name] = function() { + var wrapped = this._wrapped; + method.apply(wrapped, arguments); + var length = wrapped.length; + if ((name == 'shift' || name == 'splice') && length === 0) delete wrapped[0]; + return result(wrapped, this._chain); + }; + }); + + // Add all accessor Array functions to the wrapper. + each(['concat', 'join', 'slice'], function(name) { + var method = ArrayProto[name]; + wrapper.prototype[name] = function() { + return result(method.apply(this._wrapped, arguments), this._chain); + }; + }); + + // Start chaining a wrapped Underscore object. + wrapper.prototype.chain = function() { + this._chain = true; + return this; + }; + + // Extracts the result from a wrapped and chained object. + wrapper.prototype.value = function() { + return this._wrapped; + }; + +}).call(this); diff --git a/doc/html/_static/up-pressed.png b/doc/html/_static/up-pressed.png index 8bd587afee2fe38989383ff82010147ea56b93dd..99e7210962b0667e47408b40fdb5dd14749a156e 100644 Binary files a/doc/html/_static/up-pressed.png and b/doc/html/_static/up-pressed.png differ diff --git a/doc/html/_static/up.png b/doc/html/_static/up.png index b94625680b4a4b9647c3a6f3f283776930696aa9..26de002e85d3f5df53163e80b61af59bc4a6389b 100644 Binary files a/doc/html/_static/up.png and b/doc/html/_static/up.png differ diff --git a/doc/html/_static/websupport.js b/doc/html/_static/websupport.js index 71c0a1364aa3074b12315515f53be3694fd632c4..28d65db4aaf30db00ac3e591b88035ba434d4901 100644 --- a/doc/html/_static/websupport.js +++ b/doc/html/_static/websupport.js @@ -4,7 +4,7 @@ * * sphinx.websupport utilties for all documentation. * - * :copyright: Copyright 2007-2014 by the Sphinx team, see AUTHORS. + * :copyright: Copyright 2007-2015 by the Sphinx team, see AUTHORS. * :license: BSD, see LICENSE for details. * */ @@ -50,51 +50,51 @@ } function initEvents() { - $('a.comment-close').live("click", function(event) { + $(document).on("click", 'a.comment-close', function(event) { event.preventDefault(); hide($(this).attr('id').substring(2)); }); - $('a.vote').live("click", function(event) { + $(document).on("click", 'a.vote', function(event) { event.preventDefault(); handleVote($(this)); }); - $('a.reply').live("click", function(event) { + $(document).on("click", 'a.reply', function(event) { event.preventDefault(); openReply($(this).attr('id').substring(2)); }); - $('a.close-reply').live("click", function(event) { + $(document).on("click", 'a.close-reply', function(event) { event.preventDefault(); closeReply($(this).attr('id').substring(2)); }); - $('a.sort-option').live("click", function(event) { + $(document).on("click", 'a.sort-option', function(event) { event.preventDefault(); handleReSort($(this)); }); - $('a.show-proposal').live("click", function(event) { + $(document).on("click", 'a.show-proposal', function(event) { event.preventDefault(); showProposal($(this).attr('id').substring(2)); }); - $('a.hide-proposal').live("click", function(event) { + $(document).on("click", 'a.hide-proposal', function(event) { event.preventDefault(); hideProposal($(this).attr('id').substring(2)); }); - $('a.show-propose-change').live("click", function(event) { + $(document).on("click", 'a.show-propose-change', function(event) { event.preventDefault(); showProposeChange($(this).attr('id').substring(2)); }); - $('a.hide-propose-change').live("click", function(event) { + $(document).on("click", 'a.hide-propose-change', function(event) { event.preventDefault(); hideProposeChange($(this).attr('id').substring(2)); }); - $('a.accept-comment').live("click", function(event) { + $(document).on("click", 'a.accept-comment', function(event) { event.preventDefault(); acceptComment($(this).attr('id').substring(2)); }); - $('a.delete-comment').live("click", function(event) { + $(document).on("click", 'a.delete-comment', function(event) { event.preventDefault(); deleteComment($(this).attr('id').substring(2)); }); - $('a.comment-markup').live("click", function(event) { + $(document).on("click", 'a.comment-markup', function(event) { event.preventDefault(); toggleCommentMarkupBox($(this).attr('id').substring(2)); }); @@ -700,8 +700,8 @@ (<a href="#" class="comment-markup" id="ab<%id%>">markup</a>):</p>\ <div class="comment-markup-box" id="mb<%id%>">\ reStructured text markup: <i>*emph*</i>, <b>**strong**</b>, \ - <tt>``code``</tt>, \ - code blocks: <tt>::</tt> and an indented block after blank line</div>\ + <code>``code``</code>, \ + code blocks: <code>::</code> and an indented block after blank line</div>\ <form method="post" id="cf<%id%>" class="comment-form" action="">\ <textarea name="comment" cols="80"></textarea>\ <p class="propose-button">\ diff --git a/doc/html/actions/index_dev.html b/doc/html/actions/index_dev.html new file mode 100644 index 0000000000000000000000000000000000000000..fa4141b36ec709e7325354fdf1640c94d3a52c18 --- /dev/null +++ b/doc/html/actions/index_dev.html @@ -0,0 +1,441 @@ +<!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" + "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> + + +<html xmlns="http://www.w3.org/1999/xhtml"> + <head> + <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> + + <title>test_actions.ActionTestCase - Testing Actions — ProMod3 0 documentation</title> + + <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> + <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> + + <script type="text/javascript"> + var DOCUMENTATION_OPTIONS = { + URL_ROOT: '../', + VERSION: '0', + COLLAPSE_INDEX: false, + FILE_SUFFIX: '.html', + HAS_SOURCE: true + }; + </script> + <script type="text/javascript" src="../_static/jquery.js"></script> + <script type="text/javascript" src="../_static/underscore.js"></script> + <script type="text/javascript" src="../_static/doctools.js"></script> + <link rel="top" title="ProMod3 0 documentation" href="../index.html" /> + <link rel="up" title="Documentation For Developes" href="../developers.html" /> + <link rel="next" title="Building ProMod3" href="../buildsystem.html" /> + <link rel="prev" title="rawmodel - Coordinate Modeling" href="../rawmodel/index.html" /> + + + <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9"> + + </head> + <body role="document"> + <div class="related" role="navigation" aria-label="related navigation"> + <h3>Navigation</h3> + <ul> + <li class="right" style="margin-right: 10px"> + <a href="../genindex.html" title="General Index" + accesskey="I">index</a></li> + <li class="right" > + <a href="../py-modindex.html" title="Python Module Index" + >modules</a> |</li> + <li class="right" > + <a href="../buildsystem.html" title="Building ProMod3" + accesskey="N">next</a> |</li> + <li class="right" > + <a href="../rawmodel/index.html" title="rawmodel - Coordinate Modeling" + accesskey="P">previous</a> |</li> + <li class="nav-item nav-item-0"><a href="../index.html">ProMod3 0 documentation</a> »</li> + <li class="nav-item nav-item-1"><a href="../developers.html" accesskey="U">Documentation For Developes</a> »</li> + </ul> + </div> + + <div class="document"> + <div class="documentwrapper"> + <div class="bodywrapper"> + <div class="body" role="main"> + + <div class="section" id="module-test_actions"> +<span id="test-actions-actiontestcase-testing-actions"></span><h1><a class="reference internal" href="#test_actions.ActionTestCase" title="test_actions.ActionTestCase"><code class="xref py py-mod docutils literal"><span class="pre">test_actions.ActionTestCase</span></code></a> - Testing Actions<a class="headerlink" href="#module-test_actions" title="Permalink to this headline">¶</a></h1> +<p>This module is <strong>not</strong> part of the ProMod3 binary distribution. That is the +productive bit running to produce models. It is only part of the source +distribution intended to help developing ProMod3. Basically it supports you +creating new actions along immediate tests, which will be stored as unit tests +and stay available to monitor later changes.</p> +<div class="admonition note"> +<p class="first admonition-title">Note</p> +<p class="last">A couple of different paths will be mentioned in the following. To make +things easier to tell apart, a prefix <code class="file docutils literal"><span class="pre"><SOURCE></span></code> refers to the code +repository, <code class="file docutils literal"><span class="pre"><BUILD></span></code> to the build directory tree.</p> +</div> +<p>Inside the development environment, the module is only available to unit tests +in the <code class="file docutils literal"><span class="pre"><SOURCE>/actions/tests</span></code> directory. There is one special thing +about using it in your tests for an action, emerging from the way <code class="docutils literal"><span class="pre">make</span></code> runs +unit tests as set up via CMake. Python modules are imported from the source +directory, here this is <code class="file docutils literal"><span class="pre"><SOURCE>/actions/tests</span></code>, while the tests run +inside <code class="file docutils literal"><span class="pre"><BUILD>/tests</span></code>, here this is <code class="file docutils literal"><span class="pre"><BUILD>/tests/actions</span></code>. When +Python imports a module, its usually compiled into bytecode. This new file +would clutter up the source repository, it would always show up as untracked +file on <code class="docutils literal"><span class="pre">git</span> <span class="pre">status</span></code>. To prevent this, tell Python to stop producing +bytecode right at the beginning of your test-script:</p> +<div class="highlight-python"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>1 +2 +3 +4 +5</pre></div></td><td class="code"><div class="highlight"><pre><span class="kn">import</span> <span class="nn">sys</span> + +<span class="c"># this is needed so there will be no test_actions.pyc created in the source</span> +<span class="c"># directory</span> +<span class="hll"><span class="n">sys</span><span class="o">.</span><span class="n">dont_write_bytecode</span> <span class="o">=</span> <span class="bp">True</span> +</span></pre></div> +</td></tr></table></div> +<p>Line 5 does the trick. This needs to be set by you in every action unit test +file since Python only recognises it <strong>before</strong> the module is imported. +Otherwise a module could disable bytecoding for all other modules loaded.</p> +<p>Testing actions, basically those are commands run in a shell, is very similar +across various actions. Additionally, there are some things that should be +tested for all actions like exit codes. That is why this module exists.</p> +<p>When developing an action, you will try it in the shell during the process. You +have to check that its doing what you intend, that it delivers the right +output, that it just behaves right on various kinds of input. This module +supports you by providing functionality to run scripts out of Python. The +goal is to not trigger test runs manually in a shell but have a script that +does it for you. From there, you do not need to remember all the calls you +punched into the command line a year ago, when you come back to change +something, add new functionality, etc..</p> +<div class="section" id="creating-an-action-unit-test-script"> +<h2>Creating an Action Unit Test Script<a class="headerlink" href="#creating-an-action-unit-test-script" title="Permalink to this headline">¶</a></h2> +<p>In the next couple of paragraphs, we will walk through setting up a new unit +test script for an imaginary action. We will continuously extend the file +started above, so keep an eye on line numbers. Lets just assume your action is +called <code class="docutils literal"><span class="pre">do-awesome</span></code> for the rest of this section.</p> +<div class="section" id="the-test-script"> +<h3>The Test Script<a class="headerlink" href="#the-test-script" title="Permalink to this headline">¶</a></h3> +<p>The script to supervise your action needs to be placed in +<code class="file docutils literal"><span class="pre"><SOURCE>/actions/tests</span></code> and follow the naming convention +<code class="file docutils literal"><span class="pre">test_action_<NAME>.py</span></code>, where <code class="file docutils literal"><span class="pre"><NAME></span></code> is the name for your +action. So here we create a file <code class="file docutils literal"><span class="pre">test_action_do_awesome.py</span></code> (recognise +the underscore between <code class="docutils literal"><span class="pre">do</span></code> and <code class="docutils literal"><span class="pre">awesome</span></code> instead of a hyphen, that’s +<a class="reference external" href="https://www.python.org/dev/peps/pep-0008/">PEP 8</a>).</p> +<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> touch <SOURCE>/actions/tests/test_action_do_awesome.py +<span class="gp">$</span> +</pre></div> +</div> +<p>As a starter, we disable bytecode compilation in the script:</p> +<div class="highlight-python"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>1 +2 +3 +4 +5</pre></div></td><td class="code"><div class="highlight"><pre><span class="kn">import</span> <span class="nn">sys</span> + +<span class="c"># this is needed so there will be no test_actions.pyc created in the source</span> +<span class="c"># directory</span> +<span class="n">sys</span><span class="o">.</span><span class="n">dont_write_bytecode</span> <span class="o">=</span> <span class="bp">True</span> +</pre></div> +</td></tr></table></div> +</div> +<div class="section" id="cmake-integration"> +<h3>CMake Integration<a class="headerlink" href="#cmake-integration" title="Permalink to this headline">¶</a></h3> +<p>As always, when introducing new material to ProMod3, it has to be announced +to the CMake build system. For action unit tests, fire up +<code class="file docutils literal"><span class="pre"><SOURCE>/actions/tests/CMakeLists.txt</span></code> in your favourite text editor and +add your new script:</p> +<div class="highlight-cmake"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>1 +2 +3 +4 +5 +6 +7</pre></div></td><td class="code"><div class="highlight"><pre><span class="nb">set</span><span class="p">(</span><span class="s">ACTION_UNIT_TESTS</span> + <span class="s">test_action_help.py</span> +<span class="hll"> <span class="s">test_action_do_awesome.py</span> +</span> <span class="s">test_actions.py</span> <span class="c"># leave this as last item so it will be executed first!</span> +<span class="p">)</span> + +<span class="nb">promod3_unittest</span><span class="p">(</span><span class="s">MODULE</span> <span class="s">actions</span> <span class="s">SOURCES</span> <span class="s2">"${ACTION_UNIT_TESTS}"</span> <span class="s">TARGET</span> <span class="s">actions</span><span class="p">)</span> +</pre></div> +</td></tr></table></div> +<p>The important thing is to leave <code class="file docutils literal"><span class="pre">test_actions.py</span></code> as last item in the +list. This script contains the tests around the +<a class="reference internal" href="#test_actions.ActionTestCase" title="test_actions.ActionTestCase"><code class="xref py py-class docutils literal"><span class="pre">test_actions.ActionTestCase</span></code></a> class, which is the foundation of the +tests for your action. If this class is broken, we are lost. Putting it as the +last element in the list, CMake will execute this script first, before any +other action test script is run.</p> +</div> +<div class="section" id="creating-a-test-subclass"> +<h3>Creating a Test Subclass<a class="headerlink" href="#creating-a-test-subclass" title="Permalink to this headline">¶</a></h3> +<p><a class="reference internal" href="#test_actions.ActionTestCase" title="test_actions.ActionTestCase"><code class="xref py py-class docutils literal"><span class="pre">test_actions.ActionTestCase</span></code></a> is sort of a template class for your +tests. By spawning off from this you inherit a bunch of useful methods for your +testing. To make it work, the childclass needs to be set up properly. But +first, <code class="file docutils literal"><span class="pre">test_actions.py</span></code> has to be loaded as a module:</p> +<div class="highlight-python"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>6</pre></div></td><td class="code"><div class="highlight"><pre><span class="kn">import</span> <span class="nn">test_actions</span> +</pre></div> +</td></tr></table></div> +<p>Now create the childclass for your action. Go for <code class="xref py py-class docutils literal"><span class="pre"><NAME>ActionTests</span></code> as +a naming scheme:</p> +<div class="highlight-python"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre> 7 + 8 + 9 +10</pre></div></td><td class="code"><div class="highlight"><pre><span class="k">class</span> <span class="nc">DoAwesomeActionTests</span><span class="p">(</span><span class="n">test_actions</span><span class="o">.</span><span class="n">ActionTestCase</span><span class="p">):</span> + <span class="k">def</span> <span class="nf">__init__</span><span class="p">(</span><span class="bp">self</span><span class="p">,</span> <span class="o">*</span><span class="n">args</span><span class="p">,</span> <span class="o">**</span><span class="n">kwargs</span><span class="p">):</span> + <span class="n">test_actions</span><span class="o">.</span><span class="n">ActionTestCase</span><span class="o">.</span><span class="n">__init__</span><span class="p">(</span><span class="bp">self</span><span class="p">,</span> <span class="o">*</span><span class="n">args</span><span class="p">,</span> <span class="o">**</span><span class="n">kwargs</span><span class="p">)</span> + <span class="bp">self</span><span class="o">.</span><span class="n">pm_action</span> <span class="o">=</span> <span class="s">'do-awesome'</span> +</pre></div> +</td></tr></table></div> +<p>Pay attention that in your own class, you must set <code class="xref py py-attr docutils literal"><span class="pre">pm_action</span></code> to make +everything work. Also <code class="xref py py-meth docutils literal"><span class="pre">__init__()</span></code> needs certain parameters, as everything +is derived from the <a class="reference external" href="https://docs.python.org/2.7/library/unittest.html#unittest.TestCase" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">unittest.TestCase</span></code></a> class.</p> +</div> +<div class="section" id="must-have-tests"> +<h3>Must Have Tests<a class="headerlink" href="#must-have-tests" title="Permalink to this headline">¶</a></h3> +<p>What needs testing without exclusion are the exit codes of actions. Those +states will be placed in the userlevel documentation. This topic is already +covered in <a class="reference internal" href="#test_actions.ActionTestCase" title="test_actions.ActionTestCase"><code class="xref py py-class docutils literal"><span class="pre">test_actions.ActionTestCase</span></code></a> by <code class="xref py py-meth docutils literal"><span class="pre">RunExitStatusTest()</span></code>. +As an example, testing for <code class="docutils literal"><span class="pre">$?=0</span></code> could work like this:</p> +<div class="highlight-python"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>11 +12</pre></div></td><td class="code"><div class="highlight"><pre><span class="k">def</span> <span class="nf">testExit0</span><span class="p">(</span><span class="bp">self</span><span class="p">):</span> + <span class="bp">self</span><span class="o">.</span><span class="n">RunExitStatusTest</span><span class="p">(</span><span class="mi">0</span><span class="p">,</span> <span class="nb">list</span><span class="p">())</span> +</pre></div> +</td></tr></table></div> +<p>That will call the action stored in <code class="xref py py-attr docutils literal"><span class="pre">pm_action</span></code> with the provided list of +parameters and check that <code class="docutils literal"><span class="pre">0</span></code> is returned on the command line.</p> +<p>In a more general way, you need to test that your action is working as +intended. Do not forget some negative testing, with the idea in mind what +happens if a user throws dirty input data in.</p> +</div> +<div class="section" id="making-the-script-executable"> +<h3>Making the Script Executable<a class="headerlink" href="#making-the-script-executable" title="Permalink to this headline">¶</a></h3> +<p>In ProMod3, unit tests are run via <a class="reference external" href="http://www.OpenStructure.org">OST</a> and Python‘s +<a class="reference external" href="https://docs.python.org/2.7/library/unittest.html#unittest.TestCase" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">unittest.TestCase</span></code></a>. Those are called when the test module is executed +as a script:</p> +<div class="highlight-python"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>13 +14 +15</pre></div></td><td class="code"><div class="highlight"><pre><span class="k">if</span> <span class="n">__name__</span> <span class="o">==</span> <span class="s">"__main__"</span><span class="p">:</span> + <span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">testutils</span> + <span class="n">testutils</span><span class="o">.</span><span class="n">RunTests</span><span class="p">()</span> +</pre></div> +</td></tr></table></div> +<p>These three lines should be the same for all unit tests.</p> +</div> +<div class="section" id="running-the-test-script"> +<h3>Running the Test Script<a class="headerlink" href="#running-the-test-script" title="Permalink to this headline">¶</a></h3> +<p>Unit tests are executed via <code class="docutils literal"><span class="pre">make</span> <span class="pre">check</span></code> and so are ProMod3 action tests. +But for every test script, we also provide a private <code class="docutils literal"><span class="pre">make</span></code> target, ending +with <code class="file docutils literal"><span class="pre">_run</span></code>. To solely run the tests for the awesome action, hit</p> +<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> make test_action_do_awesome.py_run +</pre></div> +</div> +</div> +<div class="section" id="output-of-test-actions-actiontestcase"> +<h3>Output Of <a class="reference internal" href="#test_actions.ActionTestCase" title="test_actions.ActionTestCase"><code class="xref py py-class docutils literal"><span class="pre">test_actions.ActionTestCase</span></code></a><a class="headerlink" href="#output-of-test-actions-actiontestcase" title="Permalink to this headline">¶</a></h3> +<p>When running the test script you will notice that its not really talkative. +Basically you do not see output to <code class="file docutils literal"><span class="pre">stdout</span></code>/ <code class="file docutils literal"><span class="pre">stderr</span></code> of your +action, while the test script fires it a couple of times. That is by design. +When running the full unit test suite, usually nobody wants to see the output +of <strong>everything</strong> tested and working. The interesting bits are where we fail. +But for developing a new application you certainly need all the output you can +get. For this, some functions in <a class="reference internal" href="#test_actions.ActionTestCase" title="test_actions.ActionTestCase"><code class="xref py py-class docutils literal"><span class="pre">test_actions.ActionTestCase</span></code></a> have a +parameter <code class="xref py py-attr docutils literal"><span class="pre">verbose</span></code>. That triggers specific functions to flush captured +output onto the command line. The idea is to turn it on for development, but +once done, disable it to keep output of unit tests low.</p> +<p>To get the test for exit code <code class="docutils literal"><span class="pre">0</span></code> talking to you, just do</p> +<div class="highlight-python"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>11 +12</pre></div></td><td class="code"><div class="highlight"><pre><span class="k">def</span> <span class="nf">testExit0</span><span class="p">(</span><span class="bp">self</span><span class="p">):</span> + <span class="bp">self</span><span class="o">.</span><span class="n">RunExitStatusTest</span><span class="p">(</span><span class="mi">0</span><span class="p">,</span> <span class="nb">list</span><span class="p">(),</span> <span class="n">verbose</span><span class="o">=</span><span class="bp">True</span><span class="p">)</span> +</pre></div> +</td></tr></table></div> +<p>and</p> +<div class="highlight-python"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>11 +12</pre></div></td><td class="code"><div class="highlight"><pre><span class="k">def</span> <span class="nf">testExit0</span><span class="p">(</span><span class="bp">self</span><span class="p">):</span> + <span class="bp">self</span><span class="o">.</span><span class="n">RunExitStatusTest</span><span class="p">(</span><span class="mi">0</span><span class="p">,</span> <span class="nb">list</span><span class="p">())</span> +</pre></div> +</td></tr></table></div> +<p>keeps it silent (<code class="xref py py-attr docutils literal"><span class="pre">verbose</span></code> is set to <code class="docutils literal"><span class="pre">False</span></code> by default). If enabled, +output will be separated into <code class="file docutils literal"><span class="pre">stdout</span></code> and <code class="file docutils literal"><span class="pre">stderr</span></code>:</p> +<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> make test_action_do_awesome.py_run +<span class="go"><Lots of output from the build process></span> +<span class="go">[100%] running checks test_action_do_awesome.py</span> +<span class="go">stdout of '<BUILD>/stage/bin/pm do-awesome'</span> +<span class="go">------</span> +<span class="go"><Output to stdout></span> +<span class="go">------</span> +<span class="go">stderr of '<BUILD>/stage/bin/pm do-awesome'</span> +<span class="go">------</span> +<span class="go"><Output to stderr></span> +<span class="go">------</span> +</pre></div> +</div> +</div> +</div> +<div class="section" id="unit-test-actions-api"> +<h2>Unit Test Actions API<a class="headerlink" href="#unit-test-actions-api" title="Permalink to this headline">¶</a></h2> +<dl class="class"> +<dt id="test_actions.ActionTestCase"> +<em class="property">class </em><code class="descclassname">test_actions.</code><code class="descname">ActionTestCase</code><span class="sig-paren">(</span><em>*args</em>, <em>**kwargs</em><span class="sig-paren">)</span><a class="reference internal" href="../_modules/test_actions.html#ActionTestCase"><span class="viewcode-link">[source]</span></a><a class="headerlink" href="#test_actions.ActionTestCase" title="Permalink to this definition">¶</a></dt> +<dd><p>Class to help developing actions. Comes with a lot of convenience wrappers +around what should be tested and serves as a recorder for test calls... +just for in two years when you come back to rewrite the whole action...</p> +<p>While inheriting this class, <a class="reference internal" href="#test_actions.ActionTestCase.pm_action" title="test_actions.ActionTestCase.pm_action"><code class="xref py py-attr docutils literal"><span class="pre">pm_action</span></code></a> needs to be defined. +Otherwise the whole idea does not work.</p> +<dl class="attribute"> +<dt id="test_actions.ActionTestCase.pm_bin"> +<code class="descname">pm_bin</code><a class="headerlink" href="#test_actions.ActionTestCase.pm_bin" title="Permalink to this definition">¶</a></dt> +<dd></dd></dl> + +<p>This is the path of the <code class="docutils literal"><span class="pre">pm</span></code> binary. Automatically set by calling +<code class="xref py py-meth docutils literal"><span class="pre">__init__()</span></code> inside the initialisation of your class.</p> +<table class="docutils field-list" frame="void" rules="none"> +<col class="field-name" /> +<col class="field-body" /> +<tbody valign="top"> +<tr class="field-odd field"><th class="field-name">Type:</th><td class="field-body"><a class="reference external" href="https://docs.python.org/2.7/library/functions.html#str" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">str</span></code></a></td> +</tr> +</tbody> +</table> +<dl class="attribute"> +<dt id="test_actions.ActionTestCase.pm_action"> +<code class="descname">pm_action</code><a class="headerlink" href="#test_actions.ActionTestCase.pm_action" title="Permalink to this definition">¶</a></dt> +<dd></dd></dl> + +<p>The action to be tested. Needs to be set by your initialisation routine, +<strong>after</strong> calling <code class="xref py py-meth docutils literal"><span class="pre">__init__()</span></code> from here. Skip the +“pm-” in front of the action name.</p> +<table class="docutils field-list" frame="void" rules="none"> +<col class="field-name" /> +<col class="field-body" /> +<tbody valign="top"> +<tr class="field-odd field"><th class="field-name">Type:</th><td class="field-body"><a class="reference external" href="https://docs.python.org/2.7/library/functions.html#str" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">str</span></code></a></td> +</tr> +</tbody> +</table> +<dl class="method"> +<dt id="test_actions.ActionTestCase.RunAction"> +<code class="descname">RunAction</code><span class="sig-paren">(</span><em>arguments</em>, <em>verbose=False</em><span class="sig-paren">)</span><a class="reference internal" href="../_modules/test_actions.html#ActionTestCase.RunAction"><span class="viewcode-link">[source]</span></a><a class="headerlink" href="#test_actions.ActionTestCase.RunAction" title="Permalink to this definition">¶</a></dt> +<dd><p>Call an action, return the exit status (<code class="docutils literal"><span class="pre">$?</span></code> shell variable). May be +set to <code class="docutils literal"><span class="pre">verbose</span></code> to print the actions terminal output. The action to +be executed needs to be stored in <a class="reference internal" href="#test_actions.ActionTestCase.pm_action" title="test_actions.ActionTestCase.pm_action"><code class="xref py py-attr docutils literal"><span class="pre">pm_action</span></code></a> first.</p> +<p>If in verbose mode, output to <code class="file docutils literal"><span class="pre">stdout</span></code> of the action will be +printed first followed by <code class="file docutils literal"><span class="pre">stderr</span></code>.</p> +<table class="docutils field-list" frame="void" rules="none"> +<col class="field-name" /> +<col class="field-body" /> +<tbody valign="top"> +<tr class="field-odd field"><th class="field-name">Parameters:</th><td class="field-body"><ul class="first simple"> +<li><strong>arguments</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#list" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">list</span></code></a>) – A list of arguments for the call.</li> +<li><strong>verbose</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#bool" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">bool</span></code></a>) – If <code class="docutils literal"><span class="pre">True</span></code>, report output of the action.</li> +</ul> +</td> +</tr> +<tr class="field-even field"><th class="field-name">Returns:</th><td class="field-body"><p class="first last">The exit code of the action (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#int" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">int</span></code></a>).</p> +</td> +</tr> +</tbody> +</table> +</dd></dl> + +<dl class="method"> +<dt id="test_actions.ActionTestCase.RunExitStatusTest"> +<code class="descname">RunExitStatusTest</code><span class="sig-paren">(</span><em>exit_code</em>, <em>arguments</em>, <em>verbose=False</em><span class="sig-paren">)</span><a class="reference internal" href="../_modules/test_actions.html#ActionTestCase.RunExitStatusTest"><span class="viewcode-link">[source]</span></a><a class="headerlink" href="#test_actions.ActionTestCase.RunExitStatusTest" title="Permalink to this definition">¶</a></dt> +<dd><p>Run the action with given arguments and check the exit code.</p> +<table class="docutils field-list" frame="void" rules="none"> +<col class="field-name" /> +<col class="field-body" /> +<tbody valign="top"> +<tr class="field-odd field"><th class="field-name">Parameters:</th><td class="field-body"><ul class="first last simple"> +<li><strong>exit_code</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#int" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">int</span></code></a>) – The expected return code, <code class="docutils literal"><span class="pre">$?</span></code> in a shell.</li> +<li><strong>arguments</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#list" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">list</span></code></a>) – A list of arguments for the call.</li> +<li><strong>verbose</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#bool" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">bool</span></code></a>) – If <code class="docutils literal"><span class="pre">True</span></code>, report output of the action.</li> +</ul> +</td> +</tr> +</tbody> +</table> +</dd></dl> + +<dl class="method"> +<dt id="test_actions.ActionTestCase.testPMExists"> +<code class="descname">testPMExists</code><span class="sig-paren">(</span><span class="sig-paren">)</span><a class="reference internal" href="../_modules/test_actions.html#ActionTestCase.testPMExists"><span class="viewcode-link">[source]</span></a><a class="headerlink" href="#test_actions.ActionTestCase.testPMExists" title="Permalink to this definition">¶</a></dt> +<dd><p>This is an internal test, executed when the source code of the test +class is run as unit test. Verifies that <a class="reference internal" href="#test_actions.ActionTestCase.pm_bin" title="test_actions.ActionTestCase.pm_bin"><code class="xref py py-attr docutils literal"><span class="pre">pm_bin</span></code></a> is an existing +file (also complains if a directory is found instead).</p> +</dd></dl> + +</dd></dl> + +</div> +</div> + + + </div> + </div> + </div> + <div class="sphinxsidebar" role="navigation" aria-label="main navigation"> + <div class="sphinxsidebarwrapper"> + <h3><a href="../index.html">Table Of Contents</a></h3> + <ul> +<li><a class="reference internal" href="#"><code class="docutils literal"><span class="pre">test_actions.ActionTestCase</span></code> - Testing Actions</a><ul> +<li><a class="reference internal" href="#creating-an-action-unit-test-script">Creating an Action Unit Test Script</a><ul> +<li><a class="reference internal" href="#the-test-script">The Test Script</a></li> +<li><a class="reference internal" href="#cmake-integration">CMake Integration</a></li> +<li><a class="reference internal" href="#creating-a-test-subclass">Creating a Test Subclass</a></li> +<li><a class="reference internal" href="#must-have-tests">Must Have Tests</a></li> +<li><a class="reference internal" href="#making-the-script-executable">Making the Script Executable</a></li> +<li><a class="reference internal" href="#running-the-test-script">Running the Test Script</a></li> +<li><a class="reference internal" href="#output-of-test-actions-actiontestcase">Output Of <code class="docutils literal"><span class="pre">test_actions.ActionTestCase</span></code></a></li> +</ul> +</li> +<li><a class="reference internal" href="#unit-test-actions-api">Unit Test Actions API</a></li> +</ul> +</li> +</ul> + + <h4>Previous topic</h4> + <p class="topless"><a href="../rawmodel/index.html" + title="previous chapter"><code class="docutils literal"><span class="pre">rawmodel</span></code> - Coordinate Modeling</a></p> + <h4>Next topic</h4> + <p class="topless"><a href="../buildsystem.html" + title="next chapter">Building ProMod3</a></p> + <div role="note" aria-label="source link"> + <h3>This Page</h3> + <ul class="this-page-menu"> + <li><a href="../_sources/actions/index_dev.txt" + rel="nofollow">Show Source</a></li> + </ul> + </div> +<div id="searchbox" style="display: none" role="search"> + <h3>Quick search</h3> + <form class="search" action="../search.html" method="get"> + <input type="text" name="q" /> + <input type="submit" value="Go" /> + <input type="hidden" name="check_keywords" value="yes" /> + <input type="hidden" name="area" value="default" /> + </form> + <p class="searchtip" style="font-size: 90%"> + Enter search terms or a module, class or function name. + </p> +</div> +<script type="text/javascript">$('#searchbox').show(0);</script> + </div> + </div> + <div class="clearer"></div> + </div> + <div class="footer"> + ©2015, Bienchen. + + | + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.3</a> + + | + <a href="../_sources/actions/index_dev.txt" + rel="nofollow">Page source</a></li> + </div> + + + + + </body> +</html> \ No newline at end of file diff --git a/doc/html/buildsystem.html b/doc/html/buildsystem.html index 90d190486eb2d74a02c5410192ac9a45908329fc..70e884ee3cd840816327c64674e7d1dcfa21c997 100644 --- a/doc/html/buildsystem.html +++ b/doc/html/buildsystem.html @@ -8,7 +8,7 @@ <title>Building ProMod3 — ProMod3 0 documentation</title> - <link rel="stylesheet" href="_static/default.css" type="text/css" /> + <link rel="stylesheet" href="_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="_static/pygments.css" type="text/css" /> <script type="text/javascript"> @@ -26,10 +26,14 @@ <link rel="top" title="ProMod3 0 documentation" href="index.html" /> <link rel="up" title="Documentation For Developes" href="developers.html" /> <link rel="next" title="Contributing" href="contributing.html" /> - <link rel="prev" title="rawmodel - Coordinate Modeling" href="rawmodel/index.html" /> + <link rel="prev" title="test_actions.ActionTestCase - Testing Actions" href="actions/index_dev.html" /> + + + <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9"> + </head> - <body> - <div class="related"> + <body role="document"> + <div class="related" role="navigation" aria-label="related navigation"> <h3>Navigation</h3> <ul> <li class="right" style="margin-right: 10px"> @@ -42,17 +46,17 @@ <a href="contributing.html" title="Contributing" accesskey="N">next</a> |</li> <li class="right" > - <a href="rawmodel/index.html" title="rawmodel - Coordinate Modeling" + <a href="actions/index_dev.html" title="test_actions.ActionTestCase - Testing Actions" accesskey="P">previous</a> |</li> - <li><a href="index.html">ProMod3 0 documentation</a> »</li> - <li><a href="developers.html" accesskey="U">Documentation For Developes</a> »</li> + <li class="nav-item nav-item-0"><a href="index.html">ProMod3 0 documentation</a> »</li> + <li class="nav-item nav-item-1"><a href="developers.html" accesskey="U">Documentation For Developes</a> »</li> </ul> </div> <div class="document"> <div class="documentwrapper"> <div class="bodywrapper"> - <div class="body"> + <div class="body" role="main"> <div class="section" id="building-project"> <h1>Building ProMod3<a class="headerlink" href="#building-project" title="Permalink to this headline">¶</a></h1> @@ -80,39 +84,39 @@ documentation, <a class="reference external" href="http://sphinx-doc.org/">Sphin <p>CMake is used to configure the build system and in the end produces makefiles and certain directories needed for building ProMod3. Basically it is called right from a shell with the directory containing the top-level -<tt class="file docutils literal"><span class="pre">CMakeLists.txt</span></tt> as an argument:</p> +<code class="file docutils literal"><span class="pre">CMakeLists.txt</span></code> as an argument:</p> <div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> cmake . -DOST_ROOT<span class="o">=</span><PATH TO OST> -DQMEAN_ROOT<span class="o">=</span><PATH TO QMEAN> </pre></div> </div> <p>For us, at least pointers to the OST and QMEAN installation directories -are needed, handed over to CMake by <tt class="docutils literal"><span class="pre">-D</span></tt> into the variables <tt class="docutils literal"><span class="pre">OST_ROOT</span></tt> -and <tt class="docutils literal"><span class="pre">QMEAN_ROOT</span></tt>. Other important variables would be <tt class="docutils literal"><span class="pre">BOOST_ROOT</span></tt>, set to -the same path as for OST and probably <tt class="docutils literal"><span class="pre">PYTHON_ROOT</span></tt> if you want to use a +are needed, handed over to CMake by <code class="docutils literal"><span class="pre">-D</span></code> into the variables <code class="docutils literal"><span class="pre">OST_ROOT</span></code> +and <code class="docutils literal"><span class="pre">QMEAN_ROOT</span></code>. Other important variables would be <code class="docutils literal"><span class="pre">BOOST_ROOT</span></code>, set to +the same path as for OST and probably <code class="docutils literal"><span class="pre">PYTHON_ROOT</span></code> if you want to use a certain Python. Also Eigen 3 can be pulled in like this, e.g. if you have to download it by yourself because its not installed on your system. Just point -<tt class="docutils literal"><span class="pre">EIGEN3_INCLUDE_DIR</span></tt> to the path which provides the <tt class="file docutils literal"><span class="pre">Eigen</span></tt> header -directory. Don’t forget to put a <tt class="docutils literal"><span class="pre">-D</span></tt> in front of options.</p> +<code class="docutils literal"><span class="pre">EIGEN3_INCLUDE_DIR</span></code> to the path which provides the <code class="file docutils literal"><span class="pre">Eigen</span></code> header +directory. Don’t forget to put a <code class="docutils literal"><span class="pre">-D</span></code> in front of options.</p> <p>Here is a list of more options used within ProMod3:</p> <ul class="simple"> -<li><tt class="docutils literal"><span class="pre">DISABLE_DOCUMENTATION</span></tt> Don’t build documentation, don’t search for Sphinx</li> -<li><tt class="docutils literal"><span class="pre">DISABLE_DOCTEST</span></tt> Don’t run example code from documentation on -<tt class="docutils literal"><span class="pre">make</span> <span class="pre">check</span></tt> (implicit by <tt class="docutils literal"><span class="pre">DISABLE_DOCUMENTATION</span></tt>)</li> -<li><tt class="docutils literal"><span class="pre">DISABLE_LINKCHECK</span></tt> Don’t test links from documentation on <tt class="docutils literal"><span class="pre">make</span> <span class="pre">check</span></tt> -(implicit by <tt class="docutils literal"><span class="pre">DISABLE_DOCUMENTATION</span></tt>)</li> +<li><code class="docutils literal"><span class="pre">DISABLE_DOCUMENTATION</span></code> Don’t build documentation, don’t search for Sphinx</li> +<li><code class="docutils literal"><span class="pre">DISABLE_DOCTEST</span></code> Don’t run example code from documentation on +<code class="docutils literal"><span class="pre">make</span> <span class="pre">check</span></code> (implicit by <code class="docutils literal"><span class="pre">DISABLE_DOCUMENTATION</span></code>)</li> +<li><code class="docutils literal"><span class="pre">DISABLE_LINKCHECK</span></code> Don’t test links from documentation on <code class="docutils literal"><span class="pre">make</span> <span class="pre">check</span></code> +(implicit by <code class="docutils literal"><span class="pre">DISABLE_DOCUMENTATION</span></code>)</li> </ul> <p>Since we use OST in the background, some of its options for CMake are also relevant, here. Basically they need to be set to exactly the same value. Even if ProMod3 builds with different settings, it may start producing funny results at an unexpected point. If you do not know the values, grep the option -in the <tt class="file docutils literal"><span class="pre">CMakeCache.txt</span></tt> of OST:</p> +in the <code class="file docutils literal"><span class="pre">CMakeCache.txt</span></code> of OST:</p> <ul class="simple"> -<li><tt class="docutils literal"><span class="pre">OPTIMIZE</span></tt></li> -<li><tt class="docutils literal"><span class="pre">OST_DOUBLE_PRECISION</span></tt></li> +<li><code class="docutils literal"><span class="pre">OPTIMIZE</span></code></li> +<li><code class="docutils literal"><span class="pre">OST_DOUBLE_PRECISION</span></code></li> </ul> -<p>Instead of calling CMake by yourself, there is the <tt class="file docutils literal"><span class="pre">conf-scripts</span></tt> +<p>Instead of calling CMake by yourself, there is the <code class="file docutils literal"><span class="pre">conf-scripts</span></code> directory, providing smallish scripts to invoke CMake the right way for various systems. Usually those scripts just need the OST and QMEAN paths -and the location of the top-level <tt class="file docutils literal"><span class="pre">CMakeLists.txt</span></tt>.</p> +and the location of the top-level <code class="file docutils literal"><span class="pre">CMakeLists.txt</span></code>.</p> <p>What we highly recommend is going for out-of-source builds. This means creating a dedicated directory for building ProMod3 and calling CMake or a configuration script from there. This way, you can have several builds with @@ -125,21 +129,21 @@ checking if certain files really got rebuild and similar things required.</p> <div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> make </pre></div> </div> -<p>to populate the <tt class="file docutils literal"><span class="pre">stage</span></tt> directory with a ready-to-go version of the +<p>to populate the <code class="file docutils literal"><span class="pre">stage</span></code> directory with a ready-to-go version of the latest code.</p> -<p id="index-0">Beside the usual <tt class="docutils literal"><span class="pre">make</span> <span class="pre">all</span></tt> and other default targets, there are a few +<p id="index-0">Beside the usual <code class="docutils literal"><span class="pre">make</span> <span class="pre">all</span></code> and other default targets, there are a few special targets:</p> <ul class="simple"> -<li><tt class="docutils literal"><span class="pre">check</span></tt> <span class="target" id="index-1"></span>make check Runs unit tests and if CMake was invoked in -its standard configuration also Sphinx with the <tt class="docutils literal"><span class="pre">doctest</span></tt> and -<tt class="docutils literal"><span class="pre">linkcheck</span></tt> builders</li> -<li><tt class="docutils literal"><span class="pre">html</span></tt> <span class="target" id="index-2"></span>make html Creates documentation as web page using the -Sphinx <tt class="docutils literal"><span class="pre">html</span></tt> builder</li> -<li><tt class="docutils literal"><span class="pre">man</span></tt> <span class="target" id="index-3"></span>make man Creates a manual page using the Sphinx <tt class="docutils literal"><span class="pre">man</span></tt> +<li><code class="docutils literal"><span class="pre">check</span></code> <span class="target" id="index-1"></span>make check Runs unit tests and if CMake was invoked in +its standard configuration also Sphinx with the <code class="docutils literal"><span class="pre">doctest</span></code> and +<code class="docutils literal"><span class="pre">linkcheck</span></code> builders</li> +<li><code class="docutils literal"><span class="pre">html</span></code> <span class="target" id="index-2"></span>make html Creates documentation as web page using the +Sphinx <code class="docutils literal"><span class="pre">html</span></code> builder</li> +<li><code class="docutils literal"><span class="pre">man</span></code> <span class="target" id="index-3"></span>make man Creates a manual page using the Sphinx <code class="docutils literal"><span class="pre">man</span></code> builder</li> -<li><tt class="docutils literal"><span class="pre">doc</span></tt> <span class="target" id="index-4"></span>make doc Creates documentation using the <tt class="docutils literal"><span class="pre">html</span></tt> and -<tt class="docutils literal"><span class="pre">man</span></tt> targets</li> -<li><tt class="docutils literal"><span class="pre">help</span></tt> <span class="target" id="index-5"></span>make help Prints a list of targets available</li> +<li><code class="docutils literal"><span class="pre">doc</span></code> <span class="target" id="index-4"></span>make doc Creates documentation using the <code class="docutils literal"><span class="pre">html</span></code> and +<code class="docutils literal"><span class="pre">man</span></code> targets</li> +<li><code class="docutils literal"><span class="pre">help</span></code> <span class="target" id="index-5"></span>make help Prints a list of targets available</li> </ul> </div> </div> @@ -149,7 +153,7 @@ builder</li> </div> </div> </div> - <div class="sphinxsidebar"> + <div class="sphinxsidebar" role="navigation" aria-label="main navigation"> <div class="sphinxsidebarwrapper"> <h3><a href="index.html">Table Of Contents</a></h3> <ul> @@ -164,17 +168,19 @@ builder</li> </ul> <h4>Previous topic</h4> - <p class="topless"><a href="rawmodel/index.html" - title="previous chapter"><tt class="docutils literal"><span class="pre">rawmodel</span></tt> - Coordinate Modeling</a></p> + <p class="topless"><a href="actions/index_dev.html" + title="previous chapter"><code class="docutils literal"><span class="pre">test_actions.ActionTestCase</span></code> - Testing Actions</a></p> <h4>Next topic</h4> <p class="topless"><a href="contributing.html" title="next chapter">Contributing</a></p> - <h3>This Page</h3> - <ul class="this-page-menu"> - <li><a href="_sources/buildsystem.txt" - rel="nofollow">Show Source</a></li> - </ul> -<div id="searchbox" style="display: none"> + <div role="note" aria-label="source link"> + <h3>This Page</h3> + <ul class="this-page-menu"> + <li><a href="_sources/buildsystem.txt" + rel="nofollow">Show Source</a></li> + </ul> + </div> +<div id="searchbox" style="display: none" role="search"> <h3>Quick search</h3> <form class="search" action="search.html" method="get"> <input type="text" name="q" /> @@ -191,29 +197,20 @@ builder</li> </div> <div class="clearer"></div> </div> - <div class="related"> - <h3>Navigation</h3> - <ul> - <li class="right" style="margin-right: 10px"> - <a href="genindex.html" title="General Index" - >index</a></li> - <li class="right" > - <a href="py-modindex.html" title="Python Module Index" - >modules</a> |</li> - <li class="right" > - <a href="contributing.html" title="Contributing" - >next</a> |</li> - <li class="right" > - <a href="rawmodel/index.html" title="rawmodel - Coordinate Modeling" - >previous</a> |</li> - <li><a href="index.html">ProMod3 0 documentation</a> »</li> - <li><a href="developers.html" >Documentation For Developes</a> »</li> - </ul> - </div> <div class="footer"> - © Copyright 2014, Bienchen. - Last updated on Mar 23 14:52, 2015. - Created using <a href="http://sphinx-doc.org/">Sphinx</a> 1.2.3. + ©2015, Bienchen. + + | + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.3</a> + + | + <a href="_sources/buildsystem.txt" + rel="nofollow">Page source</a></li> </div> + + + + </body> </html> \ No newline at end of file diff --git a/doc/html/changelog.html b/doc/html/changelog.html index b7014472f4f882c6345c149bcad910d90caf9465..8611701ec36c4833374e9d30e056ad31f3887971 100644 --- a/doc/html/changelog.html +++ b/doc/html/changelog.html @@ -8,7 +8,7 @@ <title>Changelog — ProMod3 0 documentation</title> - <link rel="stylesheet" href="_static/default.css" type="text/css" /> + <link rel="stylesheet" href="_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="_static/pygments.css" type="text/css" /> <script type="text/javascript"> @@ -24,10 +24,14 @@ <script type="text/javascript" src="_static/underscore.js"></script> <script type="text/javascript" src="_static/doctools.js"></script> <link rel="top" title="ProMod3 0 documentation" href="index.html" /> - <link rel="prev" title="ProMod3‘s Share Of CMake" href="cmake/index.html" /> + <link rel="prev" title="ProMod3‘s Share Of CMake" href="cmake/index.html" /> + + + <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9"> + </head> - <body> - <div class="related"> + <body role="document"> + <div class="related" role="navigation" aria-label="related navigation"> <h3>Navigation</h3> <ul> <li class="right" style="margin-right: 10px"> @@ -39,14 +43,14 @@ <li class="right" > <a href="cmake/index.html" title="ProMod3‘s Share Of CMake" accesskey="P">previous</a> |</li> - <li><a href="index.html">ProMod3 0 documentation</a> »</li> + <li class="nav-item nav-item-0"><a href="index.html">ProMod3 0 documentation</a> »</li> </ul> </div> <div class="document"> <div class="documentwrapper"> <div class="bodywrapper"> - <div class="body"> + <div class="body" role="main"> <div class="section" id="changelog"> <h1>Changelog<a class="headerlink" href="#changelog" title="Permalink to this headline">¶</a></h1> @@ -69,19 +73,28 @@ </ul> </div></blockquote> </div> +<div class="section" id="changes-in-release-0-3-to-be-released"> +<h2>Changes in Release 0.3 (to be released)<a class="headerlink" href="#changes-in-release-0-3-to-be-released" title="Permalink to this headline">¶</a></h2> +<blockquote> +<div><ul class="simple"> +<li>merged argcheck into the helper module</li> +</ul> +</div></blockquote> +</div> </div> </div> </div> </div> - <div class="sphinxsidebar"> + <div class="sphinxsidebar" role="navigation" aria-label="main navigation"> <div class="sphinxsidebarwrapper"> <h3><a href="index.html">Table Of Contents</a></h3> <ul> <li><a class="reference internal" href="#">Changelog</a><ul> <li><a class="reference internal" href="#changes-in-release-0-1">Changes in Release 0.1</a></li> <li><a class="reference internal" href="#changes-in-release-0-2">Changes in Release 0.2</a></li> +<li><a class="reference internal" href="#changes-in-release-0-3-to-be-released">Changes in Release 0.3 (to be released)</a></li> </ul> </li> </ul> @@ -89,12 +102,14 @@ <h4>Previous topic</h4> <p class="topless"><a href="cmake/index.html" title="previous chapter">ProMod3‘s Share Of CMake</a></p> - <h3>This Page</h3> - <ul class="this-page-menu"> - <li><a href="_sources/changelog.txt" - rel="nofollow">Show Source</a></li> - </ul> -<div id="searchbox" style="display: none"> + <div role="note" aria-label="source link"> + <h3>This Page</h3> + <ul class="this-page-menu"> + <li><a href="_sources/changelog.txt" + rel="nofollow">Show Source</a></li> + </ul> + </div> +<div id="searchbox" style="display: none" role="search"> <h3>Quick search</h3> <form class="search" action="search.html" method="get"> <input type="text" name="q" /> @@ -111,25 +126,20 @@ </div> <div class="clearer"></div> </div> - <div class="related"> - <h3>Navigation</h3> - <ul> - <li class="right" style="margin-right: 10px"> - <a href="genindex.html" title="General Index" - >index</a></li> - <li class="right" > - <a href="py-modindex.html" title="Python Module Index" - >modules</a> |</li> - <li class="right" > - <a href="cmake/index.html" title="ProMod3‘s Share Of CMake" - >previous</a> |</li> - <li><a href="index.html">ProMod3 0 documentation</a> »</li> - </ul> - </div> <div class="footer"> - © Copyright 2014, Bienchen. - Last updated on Mar 23 14:52, 2015. - Created using <a href="http://sphinx-doc.org/">Sphinx</a> 1.2.3. + ©2015, Bienchen. + + | + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.3</a> + + | + <a href="_sources/changelog.txt" + rel="nofollow">Page source</a></li> </div> + + + + </body> </html> \ No newline at end of file diff --git a/doc/html/cmake/index.html b/doc/html/cmake/index.html index 15828bd43a347721344134eaba8c7d822f32d776..e599bea80f88eebb4bf9d05ab5ff1f5483ce08e6 100644 --- a/doc/html/cmake/index.html +++ b/doc/html/cmake/index.html @@ -8,7 +8,7 @@ <title>ProMod3‘s Share Of CMake — ProMod3 0 documentation</title> - <link rel="stylesheet" href="../_static/default.css" type="text/css" /> + <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> <script type="text/javascript"> @@ -26,10 +26,14 @@ <link rel="top" title="ProMod3 0 documentation" href="../index.html" /> <link rel="up" title="Documentation For Developes" href="../developers.html" /> <link rel="next" title="Changelog" href="../changelog.html" /> - <link rel="prev" title="Contributing" href="../contributing.html" /> + <link rel="prev" title="Contributing" href="../contributing.html" /> + + + <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9"> + </head> - <body> - <div class="related"> + <body role="document"> + <div class="related" role="navigation" aria-label="related navigation"> <h3>Navigation</h3> <ul> <li class="right" style="margin-right: 10px"> @@ -44,37 +48,37 @@ <li class="right" > <a href="../contributing.html" title="Contributing" accesskey="P">previous</a> |</li> - <li><a href="../index.html">ProMod3 0 documentation</a> »</li> - <li><a href="../developers.html" accesskey="U">Documentation For Developes</a> »</li> + <li class="nav-item nav-item-0"><a href="../index.html">ProMod3 0 documentation</a> »</li> + <li class="nav-item nav-item-1"><a href="../developers.html" accesskey="U">Documentation For Developes</a> »</li> </ul> </div> <div class="document"> <div class="documentwrapper"> <div class="bodywrapper"> - <div class="body"> + <div class="body" role="main"> <div class="section" id="project-s-share-of-cmake"> <span id="pm3-cmake-doc"></span><h1>ProMod3‘s Share Of CMake<a class="headerlink" href="#project-s-share-of-cmake" title="Permalink to this headline">¶</a></h1> <div class="section" id="introduction"> <h2>Introduction<a class="headerlink" href="#introduction" title="Permalink to this headline">¶</a></h2> <p>This section describes the set of ProMod3‘s own set of CMake functions (or -macros) fed from the <tt class="file docutils literal"><span class="pre">cmake_support</span></tt> directory. Those could be easily put +macros) fed from the <code class="file docutils literal"><span class="pre">cmake_support</span></code> directory. Those could be easily put into three categories of varying relevance for you:</p> <ol class="arabic simple"> <li>Functions used to integrate your contribution into ProMod3. Its all about adding files to the documentation, declaring unit tests and code management. -Almost all of them have their home in the file <tt class="file docutils literal"><span class="pre">PROMOD3.cmake</span></tt>.</li> +Almost all of them have their home in the file <code class="file docutils literal"><span class="pre">PROMOD3.cmake</span></code>.</li> <li>Then there is a set of functions needed to set up CMake itself. Those are little helpers to find tools, external packages and such. These are found in -<tt class="file docutils literal"><span class="pre">Find<DEPENDENCY>.cmake</span></tt> files.</li> +<code class="file docutils literal"><span class="pre">Find<DEPENDENCY>.cmake</span></code> files.</li> <li>The last and probably least relevant category for you is also to be found in -<tt class="file docutils literal"><span class="pre">PROMOD3.cmake</span></tt>. There is a set of functions used to define more +<code class="file docutils literal"><span class="pre">PROMOD3.cmake</span></code>. There is a set of functions used to define more CMake functionality. You only need to consider those if you dare to extend this set up.</li> </ol> <p>Best practices for using our home-brew CMake functions are found in the -various <tt class="file docutils literal"><span class="pre">CMakeLists.txt</span></tt> files in the project’s directory tree.</p> +various <code class="file docutils literal"><span class="pre">CMakeLists.txt</span></code> files in the project’s directory tree.</p> </div> <div class="section" id="functions-for-module-action-maintenance"> <h2>Functions For Module/ Action Maintenance<a class="headerlink" href="#functions-for-module-action-maintenance" title="Permalink to this headline">¶</a></h2> @@ -82,48 +86,101 @@ various <tt class="file docutils literal"><span class="pre">CMakeLists.txt</span <h3>Unit Tests<a class="headerlink" href="#unit-tests" title="Permalink to this headline">¶</a></h3> <dl class="command"> <dt id="command:promod3_unittest"> -<tt class="descname">promod3_unittest</tt><a class="headerlink" href="#command:promod3_unittest" title="Permalink to this definition">¶</a></dt> -<dd><div class="highlight-cmake"><div class="highlight"><pre>promod3_unittest(MODULE name - SOURCES source1 [source2 ...] - [LINK library1/ linker flag1 [library2/ linker flag2 ...]] - [DATA data1 [data2 ...]] - [TARGET target]) +<code class="descname">promod3_unittest</code><a class="headerlink" href="#command:promod3_unittest" title="Permalink to this definition">¶</a></dt> +<dd><div class="highlight-cmake"><div class="highlight"><pre><span class="nb">promod3_unittest</span><span class="p">(</span><span class="s">MODULE</span> <span class="s">name</span> + <span class="s">SOURCES</span> <span class="s">source1</span> <span class="s">[source2</span> <span class="s">...]</span> + <span class="s">[LINK</span> <span class="s">library1/</span> <span class="s">linker</span> <span class="s">flag1</span> <span class="s">[library2/</span> <span class="s">linker</span> <span class="s">flag2</span> <span class="s">...]]</span> + <span class="s">[DATA</span> <span class="s">data1</span> <span class="s">[data2</span> <span class="s">...]]</span> + <span class="s">[TARGET</span> <span class="s">target]</span><span class="p">)</span> </pre></div> </div> <p>Add unit tests to ProMod3. Unit tests should go in module-wise so all source files containing test code go by a single call of -<span class="target" id="index-0-command:promod3_unittest"></span><a class="reference internal" href="#command:promod3_unittest" title="promod3_unittest"><tt class="xref cmake cmake-command docutils literal"><span class="pre">promod3_unittest()</span></tt></a>. Test data also needs to be registered +<span class="target" id="index-0-command:promod3_unittest"></span><a class="reference internal" href="#command:promod3_unittest" title="promod3_unittest"><code class="xref cmake cmake-command docutils literal"><span class="pre">promod3_unittest()</span></code></a>. Test data also needs to be registered here, since it will be copied to the build directory. That way, inside your code you do not need to set a special path to your data. Additionally, since it is out of the source tree, you may change test data as you like, without -the Git repository noticing. Calling <span class="target" id="index-1-command:promod3_unittest"></span><a class="reference internal" href="#command:promod3_unittest" title="promod3_unittest"><tt class="xref cmake cmake-command docutils literal"><span class="pre">promod3_unittest()</span></tt></a> will -create a set of certain <tt class="docutils literal"><span class="pre">make</span></tt> targets for you, beside feeding <tt class="docutils literal"><span class="pre">codetest</span></tt>.</p> +the Git repository noticing. Calling <span class="target" id="index-1-command:promod3_unittest"></span><a class="reference internal" href="#command:promod3_unittest" title="promod3_unittest"><code class="xref cmake cmake-command docutils literal"><span class="pre">promod3_unittest()</span></code></a> will +create a set of certain <code class="docutils literal"><span class="pre">make</span></code> targets for you, beside feeding <code class="docutils literal"><span class="pre">codetest</span></code>.</p> <p>The parameters are:</p> <dl class="docutils"> -<dt><tt class="docutils literal"><span class="pre">MODULE</span></tt></dt> +<dt><code class="docutils literal"><span class="pre">MODULE</span></code></dt> <dd>Specify the name of the module these tests are made for. Needs to be set, -needs to be a single word. Ends up in <tt class="docutils literal"><span class="pre">make</span> <span class="pre">help</span></tt> as a prefix, nothing +needs to be a single word. Ends up in <code class="docutils literal"><span class="pre">make</span> <span class="pre">help</span></code> as a prefix, nothing will break if it does not match the name of any existing module.</dd> -<dt><tt class="docutils literal"><span class="pre">Sources</span></tt></dt> +<dt><code class="docutils literal"><span class="pre">SOURCES</span></code></dt> <dd>Describe a set of files hosting unit test code here. If its a wild mix of C++ and Python files does not matter, CMake will sort this out for -you. But the programming language makes a difference for the <tt class="docutils literal"><span class="pre">make</span></tt> +you. But the programming language makes a difference for the <code class="docutils literal"><span class="pre">make</span></code> targets produced. C++ files will all be gathered in a single -<tt class="docutils literal"><span class="pre">test_suite_<MODULE>_run</span></tt> target (there is also a <tt class="docutils literal"><span class="pre">_xml</span></tt> target but +<code class="docutils literal"><span class="pre">test_suite_<MODULE>_run</span></code> target (there is also a <code class="docutils literal"><span class="pre">_xml</span></code> target but this is for tools for automated testing). Python code works on a ‘one -target per file’ basis. So <tt class="file docutils literal"><span class="pre">test_foo.py</span></tt> will have own target -<tt class="docutils literal"><span class="pre">test_foo.py_run</span></tt>.</dd> -<dt><tt class="docutils literal"><span class="pre">LINK</span></tt></dt> +target per file’ basis. So <code class="file docutils literal"><span class="pre">test_foo.py</span></code> will have own target +<code class="docutils literal"><span class="pre">test_foo.py_run</span></code>.</dd> +<dt><code class="docutils literal"><span class="pre">LINK</span></code></dt> <dd>Add additional libraries and linker flags for C++ source files. Has no effect on Python tests.</dd> -<dt><tt class="docutils literal"><span class="pre">DATA</span></tt></dt> +<dt><code class="docutils literal"><span class="pre">DATA</span></code></dt> <dd>Define test data. Instead of giving data directories its own -<tt class="file docutils literal"><span class="pre">CMakeLists.txt</span></tt>, those files are added here. Usually located -somewhere in a dedicated <tt class="file docutils literal"><span class="pre">data</span></tt> subtree, files need to be given with +<code class="file docutils literal"><span class="pre">CMakeLists.txt</span></code>, those files are added here. Usually located +somewhere in a dedicated <code class="file docutils literal"><span class="pre">data</span></code> subtree, files need to be given with a path relative to this directory. That path will then be created in the build directory.</dd> -<dt><tt class="docutils literal"><span class="pre">TARGET</span></tt></dt> -<dd>This defines an additional dependency for the unit test.</dd> +<dt><code class="docutils literal"><span class="pre">TARGET</span></code></dt> +<dd>This defines an additional dependency for the unit test. That is, before +running this unit test, this target will be built.</dd> +</dl> +</dd></dl> + +</div> +<div class="section" id="documentation"> +<h3>Documentation<a class="headerlink" href="#documentation" title="Permalink to this headline">¶</a></h3> +<dl class="command"> +<dt id="command:add_doc_source"> +<code class="descname">add_doc_source</code><a class="headerlink" href="#command:add_doc_source" title="Permalink to this definition">¶</a></dt> +<dd><div class="highlight-cmake"><div class="highlight"><pre><span class="nb">add_doc_source</span><span class="p">(</span><span class="s">NAME</span> <span class="s">name</span> + <span class="s">RST</span> <span class="s">rst1</span> <span class="s">[rst2...]</span><span class="p">)</span> +</pre></div> +</div> +<p>Add reStructuredText sources for the doc build system. This is most preferable +used in <code class="file docutils literal"><span class="pre">doc</span></code> directories for keeping the documentation sorted per +module. This does not create any <code class="docutils literal"><span class="pre">make</span></code> targets. Lists filled here will all +be evaluated in the <code class="file docutils literal"><span class="pre">doc/CMakeLists.txt</span></code> of the repository root.</p> +<p>The parameters are:</p> +<dl class="docutils"> +<dt><code class="docutils literal"><span class="pre">NAME</span></code></dt> +<dd>Specify the name of the module this branch of documentation belongs to. +Needs to be set, needs to be a single word. Using module names is best +practice, while nothing will break if it does not refer to an existing one. +You will find a directory in <code class="file docutils literal"><span class="pre">doc/source</span></code> with that name in the build +root.</dd> +<dt><code class="docutils literal"><span class="pre">RST</span></code></dt> +<dd>Describe a set of files containing the documentation. Feed it a single file +name or a CMake list.</dd> +</dl> +</dd></dl> + +<dl class="command"> +<dt id="command:add_doc_dependency"> +<code class="descname">add_doc_dependency</code><a class="headerlink" href="#command:add_doc_dependency" title="Permalink to this definition">¶</a></dt> +<dd><div class="highlight-cmake"><div class="highlight"><pre><span class="nb">add_doc_source</span><span class="p">(</span><span class="s">NAME</span> <span class="s">name</span> + <span class="s">DEP</span> <span class="s">dependency1</span> <span class="s">[dependency2...]</span><span class="p">)</span> +</pre></div> +</div> +<p>Add a dependency to the doc build system. For an existing name, add some +dependencies when it comes to building documentation. Mostly for internal use.</p> +<p>The parameters are:</p> +<dl class="docutils"> +<dt><code class="docutils literal"><span class="pre">NAME</span></code></dt> +<dd>Specify a name the dependencies belong to. This name needs to be already +known in the doc build system. Names of Python modules are good, otherwise +names introduced by <span class="target" id="index-0-command:add_doc_source"></span><a class="reference internal" href="#command:add_doc_source" title="add_doc_source"><code class="xref cmake cmake-command docutils literal"><span class="pre">add_doc_source()</span></code></a> work well. Dependencies +will be create for all reStructuredText files listed by +<span class="target" id="index-1-command:add_doc_source"></span><a class="reference internal" href="#command:add_doc_source" title="add_doc_source"><code class="xref cmake cmake-command docutils literal"><span class="pre">add_doc_source()</span></code></a> under this name and for all <code class="docutils literal"><span class="pre">make</span></code> +targets related to the documentation.</dd> +<dt><code class="docutils literal"><span class="pre">DEP</span></code></dt> +<dd>Hand over a dependency here or a CMake list. Files work, if given with +absolute path.</dd> </dl> </dd></dl> @@ -132,23 +189,24 @@ build directory.</dd> <h3>Actions<a class="headerlink" href="#actions" title="Permalink to this headline">¶</a></h3> <dl class="command"> <dt id="command:pm_action"> -<tt class="descname">pm_action</tt><a class="headerlink" href="#command:pm_action" title="Permalink to this definition">¶</a></dt> +<code class="descname">pm_action</code><a class="headerlink" href="#command:pm_action" title="Permalink to this definition">¶</a></dt> <dd><div class="highlight-cmake"><div class="highlight"><pre><span class="nb">pm_action</span><span class="p">(</span><span class="s">ACTION</span> <span class="s">action-script</span> <span class="s">TARGET</span> <span class="s">target</span><span class="p">)</span> </pre></div> </div> -<p>Add an action to ProMod3. Actions are scripts called by the <tt class="docutils literal"><span class="pre">pm</span></tt> launcher -and should all live in the <tt class="file docutils literal"><span class="pre">actions</span></tt> directory as executable files. +<p>Add an action to ProMod3. Actions are scripts called by the <code class="docutils literal"><span class="pre">pm</span></code> launcher +and should all live in the <code class="file docutils literal"><span class="pre">actions</span></code> directory as executable files. Adding an action means connecting its file with the given target to be copied -to the <tt class="file docutils literal"><span class="pre">libexec</span></tt> directory. No dedicated <tt class="docutils literal"><span class="pre">make</span></tt> target will be +to the <code class="file docutils literal"><span class="pre">libexec</span></code> directory. No dedicated <code class="docutils literal"><span class="pre">make</span></code> target will be created.</p> <p>The parameters are:</p> <dl class="docutils"> -<dt><tt class="docutils literal"><span class="pre">ACTION</span></tt></dt> -<dd>Name of the action to be added. Should start with <tt class="docutils literal"><span class="pre">pm-</span></tt>. Needs to be an -existing file in the same directory as the invoking <tt class="file docutils literal"><span class="pre">CMakeLists.txt</span></tt>.</dd> -<dt><tt class="docutils literal"><span class="pre">TARGET</span></tt></dt> -<dd>Provide a <tt class="docutils literal"><span class="pre">make</span></tt> target to trigger copying the action’s script file. The +<dt><code class="docutils literal"><span class="pre">ACTION</span></code></dt> +<dd>Name of the action to be added. Should start with <code class="file docutils literal"><span class="pre">pm-</span></code>. Needs to be +an existing file in the same directory as the invoking +<code class="file docutils literal"><span class="pre">CMakeLists.txt</span></code>.</dd> +<dt><code class="docutils literal"><span class="pre">TARGET</span></code></dt> +<dd>Provide a <code class="docutils literal"><span class="pre">make</span></code> target to trigger copying the action’s script file. The target has to be created <strong>before</strong> any action may be attached to it.</dd> </dl> </dd></dl> @@ -161,7 +219,7 @@ target has to be created <strong>before</strong> any action may be attached to i </div> </div> </div> - <div class="sphinxsidebar"> + <div class="sphinxsidebar" role="navigation" aria-label="main navigation"> <div class="sphinxsidebarwrapper"> <h3><a href="../index.html">Table Of Contents</a></h3> <ul> @@ -169,6 +227,7 @@ target has to be created <strong>before</strong> any action may be attached to i <li><a class="reference internal" href="#introduction">Introduction</a></li> <li><a class="reference internal" href="#functions-for-module-action-maintenance">Functions For Module/ Action Maintenance</a><ul> <li><a class="reference internal" href="#unit-tests">Unit Tests</a></li> +<li><a class="reference internal" href="#documentation">Documentation</a></li> <li><a class="reference internal" href="#actions">Actions</a></li> </ul> </li> @@ -182,12 +241,14 @@ target has to be created <strong>before</strong> any action may be attached to i <h4>Next topic</h4> <p class="topless"><a href="../changelog.html" title="next chapter">Changelog</a></p> - <h3>This Page</h3> - <ul class="this-page-menu"> - <li><a href="../_sources/cmake/index.txt" - rel="nofollow">Show Source</a></li> - </ul> -<div id="searchbox" style="display: none"> + <div role="note" aria-label="source link"> + <h3>This Page</h3> + <ul class="this-page-menu"> + <li><a href="../_sources/cmake/index.txt" + rel="nofollow">Show Source</a></li> + </ul> + </div> +<div id="searchbox" style="display: none" role="search"> <h3>Quick search</h3> <form class="search" action="../search.html" method="get"> <input type="text" name="q" /> @@ -204,29 +265,20 @@ target has to be created <strong>before</strong> any action may be attached to i </div> <div class="clearer"></div> </div> - <div class="related"> - <h3>Navigation</h3> - <ul> - <li class="right" style="margin-right: 10px"> - <a href="../genindex.html" title="General Index" - >index</a></li> - <li class="right" > - <a href="../py-modindex.html" title="Python Module Index" - >modules</a> |</li> - <li class="right" > - <a href="../changelog.html" title="Changelog" - >next</a> |</li> - <li class="right" > - <a href="../contributing.html" title="Contributing" - >previous</a> |</li> - <li><a href="../index.html">ProMod3 0 documentation</a> »</li> - <li><a href="../developers.html" >Documentation For Developes</a> »</li> - </ul> - </div> <div class="footer"> - © Copyright 2014, Bienchen. - Last updated on Mar 24 17:42, 2015. - Created using <a href="http://sphinx-doc.org/">Sphinx</a> 1.2.3. + ©2015, Bienchen. + + | + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.3</a> + + | + <a href="../_sources/cmake/index.txt" + rel="nofollow">Page source</a></li> </div> + + + + </body> </html> \ No newline at end of file diff --git a/doc/html/contributing.html b/doc/html/contributing.html index 1f9cad7f13ce05cae1e357117a8e3217ac00a491..41ffd2b8963a5e1124901adfcb44626433698d5f 100644 --- a/doc/html/contributing.html +++ b/doc/html/contributing.html @@ -8,7 +8,7 @@ <title>Contributing — ProMod3 0 documentation</title> - <link rel="stylesheet" href="_static/default.css" type="text/css" /> + <link rel="stylesheet" href="_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="_static/pygments.css" type="text/css" /> <script type="text/javascript"> @@ -26,10 +26,14 @@ <link rel="top" title="ProMod3 0 documentation" href="index.html" /> <link rel="up" title="Documentation For Developes" href="developers.html" /> <link rel="next" title="ProMod3‘s Share Of CMake" href="cmake/index.html" /> - <link rel="prev" title="Building ProMod3" href="buildsystem.html" /> + <link rel="prev" title="Building ProMod3" href="buildsystem.html" /> + + + <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9"> + </head> - <body> - <div class="related"> + <body role="document"> + <div class="related" role="navigation" aria-label="related navigation"> <h3>Navigation</h3> <ul> <li class="right" style="margin-right: 10px"> @@ -44,15 +48,15 @@ <li class="right" > <a href="buildsystem.html" title="Building ProMod3" accesskey="P">previous</a> |</li> - <li><a href="index.html">ProMod3 0 documentation</a> »</li> - <li><a href="developers.html" accesskey="U">Documentation For Developes</a> »</li> + <li class="nav-item nav-item-0"><a href="index.html">ProMod3 0 documentation</a> »</li> + <li class="nav-item nav-item-1"><a href="developers.html" accesskey="U">Documentation For Developes</a> »</li> </ul> </div> <div class="document"> <div class="documentwrapper"> <div class="bodywrapper"> - <div class="body"> + <div class="body" role="main"> <div class="section" id="contributing"> <h1>Contributing<a class="headerlink" href="#contributing" title="Permalink to this headline">¶</a></h1> @@ -62,35 +66,35 @@ directory structure and tightly linked with this also CMake. The most general advice would be to use existing bits and pieces as examples and to be consistent with what you already find here. As an example, documentation explaining what a whole module is supposed to do usually goes into a -<tt class="file docutils literal"><span class="pre">doc</span></tt> directory within the modules tree, while the API itself is +<code class="file docutils literal"><span class="pre">doc</span></code> directory within the modules tree, while the API itself is documented inline. One exception exists on the example-driven approach: -following the <a class="reference internal" href="core/index.html#module-promod3.core" title="promod3.core: Basic functionality, supporting standard tasks in your code."><tt class="xref py py-mod docutils literal"><span class="pre">core</span></tt></a> module for your setup is not advisable. This +following the <a class="reference internal" href="core/index.html#module-promod3.core" title="promod3.core: Basic functionality, supporting standard tasks in your code."><code class="xref py py-mod docutils literal"><span class="pre">core</span></code></a> module for your setup is not advisable. This one is a bit special and provides core functionality to everybody else.</p> <p>In the end of this chapter you will find a little walk-through on how to get started.</p> <div class="section" id="git-branches"> <h2>Git Branches<a class="headerlink" href="#git-branches" title="Permalink to this headline">¶</a></h2> -<p>Basically we have two, sometimes three major branches. <tt class="docutils literal"><span class="pre">master</span></tt>, <tt class="docutils literal"><span class="pre">develop</span></tt> +<p>Basically we have two, sometimes three major branches. <code class="docutils literal"><span class="pre">master</span></code>, <code class="docutils literal"><span class="pre">develop</span></code> and in front of a new release a dedicated release branch. For bugs, hotfix branches of a rather short life are used.</p> -<p><tt class="docutils literal"><span class="pre">master</span></tt> is the stable branch, corresponding to a released version. It is +<p><code class="docutils literal"><span class="pre">master</span></code> is the stable branch, corresponding to a released version. It is solely fed by a release or hotfix branch.</p> -<p>Release branches, usually labelled <tt class="docutils literal"><span class="pre">release-<VERSION></span></tt>, are branched of -<tt class="docutils literal"><span class="pre">develop</span></tt> to fix features and thoroughly test them before a new major +<p>Release branches, usually labelled <code class="docutils literal"><span class="pre">release-<VERSION></span></code>, are branched of +<code class="docutils literal"><span class="pre">develop</span></code> to fix features and thoroughly test them before a new major release. Once everything looks trustworthy, such a branch is merged into -<tt class="docutils literal"><span class="pre">master</span></tt> and since there should be a few bug fixes in, <tt class="docutils literal"><span class="pre">master</span></tt> is merged -into <tt class="docutils literal"><span class="pre">develop</span></tt>. Bugs are fixed in dedicated hotfix branches, which should +<code class="docutils literal"><span class="pre">master</span></code> and since there should be a few bug fixes in, <code class="docutils literal"><span class="pre">master</span></code> is merged +into <code class="docutils literal"><span class="pre">develop</span></code>. Bugs are fixed in dedicated hotfix branches, which should only exist for the fix and testing itself. Those are forged from release -branches or <tt class="docutils literal"><span class="pre">master</span></tt>. If created for <tt class="docutils literal"><span class="pre">master</span></tt>, they are also merged back -into <tt class="docutils literal"><span class="pre">develop</span></tt>.</p> -<p>The <tt class="docutils literal"><span class="pre">develop</span></tt> branch exists to introduce new features up to the level of +branches or <code class="docutils literal"><span class="pre">master</span></code>. If created for <code class="docutils literal"><span class="pre">master</span></code>, they are also merged back +into <code class="docutils literal"><span class="pre">develop</span></code>.</p> +<p>The <code class="docutils literal"><span class="pre">develop</span></code> branch exists to introduce new features up to the level of whole projects extending ProMod3 and see that they work seamlessly together with the rest of the system. There do exist a couple of rather strict rules for what goes into this branch:</p> <ul class="simple"> <li>Your code must have been (briefly) reviewed by others</li> <li>There have to be unit tests</li> -<li>It needs to pass <tt class="docutils literal"><span class="pre">make</span> <span class="pre">check</span></tt> <strong>including</strong> <tt class="docutils literal"><span class="pre">doctest</span></tt> & <tt class="docutils literal"><span class="pre">linkcheck</span></tt></li> +<li>It needs to pass <code class="docutils literal"><span class="pre">make</span> <span class="pre">check</span></code> <strong>including</strong> <code class="docutils literal"><span class="pre">doctest</span></code> & <code class="docutils literal"><span class="pre">linkcheck</span></code></li> <li>Your project needs documentation</li> <li>It must not break the ability of out-of-source builds</li> </ul> @@ -105,15 +109,15 @@ the end for you, fixing the problems.</p> <p>The place where you may get messy is your own Git branch within the ProMod3 repository. This is basically where you should develop your project. Once you created something that could go into a release, tidy things up according to the -rules from above and merge it into <tt class="docutils literal"><span class="pre">develop</span></tt>. From there it will +rules from above and merge it into <code class="docutils literal"><span class="pre">develop</span></code>. From there it will automatically find its way into the next release.</p> -<p>To set up your own branch, start from a current <tt class="docutils literal"><span class="pre">develop</span></tt> branch:</p> +<p>To set up your own branch, start from a current <code class="docutils literal"><span class="pre">develop</span></code> branch:</p> <div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> git checkout develop <span class="c"># switch to branch develop</span> <span class="gp">$</span> git pull --rebase <span class="c"># update branch develop</span> <span class="gp">$</span> git checkout -b <BRANCHNAME> <span class="c"># create branch <BRANCHNAME> and switch to it</span> </pre></div> </div> -<p>Over time, <tt class="docutils literal"><span class="pre">develop</span></tt> may recognise some changes, e.g. new features, which you +<p>Over time, <code class="docutils literal"><span class="pre">develop</span></code> may recognise some changes, e.g. new features, which you want to make use of in your project. Keeping your branch up to date is a three step process. Git does not allow updates on top of changed code, so either changes have to be committed, or if in the middle of implementing something, @@ -136,7 +140,7 @@ achieved by:</p> <div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> git stash pop </pre></div> </div> -<p>After cleaning up your branch, switch to <tt class="docutils literal"><span class="pre">develop</span></tt>, update it and switch back:</p> +<p>After cleaning up your branch, switch to <code class="docutils literal"><span class="pre">develop</span></code>, update it and switch back:</p> <div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> git checkout develop <span class="gp">$</span> git pull --rebase <span class="gp">$</span> git checkout <BRANCHNAME> @@ -145,7 +149,7 @@ achieved by:</p> <p>Now for actually updating your branch, there are two different ways: merging and rebasing. A rebase may only be done, if you <strong>never</strong> pushed your branch to the origin of the repository (otherwise you will mess up history, in the worst -case <tt class="docutils literal"><span class="pre">develop</span></tt> may be unusable once you merge):</p> +case <code class="docutils literal"><span class="pre">develop</span></code> may be unusable once you merge):</p> <div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> git rebase develop </pre></div> </div> @@ -164,7 +168,7 @@ ProMod3 currently provides one for <strong class="command">commit</strong>. It i </pre></div> </div> <p>Its task is applying coding standards and doing a bunch of other checks on the -files involved in a commit. Everything around the script is hosted in <tt class="file docutils literal"><span class="pre">extras/pre_commit/</span></tt>.</p> +files involved in a commit. Everything around the script is hosted in <code class="file docutils literal"><span class="pre">extras/pre_commit/</span></code>.</p> <p>If you ever have to skip the hook,</p> <div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> git commit --no-verify <span class="gp">$</span> @@ -183,8 +187,8 @@ it just seems inconvenient or you do not understand why Pylint is croaking at what looks like ‘working’ code. But then there are also cases where Pylint is not smart enough to cope with valid PEP 8 code. For changes with valid cause, the configuration flushed into Pylint may be found at -<tt class="file docutils literal"><span class="pre">extras/pre_commit/pm3_csc/filecheck/pylintrc</span></tt> and -<tt class="file docutils literal"><span class="pre">extras/pre_commit/pm3_csc/filecheck/pylint-unittest-rc</span></tt>. The latter one +<code class="file docutils literal"><span class="pre">extras/pre_commit/pm3_csc/filecheck/pylintrc</span></code> and +<code class="file docutils literal"><span class="pre">extras/pre_commit/pm3_csc/filecheck/pylint-unittest-rc</span></code>. The latter one is invoked on unit test code, where we may go a little bit less restrictive.</p> </div> <div class="section" id="directory-structure"> @@ -225,25 +229,25 @@ repository root. The directory structure of your module should look like this:</ </div> <div class="section" id="cmake"> <h2>CMake<a class="headerlink" href="#cmake" title="Permalink to this headline">¶</a></h2> -<p>The attentive reader may have noticed all the <tt class="file docutils literal"><span class="pre">CMakeLists.txt</span></tt> files in +<p>The attentive reader may have noticed all the <code class="file docutils literal"><span class="pre">CMakeLists.txt</span></code> files in the directory structure. Those are needed to configure the build system, e.g. tell it which files have to be considered packaging, compiling, etc.. Also Python modules are declared there as well as which files belong to the documentation. CMake is a rather complex topic (unfortunately all usable build systems seem to be) so we skip a detailed view, here, and just advice you to go by example. There is a tiny bit of documentation on our additions to -CMake <a class="reference internal" href="cmake/index.html#pm3-cmake-doc"><em>here</em></a>. If you really need to make changes to the +CMake <a class="reference internal" href="cmake/index.html#pm3-cmake-doc"><span>here</span></a>. If you really need to make changes to the build system, other than adding new files and modules, you have to dive into CMake documentation all by yourself and on your own responsibility. You have been warned.</p> </div> <div class="section" id="the-stage-directory"> -<h2>The <tt class="file docutils literal"><span class="pre">stage</span></tt> Directory<a class="headerlink" href="#the-stage-directory" title="Permalink to this headline">¶</a></h2> -<p>Once you hit <strong class="command">make</strong> in your build directory, a directory <tt class="file docutils literal"><span class="pre">stage</span></tt> +<h2>The <code class="file docutils literal"><span class="pre">stage</span></code> Directory<a class="headerlink" href="#the-stage-directory" title="Permalink to this headline">¶</a></h2> +<p>Once you hit <strong class="command">make</strong> in your build directory, a directory <code class="file docutils literal"><span class="pre">stage</span></code> in this path will be populated. It just resembles a directory structure as of a usual Unix file system filled with the build products of ProMod3. The -<tt class="file docutils literal"><span class="pre">stage</span></tt> directory tree can already be utilised. You may import Python -modules from there, use the binaries from <tt class="file docutils literal"><span class="pre">stage/bin</span></tt>, etc..</p> +<code class="file docutils literal"><span class="pre">stage</span></code> directory tree can already be utilised. You may import Python +modules from there, use the binaries from <code class="file docutils literal"><span class="pre">stage/bin</span></code>, etc..</p> </div> <div class="section" id="unit-tests"> <h2>Unit Tests<a class="headerlink" href="#unit-tests" title="Permalink to this headline">¶</a></h2> @@ -252,23 +256,23 @@ tutorial on unit testing here. Again, have a look at how other modules treat this topic and then there is quite a lot of educated material to be found on the Internet. Nevertheless, here is a short list of most important advices:</p> <ul class="simple"> -<li>Tests go into dedicated scripts/ source files in the <tt class="file docutils literal"><span class="pre">tests</span></tt> directory</li> +<li>Tests go into dedicated scripts/ source files in the <code class="file docutils literal"><span class="pre">tests</span></code> directory</li> <li>No external data dependencies, if tests need data, they find it in -<tt class="file docutils literal"><span class="pre">tests/data</span></tt></li> +<code class="file docutils literal"><span class="pre">tests/data</span></code></li> <li>If ‘exotic’ Python modules are used, consider making the test aware of the possibility that the module is not available</li> <li>Tests do not fail on purpose</li> <li>No failing tests, that are considered ‘this does not affect anything’</li> </ul> -<p>To run the whole test suite, <tt class="docutils literal"><span class="pre">make</span> <span class="pre">check</span></tt> is enough. This will also trigger -the <tt class="docutils literal"><span class="pre">doctest</span></tt> and <tt class="docutils literal"><span class="pre">linkcheck</span></tt> targets. To avoid this, e.g. when just -testing a smallish change in code, <tt class="docutils literal"><span class="pre">codetest</span></tt> exists as a separate target, -only running unit tests from all modules in ProMod3. Actually <tt class="docutils literal"><span class="pre">make</span> <span class="pre">check</span></tt> -does nothing more but invoking <tt class="docutils literal"><span class="pre">doctest</span></tt>, <tt class="docutils literal"><span class="pre">linkcheck</span></tt> and <tt class="docutils literal"><span class="pre">codetest</span></tt> as +<p>To run the whole test suite, <code class="docutils literal"><span class="pre">make</span> <span class="pre">check</span></code> is enough. This will also trigger +the <code class="docutils literal"><span class="pre">doctest</span></code> and <code class="docutils literal"><span class="pre">linkcheck</span></code> targets. To avoid this, e.g. when just +testing a smallish change in code, <code class="docutils literal"><span class="pre">codetest</span></code> exists as a separate target, +only running unit tests from all modules in ProMod3. Actually <code class="docutils literal"><span class="pre">make</span> <span class="pre">check</span></code> +does nothing more but invoking <code class="docutils literal"><span class="pre">doctest</span></code>, <code class="docutils literal"><span class="pre">linkcheck</span></code> and <code class="docutils literal"><span class="pre">codetest</span></code> as dependencies. You could even go with running tests gathered in a single file: -assuming you have <tt class="file docutils literal"><span class="pre">your_module/tests/test_awesome_feature.py</span></tt>, CMake -will provide you with a target <tt class="docutils literal"><span class="pre">test_awesome_feature.py_run</span></tt>. If your module -has C++ tests, those will be available by <tt class="docutils literal"><span class="pre">test_suite_your_module_run</span></tt>.</p> +assuming you have <code class="file docutils literal"><span class="pre">your_module/tests/test_awesome_feature.py</span></code>, CMake +will provide you with a target <code class="docutils literal"><span class="pre">test_awesome_feature.py_run</span></code>. If your module +has C++ tests, those will be available by <code class="docutils literal"><span class="pre">test_suite_your_module_run</span></code>.</p> </div> <div class="section" id="writing-documentation"> <h2>Writing Documentation<a class="headerlink" href="#writing-documentation" title="Permalink to this headline">¶</a></h2> @@ -279,9 +283,9 @@ or man pages.</p> gives an idea of concepts and pulls in interfaces from source. Copying files to the build directory, issuing the Sphinx call and everything else that is needed to create the actual documentation is done by CMake and its makefiles. -Hence, the <tt class="file docutils literal"><span class="pre">CMakeLists.txt</span></tt> of the <tt class="file docutils literal"><span class="pre">doc</span></tt> directory of a module is +Hence, the <code class="file docutils literal"><span class="pre">CMakeLists.txt</span></code> of the <code class="file docutils literal"><span class="pre">doc</span></code> directory of a module is crucial. For documentation which does not relate to a particular module, the -repository comes with a top-level <tt class="file docutils literal"><span class="pre">doc</span></tt> directory.</p> +repository comes with a top-level <code class="file docutils literal"><span class="pre">doc</span></code> directory.</p> <p>While you should not spend to much time thinking about how to format documentation, here is a helpful list of standard formatters: <a class="reference external" href="http://sphinx-doc.org/markup/inline.html">http://sphinx-doc.org/markup/inline.html</a></p> @@ -289,11 +293,11 @@ documentation, here is a helpful list of standard formatters: the Changelog. It will be automatically pulled into the documentation.</p> </div> <div class="section" id="how-to-start-your-own-module"> -<h2>How To Start Your Own Module<a class="headerlink" href="#how-to-start-your-own-module" title="Permalink to this headline">¶</a></h2> +<span id="id1"></span><h2>How To Start Your Own Module<a class="headerlink" href="#how-to-start-your-own-module" title="Permalink to this headline">¶</a></h2> <p>This is just a walk-through how the topics from above work together when you start your own module. For the entry point, lets assume that you already cloned the repository into a directory and just changed into it.</p> -<p>All new features should take off from the <tt class="docutils literal"><span class="pre">develop</span></tt> branch. That way, they +<p>All new features should take off from the <code class="docutils literal"><span class="pre">develop</span></code> branch. That way, they work fine with all the other new fellows waiting for release right from the beginning. Therefore you need to switch branches as a first step. Git will tell you for which branch you went, a story of failure otherwise.</p> @@ -326,7 +330,7 @@ list of directories which are likely to be used in every project.</p> <span class="gp">$</span> </pre></div> </div> -<p>If you run <tt class="docutils literal"><span class="pre">git</span> <span class="pre">status</span></tt> at this point, you will see basically nothing. That +<p>If you run <code class="docutils literal"><span class="pre">git</span> <span class="pre">status</span></code> at this point, you will see basically nothing. That is, Git does not admire empty directories. Before you bring your module under version control, create a couple of files which are always needed.</p> <div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> touch sidechains/pymod/__init__.py @@ -335,8 +339,8 @@ version control, create a couple of files which are always needed.</p> <span class="gp">$</span> </pre></div> </div> -<p>Having an empty <tt class="file docutils literal"><span class="pre">__init__.py</span></tt> is perfectly fine for Python, it just -announces a directory as a module. But a blank <tt class="file docutils literal"><span class="pre">index.rst</span></tt> has the chance +<p>Having an empty <code class="file docutils literal"><span class="pre">__init__.py</span></code> is perfectly fine for Python, it just +announces a directory as a module. But a blank <code class="file docutils literal"><span class="pre">index.rst</span></code> has the chance to give Sphinx quite a headache so you already fill it with a headline for your documentation.</p> <p>For integration with <strong class="command">make</strong>, the build system needs to now about the @@ -349,16 +353,16 @@ extending some around the directory root.</p> </pre></div> </div> <p>Each of those files still needs a bit of content. The simplest one comes from -the module’s root, <tt class="file docutils literal"><span class="pre">sidechains/CMakeLists.txt</span></tt>:</p> +the module’s root, <code class="file docutils literal"><span class="pre">sidechains/CMakeLists.txt</span></code>:</p> <div class="highlight-cmake"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>1 2</pre></div></td><td class="code"><div class="highlight"><pre><span class="nb">add_subdirectory</span><span class="p">(</span><span class="s">pymod</span><span class="p">)</span> <span class="nb">add_subdirectory</span><span class="p">(</span><span class="s">doc</span><span class="p">)</span> </pre></div> </td></tr></table></div> <p>Those two directives just tell CMake to go and look in directories -<tt class="file docutils literal"><span class="pre">pymod</span></tt> and <tt class="file docutils literal"><span class="pre">doc</span></tt> below the current path for more CMake -configurations. The next level in <tt class="file docutils literal"><span class="pre">CMakeLists.txt</span></tt> magic comes for the -<tt class="file docutils literal"><span class="pre">doc</span></tt> directory:</p> +<code class="file docutils literal"><span class="pre">pymod</span></code> and <code class="file docutils literal"><span class="pre">doc</span></code> below the current path for more CMake +configurations. The next level in <code class="file docutils literal"><span class="pre">CMakeLists.txt</span></code> magic comes for the +<code class="file docutils literal"><span class="pre">doc</span></code> directory:</p> <div class="highlight-cmake"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>1 2 3 @@ -370,20 +374,20 @@ configurations. The next level in <tt class="file docutils literal"><span class= <span class="nb">add_doc_source</span><span class="p">(</span><span class="s">NAME</span> <span class="s">sidechains</span> <span class="s">RST</span> <span class="o">${</span><span class="nv">SIDECHAINS_RST</span><span class="o">}</span><span class="p">)</span> </pre></div> </td></tr></table></div> -<p><tt class="docutils literal"><span class="pre">add_doc_source</span></tt> is our custom CMake macro to register +<p><code class="docutils literal"><span class="pre">add_doc_source</span></code> is our custom CMake macro to register reST files for the documentation. On running -<strong class="command">make</strong>, those files are placed in a <tt class="file docutils literal"><span class="pre">doc/source</span></tt> directory tree +<strong class="command">make</strong>, those files are placed in a <code class="file docutils literal"><span class="pre">doc/source</span></code> directory tree within the build directory. Each new submodule in your project should be -covered by its own documentation entity, extending the list in <tt class="docutils literal"><span class="pre">RST</span></tt>. +covered by its own documentation entity, extending the list in <code class="docutils literal"><span class="pre">RST</span></code>. Maintaining readability, its good practice to store this list in a separate -variable, called <tt class="docutils literal"><span class="pre">SIDECHAINS_RST</span></tt> here.</p> +variable, called <code class="docutils literal"><span class="pre">SIDECHAINS_RST</span></code> here.</p> <p>For the actual code, you should keep in mind that a Python module may be rather complex. There is for sure Python code, there could be a bit of C++ and conditional compilation. In rare cases you also want to modify the directory structure of the package. All this has to be declared in the -<tt class="file docutils literal"><span class="pre">pymod</span></tt> subtree. We cannot enumerate all specialities but there should be +<code class="file docutils literal"><span class="pre">pymod</span></code> subtree. We cannot enumerate all specialities but there should be a couple of examples around in this repository. Here is the most basic -<tt class="file docutils literal"><span class="pre">CMakeLists.txt</span></tt>:</p> +<code class="file docutils literal"><span class="pre">CMakeLists.txt</span></code>:</p> <div class="highlight-cmake"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>1 2 3 @@ -397,11 +401,11 @@ a couple of examples around in this repository. Here is the most basic </td></tr></table></div> <p>Source files should be again listed in a dedicated variable. Later, you probably add some C++ code and settings diverging from the defaults via the -<tt class="docutils literal"><span class="pre">pymod</span></tt> macro. This is where things clutter up quite quickly. As set up here, -your project would be added as a module <tt class="docutils literal"><span class="pre">sidechains</span></tt> in the ProMod3 +<code class="docutils literal"><span class="pre">pymod</span></code> macro. This is where things clutter up quite quickly. As set up here, +your project would be added as a module <code class="docutils literal"><span class="pre">sidechains</span></code> in the ProMod3 Python package tree.</p> <p>The final step towards CMake is to register your module’s directory in the -top level <tt class="file docutils literal"><span class="pre">CMakeLists.txt</span></tt>:</p> +top level <code class="file docutils literal"><span class="pre">CMakeLists.txt</span></code>:</p> <div class="highlight-cmake"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre> 1 2 3 @@ -647,23 +651,23 @@ directory as shown in line 103.</p> <p>This was the final step to set up the build system. Running CMake at this point would create the build environment in place. But building software in your code repository has several drawbacks. First of all, it puts all kind of -new files in the directory tree and <tt class="docutils literal"><span class="pre">git</span> <span class="pre">status</span></tt> would show them all. Then -its very likely, that manual intervention is needed after <tt class="docutils literal"><span class="pre">make</span> <span class="pre">clean</span></tt>. Plus, +new files in the directory tree and <code class="docutils literal"><span class="pre">git</span> <span class="pre">status</span></code> would show them all. Then +its very likely, that manual intervention is needed after <code class="docutils literal"><span class="pre">make</span> <span class="pre">clean</span></code>. Plus, this would be very static. Imagine at one point you want to switch on all debugging flags for your C++ code. So you either clean the whole repository and rebuild or you go by two separated repositories copying code changes from A to B. The solution to this is instead of ‘in place’ you go ‘out of source’. You still can stay in your repository while being out of the source tree by using sub-directories. ProMod3 comes with a dedicated prefix ‘build*’ in -<tt class="file docutils literal"><span class="pre">.gitignore</span></tt>. Have a directory <tt class="file docutils literal"><span class="pre">build</span></tt> and <tt class="file docutils literal"><span class="pre">build-dbg</span></tt> and it -will not show up in <tt class="docutils literal"><span class="pre">git</span> <span class="pre">status</span></tt>.</p> +<code class="file docutils literal"><span class="pre">.gitignore</span></code>. Have a directory <code class="file docutils literal"><span class="pre">build</span></code> and <code class="file docutils literal"><span class="pre">build-dbg</span></code> and it +will not show up in <code class="docutils literal"><span class="pre">git</span> <span class="pre">status</span></code>.</p> <div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> mkdir build <span class="gp">$</span> <span class="nb">cd </span>build <span class="gp">$</span> </pre></div> </div> <p>To actually create all the makefiles and generated files, you may use one of -the configuration scripts from the <tt class="file docutils literal"><span class="pre">conf-scripts</span></tt> directory. Usually +the configuration scripts from the <code class="file docutils literal"><span class="pre">conf-scripts</span></code> directory. Usually those scripts only need to be pointed to an OST staging tree. Even if you are on a system not covered by available scripts, their code may help you at the CMake command. Once you managed to conquer a new system, feel free to add @@ -672,19 +676,19 @@ a new configuration script. The following example assumes Fedora 19.</p> </pre></div> </div> <p>From this point, <strong class="command">make</strong> should work and you could start adding your -files to the repository using <tt class="docutils literal"><span class="pre">git</span> <span class="pre">add</span></tt>.</p> -<p>Up to now, we did not cover the <tt class="file docutils literal"><span class="pre">tests</span></tt> branch of a new module. But its +files to the repository using <code class="docutils literal"><span class="pre">git</span> <span class="pre">add</span></code>.</p> +<p>Up to now, we did not cover the <code class="file docutils literal"><span class="pre">tests</span></code> branch of a new module. But its good practice to develop new functionality along tests and that right from the beginning. At some point, new code needs testing anyway to see if it does what it should, so just do this by writing unit tests. Test sources are stored in -files with a prefix <tt class="file docutils literal"><span class="pre">test_</span></tt> and usually come per submodule instead of -sporting a single monolithic <tt class="file docutils literal"><span class="pre">test_sidechains.py</span></tt>.</p> +files with a prefix <code class="file docutils literal"><span class="pre">test_</span></code> and usually come per submodule instead of +sporting a single monolithic <code class="file docutils literal"><span class="pre">test_sidechains.py</span></code>.</p> <p>Python code is evaluated using its own <a class="reference external" href="https://docs.python.org/2.7/library/unittest.html">unit testing framework</a> with a little help from <a class="reference external" href="http://www.OpenStructure.org">OST</a> (C++ uses the Boost <a class="reference external" href="http://www.boost.org/doc/libs/1_47_0/libs/test/doc/html/index.html">Test Library</a>). -The basic scheme is to import your module, subclass <a class="reference external" href="https://docs.python.org/2.7/library/unittest.html#unittest.TestCase" title="(in Python v2.7)"><tt class="xref py py-class docutils literal"><span class="pre">unittest.TestCase</span></tt></a> -and make the whole file runnable as script using the most common <a class="reference external" href="https://docs.python.org/2.7/library/__main__.html"><tt class="xref py py-attr docutils literal"><span class="pre">__name__</span></tt></a> -attribute. A file <tt class="file docutils literal"><span class="pre">tests/test_something.py</span></tt> could look like this, +The basic scheme is to import your module, subclass <a class="reference external" href="https://docs.python.org/2.7/library/unittest.html#unittest.TestCase" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">unittest.TestCase</span></code></a> +and make the whole file runnable as script using the most common <a class="reference external" href="https://docs.python.org/2.7/library/__main__.html"><code class="xref py py-attr docutils literal"><span class="pre">__name__</span></code></a> +attribute. A file <code class="file docutils literal"><span class="pre">tests/test_something.py</span></code> could look like this, carrying a single test case:</p> <div class="highlight-python"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre> 1 2 @@ -707,10 +711,10 @@ carrying a single test case:</p> <span class="n">testutils</span><span class="o">.</span><span class="n">RunTests</span><span class="p">()</span> </pre></div> </td></tr></table></div> -<p>To hook up your tests with <tt class="docutils literal"><span class="pre">make</span> <span class="pre">codetest</span></tt> (and to create a -<tt class="docutils literal"><span class="pre">test_something.py_run</span></tt> target), everything has to be introduced to CMake. -First, tell CMake to search <tt class="file docutils literal"><span class="pre">tests</span></tt> for a <tt class="file docutils literal"><span class="pre">CMakeLists.txt</span></tt> file -by extending the list of sub-directories in <tt class="file docutils literal"><span class="pre">sidechains/CMakeLists.txt</span></tt>:</p> +<p>To hook up your tests with <code class="docutils literal"><span class="pre">make</span> <span class="pre">codetest</span></code> (and to create a +<code class="docutils literal"><span class="pre">test_something.py_run</span></code> target), everything has to be introduced to CMake. +First, tell CMake to search <code class="file docutils literal"><span class="pre">tests</span></code> for a <code class="file docutils literal"><span class="pre">CMakeLists.txt</span></code> file +by extending the list of sub-directories in <code class="file docutils literal"><span class="pre">sidechains/CMakeLists.txt</span></code>:</p> <div class="highlight-cmake"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>1 2 3</pre></div></td><td class="code"><div class="highlight"><pre> <span class="nb">add_subdirectory</span><span class="p">(</span><span class="s">pymod</span><span class="p">)</span> @@ -718,22 +722,143 @@ by extending the list of sub-directories in <tt class="file docutils literal"><s <span class="nb">add_subdirectory</span><span class="p">(</span><span class="s">tests</span><span class="p">)</span> </pre></div> </td></tr></table></div> -<p>Then fill <tt class="file docutils literal"><span class="pre">sidechains/tests/CMakeLists.txt</span></tt> with your new test script and -<tt class="docutils literal"><span class="pre">make</span></tt> will recognise the changes next time it is run and fix the rest for +<p>Then fill <code class="file docutils literal"><span class="pre">sidechains/tests/CMakeLists.txt</span></code> with your new test script and +<code class="docutils literal"><span class="pre">make</span></code> will recognise the changes next time it is run and fix the rest for you.</p> <div class="highlight-cmake"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>1 2 3 4 -5</pre></div></td><td class="code"><div class="highlight"><pre> set(SIDECHAINS_UNIT_TESTS - test_something.py - ) +5</pre></div></td><td class="code"><div class="highlight"><pre> <span class="nb">set</span><span class="p">(</span><span class="s">SIDECHAINS_UNIT_TESTS</span> + <span class="s">test_something.py</span> + <span class="p">)</span> - promod3_unittest(MODULE sidechains SOURCES "${SIDECHAINS_UNIT_TESTS}") + <span class="nb">promod3_unittest</span><span class="p">(</span><span class="s">MODULE</span> <span class="s">sidechains</span> <span class="s">SOURCES</span> <span class="s2">"${SIDECHAINS_UNIT_TESTS}"</span><span class="p">)</span> </pre></div> </td></tr></table></div> -<p>Now tests should be available by <tt class="docutils literal"><span class="pre">make</span> <span class="pre">check</span></tt>, <tt class="docutils literal"><span class="pre">make</span> <span class="pre">codetest</span></tt> and -<tt class="docutils literal"><span class="pre">make</span> <span class="pre">test_something.py_run</span></tt>.</p> +<p>Now tests should be available by <code class="docutils literal"><span class="pre">make</span> <span class="pre">check</span></code>, <code class="docutils literal"><span class="pre">make</span> <span class="pre">codetest</span></code> and +<code class="docutils literal"><span class="pre">make</span> <span class="pre">test_something.py_run</span></code>.</p> +</div> +<div class="section" id="how-to-start-your-own-action"> +<h2>How To Start Your Own Action<a class="headerlink" href="#how-to-start-your-own-action" title="Permalink to this headline">¶</a></h2> +<p>In ProMod3 we call scripts/ programs ‘actions’. They are started by a +launcher found in your staging directory at <code class="file docutils literal"><span class="pre">stage/bin/pm</span></code>. This little +guy helps keeping the shell environment in the right mood to carry out your +job. So usually you will start an action by</p> +<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> stage/bin/pm <span class="nb">help</span> +</pre></div> +</div> +<p>To start your own action, follow <a class="reference internal" href="#how-to-start-your-own-module"><span>How To Start Your Own Module</span></a> until +creating a directory structure for a new module. Also <strong>do</strong> go for a dedicated +branch for action-development. There you can produce intermediate commits while +other branches stay clean in case you have to do some work there which needs to +get public.</p> +<p>After preparing your repository its time to create a file for the action. That +is a bit different than for modules. Assuming we are sitting in the +repository’s root:</p> +<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> touch action/pm-awesome-action +<span class="gp">$</span> chmod +x action/pm-awesome-action +</pre></div> +</div> +<p>Two things are important here: actions are prefixed with <code class="file docutils literal"><span class="pre">pm-</span></code>, so they +are recognised by the <code class="file docutils literal"><span class="pre">pm</span></code> launcher. Secondly, action files need to be +executable, which does not propagate if you do it <strong>after</strong> the first call to +<code class="docutils literal"><span class="pre">make</span></code>.</p> +<p>To get the new action recognised by <code class="docutils literal"><span class="pre">make</span></code> to be placed in +<code class="file docutils literal"><span class="pre">stage/libexec/promod3</span></code>, it has to be registered with CMake in +<code class="file docutils literal"><span class="pre">actions/CMakeLists.txt</span></code>:</p> +<div class="highlight-cmake"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>1 +2 +3 +4 +5 +6 +7</pre></div></td><td class="code"><div class="highlight"><pre> <span class="nb">add_custom_target</span><span class="p">(</span><span class="s">actions</span> <span class="s">ALL</span><span class="p">)</span> + <span class="nb">add_subdirectory</span><span class="p">(</span><span class="s">tests</span><span class="p">)</span> + + <span class="nb">pm_action_init</span><span class="p">()</span> + <span class="nb">pm_action</span><span class="p">(</span><span class="s">pm-build-rawmodel</span> <span class="s">actions</span><span class="p">)</span> + <span class="nb">pm_action</span><span class="p">(</span><span class="s">pm-help</span> <span class="s">actions</span><span class="p">)</span> + <span class="nb">pm_action</span><span class="p">(</span><span class="s">pm-awesome-action</span> <span class="s">actions</span><span class="p">)</span> +</pre></div> +</td></tr></table></div> +<p>Just add your action with its full filename with a call to +<span class="target" id="index-0-command:pm_action"></span><a class="reference internal" href="cmake/index.html#command:pm_action" title="pm_action"><code class="xref cmake cmake-command docutils literal"><span class="pre">pm_action()</span></code></a> at the end of the file.</p> +<p>Before coding your action, lets set up unit tests for it. Usually when adding +features, you will immediately try them, check that everything works as +intended, etc.. ProMod3 helps you automatising those tests so its rather easy +to check later, if code changes break anything. Start with a file +<code class="file docutils literal"><span class="pre">actions/tests/test_action_awesome.py</span></code>:</p> +<div class="highlight-python"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre> 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 +10 +11 +12 +13 +14 +15 +16 +17 +18 +19</pre></div></td><td class="code"><div class="highlight"><pre><span class="kn">import</span> <span class="nn">sys</span> + +<span class="c"># this is needed so there will be no test_actions.pyc created in the source</span> +<span class="c"># directory</span> +<span class="n">sys</span><span class="o">.</span><span class="n">dont_write_bytecode</span> <span class="o">=</span> <span class="bp">True</span> + +<span class="kn">import</span> <span class="nn">test_actions</span> + +<span class="k">class</span> <span class="nc">AwesomeActionTests</span><span class="p">(</span><span class="n">test_actions</span><span class="o">.</span><span class="n">ActionTestCase</span><span class="p">):</span> + <span class="k">def</span> <span class="nf">__init__</span><span class="p">(</span><span class="bp">self</span><span class="p">,</span> <span class="o">*</span><span class="n">args</span><span class="p">,</span> <span class="o">**</span><span class="n">kwargs</span><span class="p">):</span> + <span class="n">test_actions</span><span class="o">.</span><span class="n">ActionTestCase</span><span class="o">.</span><span class="n">__init__</span><span class="p">(</span><span class="bp">self</span><span class="p">,</span> <span class="o">*</span><span class="n">args</span><span class="p">,</span> <span class="o">**</span><span class="n">kwargs</span><span class="p">)</span> + <span class="bp">self</span><span class="o">.</span><span class="n">pm_action</span> <span class="o">=</span> <span class="s">'awesome'</span> + + <span class="k">def</span> <span class="nf">testExit0</span><span class="p">(</span><span class="bp">self</span><span class="p">):</span> + <span class="bp">self</span><span class="o">.</span><span class="n">RunExitStatusTest</span><span class="p">(</span><span class="mi">0</span><span class="p">,</span> <span class="nb">list</span><span class="p">())</span> + +<span class="k">if</span> <span class="n">__name__</span> <span class="o">==</span> <span class="s">"__main__"</span><span class="p">:</span> + <span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">testutils</span> + <span class="n">testutils</span><span class="o">.</span><span class="n">RunTests</span><span class="p">()</span> +</pre></div> +</td></tr></table></div> +<p>Please note that for actions we are using +<a class="reference internal" href="actions/index_dev.html#module-test_actions" title="test_actions"><code class="xref py py-class docutils literal"><span class="pre">test_actions.ActionTestCase</span></code></a> instead of +<a class="reference external" href="https://docs.python.org/2.7/library/unittest.html#unittest.TestCase" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">unittest.TestCase</span></code></a>. Since testing has a lot in common for different +actions, we decided to put up a little wrapper around this subject. See the +documentation of <a class="reference internal" href="actions/index_dev.html#module-test_actions" title="test_actions"><code class="xref py py-class docutils literal"><span class="pre">ActionTestCase</span></code></a> for more information.</p> +<p>Now its time to fill your action with code. Instead of reading a lot more of +explanations, it should be easy to go by examples from the <code class="file docutils literal"><span class="pre">actions</span></code> +directory. There are only two really important points:</p> +<ul> +<li><p class="first">No shebang line (<code class="docutils literal"><span class="pre">#!</span> <span class="pre">/usr/bin/python</span></code>) in your action! Also no +<code class="docutils literal"><span class="pre">#!</span> <span class="pre">/usr/bin/env</span> <span class="pre">python</span></code> or anything like this. This may lead to funny side +effects, like calling a Python interpreter from outside a virtual +environment or a different version OST. Basically it may mess up the +environment your action is running in. Actions are called by <code class="file docutils literal"><span class="pre">pm</span></code>, +that’s enough to get everything just right.</p> +</li> +<li><p class="first">The action of your action happens in the <a class="reference external" href="https://docs.python.org/2.7/library/__main__.html"><code class="xref py py-attr docutils literal"><span class="pre">__main__</span></code></a> branch of the script. +Your action will have own function definitions, variables and all the bells +and whistles. Hiding behind <a class="reference external" href="https://docs.python.org/2.7/library/__main__.html"><code class="xref py py-attr docutils literal"><span class="pre">__main__</span></code></a> keeps everything separated and makes +things easier when it gets to debugging. So just after</p> +<div class="highlight-python"><div class="highlight"><pre><span class="kn">import</span> <span class="nn">alot</span> + +<span class="k">def</span> <span class="nf">functions_specific_to_your_action</span><span class="p">(</span><span class="o">...</span><span class="p">):</span> + +<span class="k">if</span> <span class="n">__name__</span> <span class="o">==</span> <span class="s">"__main__"</span><span class="p">:</span> + <span class="o"><</span><span class="n">put</span> <span class="n">together</span> <span class="n">what</span> <span class="n">your</span> <span class="n">action</span> <span class="n">should</span> <span class="n">do</span> <span class="n">here</span><span class="o">></span> +</pre></div> +</div> +<p>start putting your action together.</p> +</li> +</ul> </div> <div class="section" id="third-party-contributions-license-issues"> <h2>Third Party Contributions (License Issues)<a class="headerlink" href="#third-party-contributions-license-issues" title="Permalink to this headline">¶</a></h2> @@ -770,7 +895,7 @@ contributions to web pages using ProMod3.</p> </div> </div> </div> - <div class="sphinxsidebar"> + <div class="sphinxsidebar" role="navigation" aria-label="main navigation"> <div class="sphinxsidebarwrapper"> <h3><a href="index.html">Table Of Contents</a></h3> <ul> @@ -779,10 +904,11 @@ contributions to web pages using ProMod3.</p> <li><a class="reference internal" href="#git-hooks">Git Hooks</a></li> <li><a class="reference internal" href="#directory-structure">Directory Structure</a></li> <li><a class="reference internal" href="#cmake">CMake</a></li> -<li><a class="reference internal" href="#the-stage-directory">The <tt class="file docutils literal"><span class="pre">stage</span></tt> Directory</a></li> +<li><a class="reference internal" href="#the-stage-directory">The <code class="file docutils literal"><span class="pre">stage</span></code> Directory</a></li> <li><a class="reference internal" href="#unit-tests">Unit Tests</a></li> <li><a class="reference internal" href="#writing-documentation">Writing Documentation</a></li> <li><a class="reference internal" href="#how-to-start-your-own-module">How To Start Your Own Module</a></li> +<li><a class="reference internal" href="#how-to-start-your-own-action">How To Start Your Own Action</a></li> <li><a class="reference internal" href="#third-party-contributions-license-issues">Third Party Contributions (License Issues)</a></li> </ul> </li> @@ -794,12 +920,14 @@ contributions to web pages using ProMod3.</p> <h4>Next topic</h4> <p class="topless"><a href="cmake/index.html" title="next chapter">ProMod3‘s Share Of CMake</a></p> - <h3>This Page</h3> - <ul class="this-page-menu"> - <li><a href="_sources/contributing.txt" - rel="nofollow">Show Source</a></li> - </ul> -<div id="searchbox" style="display: none"> + <div role="note" aria-label="source link"> + <h3>This Page</h3> + <ul class="this-page-menu"> + <li><a href="_sources/contributing.txt" + rel="nofollow">Show Source</a></li> + </ul> + </div> +<div id="searchbox" style="display: none" role="search"> <h3>Quick search</h3> <form class="search" action="search.html" method="get"> <input type="text" name="q" /> @@ -816,29 +944,20 @@ contributions to web pages using ProMod3.</p> </div> <div class="clearer"></div> </div> - <div class="related"> - <h3>Navigation</h3> - <ul> - <li class="right" style="margin-right: 10px"> - <a href="genindex.html" title="General Index" - >index</a></li> - <li class="right" > - <a href="py-modindex.html" title="Python Module Index" - >modules</a> |</li> - <li class="right" > - <a href="cmake/index.html" title="ProMod3‘s Share Of CMake" - >next</a> |</li> - <li class="right" > - <a href="buildsystem.html" title="Building ProMod3" - >previous</a> |</li> - <li><a href="index.html">ProMod3 0 documentation</a> »</li> - <li><a href="developers.html" >Documentation For Developes</a> »</li> - </ul> - </div> <div class="footer"> - © Copyright 2014, Bienchen. - Last updated on Mar 24 17:42, 2015. - Created using <a href="http://sphinx-doc.org/">Sphinx</a> 1.2.3. + ©2015, Bienchen. + + | + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.3</a> + + | + <a href="_sources/contributing.txt" + rel="nofollow">Page source</a></li> </div> + + + + </body> </html> \ No newline at end of file diff --git a/doc/html/core/argcheck.html b/doc/html/core/argcheck.html deleted file mode 100644 index 900c80d978fc8ba8c17723a45d3c9ccaabcd8828..0000000000000000000000000000000000000000 --- a/doc/html/core/argcheck.html +++ /dev/null @@ -1,224 +0,0 @@ -<!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" - "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> - - -<html xmlns="http://www.w3.org/1999/xhtml"> - <head> - <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - - <title>argcheck - Standard Tests For Command Line Arguments — ProMod3 0 documentation</title> - - <link rel="stylesheet" href="../_static/default.css" type="text/css" /> - <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> - - <script type="text/javascript"> - var DOCUMENTATION_OPTIONS = { - URL_ROOT: '../', - VERSION: '0', - COLLAPSE_INDEX: false, - FILE_SUFFIX: '.html', - HAS_SOURCE: true - }; - </script> - <script type="text/javascript" src="../_static/jquery.js"></script> - <script type="text/javascript" src="../_static/underscore.js"></script> - <script type="text/javascript" src="../_static/doctools.js"></script> - <link rel="top" title="ProMod3 0 documentation" href="../index.html" /> - <link rel="up" title="core - ProMod3 Core Functionality" href="index.html" /> - <link rel="next" title="helper - Shared Functionality For the Everything" href="helper.html" /> - <link rel="prev" title="core - ProMod3 Core Functionality" href="index.html" /> - </head> - <body> - <div class="related"> - <h3>Navigation</h3> - <ul> - <li class="right" style="margin-right: 10px"> - <a href="../genindex.html" title="General Index" - accesskey="I">index</a></li> - <li class="right" > - <a href="../py-modindex.html" title="Python Module Index" - >modules</a> |</li> - <li class="right" > - <a href="helper.html" title="helper - Shared Functionality For the Everything" - accesskey="N">next</a> |</li> - <li class="right" > - <a href="index.html" title="core - ProMod3 Core Functionality" - accesskey="P">previous</a> |</li> - <li><a href="../index.html">ProMod3 0 documentation</a> »</li> - <li><a href="../developers.html" >Documentation For Developes</a> »</li> - <li><a href="index.html" accesskey="U"><tt class="docutils literal"><span class="pre">core</span></tt> - ProMod3 Core Functionality</a> »</li> - </ul> - </div> - - <div class="document"> - <div class="documentwrapper"> - <div class="bodywrapper"> - <div class="body"> - - <div class="section" id="argcheck-standard-tests-for-command-line-arguments"> -<h1><tt class="xref py py-mod docutils literal"><span class="pre">argcheck</span></tt> - Standard Tests For Command Line Arguments<a class="headerlink" href="#argcheck-standard-tests-for-command-line-arguments" title="Permalink to this headline">¶</a></h1> -<div class="section" id="introduction"> -<h2>Introduction<a class="headerlink" href="#introduction" title="Permalink to this headline">¶</a></h2> -<p>For parsing command line arguments - -<a class="reference external" href="https://docs.python.org/2.7/howto/argparse.html#introducing-optional-arguments">optional</a> and -<a class="reference external" href="https://docs.python.org/2.7/howto/argparse.html#introducing-positional-arguments">positional</a> - -ProMod3 tools should utilise Pythons own -<a class="reference external" href="https://docs.python.org/2.7/library/argparse.html">argparse</a> module. While this comes with a lot -of functionality to fetch values from the command line comfortably, it has no -means in checking/ verifying input. Some of the most common tests are covered -here. All tests are designed to exit a script on failure.</p> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">import</span> <span class="nn">argparse</span> -<span class="kn">from</span> <span class="nn">promod3.core</span> <span class="kn">import</span> <span class="n">argcheck</span> - -<span class="n">p</span> <span class="o">=</span> <span class="n">argparse</span><span class="o">.</span><span class="n">ArgumentParser</span><span class="p">()</span> -<span class="n">p</span><span class="o">.</span><span class="n">add_argument</span><span class="p">(</span><span class="s">'file'</span><span class="p">,</span> <span class="nb">type</span><span class="o">=</span><span class="nb">str</span><span class="p">)</span> -<span class="n">opts</span> <span class="o">=</span> <span class="n">p</span><span class="o">.</span><span class="n">parse_args</span><span class="p">()</span> - -<span class="n">argcheck</span><span class="o">.</span><span class="n">FileExists</span><span class="p">(</span><span class="s">'Test file'</span><span class="p">,</span> <span class="mi">1</span><span class="p">,</span> <span class="n">opts</span><span class="o">.</span><span class="n">file</span><span class="p">)</span> - -<span class="n">opts</span><span class="o">.</span><span class="n">name</span><span class="p">,</span> <span class="n">opts</span><span class="o">.</span><span class="n">ext</span><span class="p">,</span> <span class="n">opts</span><span class="o">.</span><span class="n">gz</span> <span class="o">=</span> <span class="n">argcheck</span><span class="o">.</span><span class="n">FileExtension</span><span class="p">(</span><span class="s">'Test file'</span><span class="p">,</span> <span class="mi">2</span><span class="p">,</span> - <span class="n">opts</span><span class="o">.</span><span class="n">file</span><span class="p">,</span> - <span class="p">(</span><span class="s">'pdb'</span><span class="p">,</span> <span class="s">'mmcif'</span><span class="p">),</span> - <span class="n">gz</span><span class="o">=</span><span class="bp">True</span><span class="p">)</span> -</pre></div> -</div> -</div> -<div class="section" id="file-tests"> -<h2>File Tests<a class="headerlink" href="#file-tests" title="Permalink to this headline">¶</a></h2> -<dl class="function"> -<dt id="promod3.core.argcheck.FileExists"> -<tt class="descclassname">promod3.core.argcheck.</tt><tt class="descname">FileExists</tt><big>(</big><em>prefix</em>, <em>exit_status</em>, <em>file</em><big>)</big><a class="reference internal" href="../_modules/promod3/core/argcheck.html#FileExists"><span class="viewcode-link">[source]</span></a><a class="headerlink" href="#promod3.core.argcheck.FileExists" title="Permalink to this definition">¶</a></dt> -<dd><p>Checks if a file exists, terminates if not. The error message displayed is -fixed and only needs a <em>prefix</em> describing the specimen of file.</p> -<table class="docutils field-list" frame="void" rules="none"> -<col class="field-name" /> -<col class="field-body" /> -<tbody valign="top"> -<tr class="field-odd field"><th class="field-name">Parameters:</th><td class="field-body"><ul class="first simple"> -<li><strong>prefix</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#str" title="(in Python v2.7)"><tt class="xref py py-class docutils literal"><span class="pre">str</span></tt></a>) – String to put in front of the failure-message -“file does not exist: <tt class="docutils literal"><span class="pre">file</span></tt>”.</li> -<li><strong>exit_status</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#int" title="(in Python v2.7)"><tt class="xref py py-class docutils literal"><span class="pre">int</span></tt></a>) – Exit code on missing file, ends up in <tt class="docutils literal"><span class="pre">$?</span></tt> in the -shell. <tt class="docutils literal"><span class="pre">0</span></tt> is traditionally reserved to successful commands.</li> -<li><strong>file</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#str" title="(in Python v2.7)"><tt class="xref py py-class docutils literal"><span class="pre">str</span></tt></a>) – Path including file name to be checked.</li> -</ul> -</td> -</tr> -<tr class="field-even field"><th class="field-name">Returns:</th><td class="field-body"><p class="first last">No return value, exits script with value <tt class="docutils literal"><span class="pre">exit_status</span></tt> if file is -missing.</p> -</td> -</tr> -</tbody> -</table> -</dd></dl> - -<dl class="function"> -<dt id="promod3.core.argcheck.FileExtension"> -<tt class="descclassname">promod3.core.argcheck.</tt><tt class="descname">FileExtension</tt><big>(</big><em>prefix</em>, <em>exit_status</em>, <em>file</em>, <em>extensions</em>, <em>gz=False</em><big>)</big><a class="reference internal" href="../_modules/promod3/core/argcheck.html#FileExtension"><span class="viewcode-link">[source]</span></a><a class="headerlink" href="#promod3.core.argcheck.FileExtension" title="Permalink to this definition">¶</a></dt> -<dd><p>Checks a file to carry a known extension given by a list of strings. Since -files are very often compressed these days, an additional “gz” suffix can be -tracked automatically by this function. Thus, the list of <em>extensions</em> only -needs to contain what you are really looking for, e.g. (“pdb”) instead of -(“pdb”, “pdb.gz”). The <em>gz</em> flag also determines the output of this function. -If enabled, a triple is returned: name of the file without extension, its -extension and a Boolean to tell whether the file carries the gzip extension -or not. If <em>gz</em> detection is turned of, only a tuple is returned: file name -and extension. If the tested file name has an unrecognised extension, this -function terminates the script.</p> -<table class="docutils field-list" frame="void" rules="none"> -<col class="field-name" /> -<col class="field-body" /> -<tbody valign="top"> -<tr class="field-odd field"><th class="field-name">Parameters:</th><td class="field-body"><ul class="first simple"> -<li><strong>prefix</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#str" title="(in Python v2.7)"><tt class="xref py py-class docutils literal"><span class="pre">str</span></tt></a>) – String to put in front of the failure-message -“file extension not supported: <tt class="docutils literal"><span class="pre">file</span></tt>”.</li> -<li><strong>exit_status</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#int" title="(in Python v2.7)"><tt class="xref py py-class docutils literal"><span class="pre">int</span></tt></a>) – Exit code on missing file, ends up in <tt class="docutils literal"><span class="pre">$?</span></tt> in the -shell. <tt class="docutils literal"><span class="pre">0</span></tt> is traditionally reserved to successful commands.</li> -<li><strong>file</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#str" title="(in Python v2.7)"><tt class="xref py py-class docutils literal"><span class="pre">str</span></tt></a>) – Path including file name to be checked.</li> -<li><strong>extensions</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#list" title="(in Python v2.7)"><tt class="xref py py-class docutils literal"><span class="pre">list</span></tt></a>) – List of strings without a leading ”.”.</li> -<li><strong>gz</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#bool" title="(in Python v2.7)"><tt class="xref py py-class docutils literal"><span class="pre">bool</span></tt></a>) – Indicates whether to check for an additional “gz” extension.</li> -</ul> -</td> -</tr> -<tr class="field-even field"><th class="field-name">Returns:</th><td class="field-body"><p class="first last">(base name of <tt class="docutils literal"><span class="pre">file</span></tt> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#str" title="(in Python v2.7)"><tt class="xref py py-class docutils literal"><span class="pre">str</span></tt></a>), extension of file without a -”.gz” (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#str" title="(in Python v2.7)"><tt class="xref py py-class docutils literal"><span class="pre">str</span></tt></a>), flag to indicate an additional ”.gz” -(<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#bool" title="(in Python v2.7)"><tt class="xref py py-class docutils literal"><span class="pre">bool</span></tt></a>)) <strong>if</strong> <tt class="docutils literal"><span class="pre">gz</span></tt> is set, (base name of <tt class="docutils literal"><span class="pre">file</span></tt> -(<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#str" title="(in Python v2.7)"><tt class="xref py py-class docutils literal"><span class="pre">str</span></tt></a>), extension of file) <strong>if not</strong>.</p> -</td> -</tr> -</tbody> -</table> -</dd></dl> - -</div> -</div> - - - </div> - </div> - </div> - <div class="sphinxsidebar"> - <div class="sphinxsidebarwrapper"> - <h3><a href="../index.html">Table Of Contents</a></h3> - <ul> -<li><a class="reference internal" href="#"><tt class="docutils literal"><span class="pre">argcheck</span></tt> - Standard Tests For Command Line Arguments</a><ul> -<li><a class="reference internal" href="#introduction">Introduction</a></li> -<li><a class="reference internal" href="#file-tests">File Tests</a></li> -</ul> -</li> -</ul> - - <h4>Previous topic</h4> - <p class="topless"><a href="index.html" - title="previous chapter"><tt class="docutils literal"><span class="pre">core</span></tt> - ProMod3 Core Functionality</a></p> - <h4>Next topic</h4> - <p class="topless"><a href="helper.html" - title="next chapter"><tt class="docutils literal"><span class="pre">helper</span></tt> - Shared Functionality For the Everything</a></p> - <h3>This Page</h3> - <ul class="this-page-menu"> - <li><a href="../_sources/core/argcheck.txt" - rel="nofollow">Show Source</a></li> - </ul> -<div id="searchbox" style="display: none"> - <h3>Quick search</h3> - <form class="search" action="../search.html" method="get"> - <input type="text" name="q" /> - <input type="submit" value="Go" /> - <input type="hidden" name="check_keywords" value="yes" /> - <input type="hidden" name="area" value="default" /> - </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> -</div> -<script type="text/javascript">$('#searchbox').show(0);</script> - </div> - </div> - <div class="clearer"></div> - </div> - <div class="related"> - <h3>Navigation</h3> - <ul> - <li class="right" style="margin-right: 10px"> - <a href="../genindex.html" title="General Index" - >index</a></li> - <li class="right" > - <a href="../py-modindex.html" title="Python Module Index" - >modules</a> |</li> - <li class="right" > - <a href="helper.html" title="helper - Shared Functionality For the Everything" - >next</a> |</li> - <li class="right" > - <a href="index.html" title="core - ProMod3 Core Functionality" - >previous</a> |</li> - <li><a href="../index.html">ProMod3 0 documentation</a> »</li> - <li><a href="../developers.html" >Documentation For Developes</a> »</li> - <li><a href="index.html" ><tt class="docutils literal"><span class="pre">core</span></tt> - ProMod3 Core Functionality</a> »</li> - </ul> - </div> - <div class="footer"> - © Copyright 2014, Bienchen. - Last updated on Mar 23 14:52, 2015. - Created using <a href="http://sphinx-doc.org/">Sphinx</a> 1.2.3. - </div> - </body> -</html> \ No newline at end of file diff --git a/doc/html/core/helper.html b/doc/html/core/helper.html index 4115022186df8ed0340e9e6e6d2623e6504acd9c..083829335c38302c8904d9f200e50285de867f8b 100644 --- a/doc/html/core/helper.html +++ b/doc/html/core/helper.html @@ -8,7 +8,7 @@ <title>helper - Shared Functionality For the Everything — ProMod3 0 documentation</title> - <link rel="stylesheet" href="../_static/default.css" type="text/css" /> + <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> <script type="text/javascript"> @@ -26,10 +26,14 @@ <link rel="top" title="ProMod3 0 documentation" href="../index.html" /> <link rel="up" title="core - ProMod3 Core Functionality" href="index.html" /> <link rel="next" title="rawmodel - Coordinate Modeling" href="../rawmodel/index.html" /> - <link rel="prev" title="argcheck - Standard Tests For Command Line Arguments" href="argcheck.html" /> + <link rel="prev" title="pm3argparse - Parsing Command Lines" href="pm3argparse.html" /> + + + <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9"> + </head> - <body> - <div class="related"> + <body role="document"> + <div class="related" role="navigation" aria-label="related navigation"> <h3>Navigation</h3> <ul> <li class="right" style="margin-right: 10px"> @@ -42,21 +46,21 @@ <a href="../rawmodel/index.html" title="rawmodel - Coordinate Modeling" accesskey="N">next</a> |</li> <li class="right" > - <a href="argcheck.html" title="argcheck - Standard Tests For Command Line Arguments" + <a href="pm3argparse.html" title="pm3argparse - Parsing Command Lines" accesskey="P">previous</a> |</li> - <li><a href="../index.html">ProMod3 0 documentation</a> »</li> - <li><a href="../developers.html" >Documentation For Developes</a> »</li> - <li><a href="index.html" accesskey="U"><tt class="docutils literal"><span class="pre">core</span></tt> - ProMod3 Core Functionality</a> »</li> + <li class="nav-item nav-item-0"><a href="../index.html">ProMod3 0 documentation</a> »</li> + <li class="nav-item nav-item-1"><a href="../developers.html" >Documentation For Developes</a> »</li> + <li class="nav-item nav-item-2"><a href="index.html" accesskey="U"><code class="docutils literal"><span class="pre">core</span></code> - ProMod3 Core Functionality</a> »</li> </ul> </div> <div class="document"> <div class="documentwrapper"> <div class="bodywrapper"> - <div class="body"> + <div class="body" role="main"> <div class="section" id="helper-shared-functionality-for-the-everything"> -<h1><tt class="xref py py-mod docutils literal"><span class="pre">helper</span></tt> - Shared Functionality For the Everything<a class="headerlink" href="#helper-shared-functionality-for-the-everything" title="Permalink to this headline">¶</a></h1> +<h1><code class="xref py py-mod docutils literal"><span class="pre">helper</span></code> - Shared Functionality For the Everything<a class="headerlink" href="#helper-shared-functionality-for-the-everything" title="Permalink to this headline">¶</a></h1> <div class="section" id="introduction"> <h2>Introduction<a class="headerlink" href="#introduction" title="Permalink to this headline">¶</a></h2> <p>We collect functions here, which should be useful in many places but would make @@ -71,21 +75,133 @@ rather empty modules left alone.</p> </div> <dl class="function"> <dt id="promod3.core.helper.MsgErrorAndExit"> -<tt class="descclassname">promod3.core.helper.</tt><tt class="descname">MsgErrorAndExit</tt><big>(</big><em>msg</em>, <em>exit_status</em><big>)</big><a class="reference internal" href="../_modules/promod3/core/helper.html#MsgErrorAndExit"><span class="viewcode-link">[source]</span></a><a class="headerlink" href="#promod3.core.helper.MsgErrorAndExit" title="Permalink to this definition">¶</a></dt> -<dd><p>Send a messages to the OST <a class="reference external" href="http://www.openstructure.org/docs/1.3/base/logging/">error log</a> and exit -the Python interpreter.</p> +<code class="descclassname">promod3.core.helper.</code><code class="descname">MsgErrorAndExit</code><span class="sig-paren">(</span><em>msg</em>, <em>exit_status</em><span class="sig-paren">)</span><a class="reference internal" href="../_modules/promod3/core/helper.html#MsgErrorAndExit"><span class="viewcode-link">[source]</span></a><a class="headerlink" href="#promod3.core.helper.MsgErrorAndExit" title="Permalink to this definition">¶</a></dt> +<dd><p>Send a messages to the OST <a class="reference external" href="http://www.openstructure.org/docs/1.3/base/logging/">error log</a> and +exit the Python interpreter.</p> <table class="docutils field-list" frame="void" rules="none"> <col class="field-name" /> <col class="field-body" /> <tbody valign="top"> <tr class="field-odd field"><th class="field-name">Parameters:</th><td class="field-body"><ul class="first simple"> -<li><strong>msg</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#str" title="(in Python v2.7)"><tt class="xref py py-class docutils literal"><span class="pre">str</span></tt></a>) – The message.</li> -<li><strong>exit_status</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#int" title="(in Python v2.7)"><tt class="xref py py-class docutils literal"><span class="pre">int</span></tt></a>) – Exit code, ends up in <tt class="docutils literal"><span class="pre">$?</span></tt> in the shell. <tt class="docutils literal"><span class="pre">0</span></tt> is +<li><strong>msg</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#str" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">str</span></code></a>) – The message.</li> +<li><strong>exit_status</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#int" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">int</span></code></a>) – Exit code, ends up in <code class="docutils literal"><span class="pre">$?</span></code> in the shell. <code class="docutils literal"><span class="pre">0</span></code> is traditionally reserved to successful commands.</li> </ul> </td> </tr> -<tr class="field-even field"><th class="field-name">Returns:</th><td class="field-body"><p class="first last">No return value, exits script with value <tt class="docutils literal"><span class="pre">exit_status</span></tt>.</p> +<tr class="field-even field"><th class="field-name">Returns:</th><td class="field-body"><p class="first last">No return value, exits script with value <code class="docutils literal"><span class="pre">exit_status</span></code>.</p> +</td> +</tr> +</tbody> +</table> +</dd></dl> + +</div> +<div class="section" id="file-tests"> +<h2>File Tests<a class="headerlink" href="#file-tests" title="Permalink to this headline">¶</a></h2> +<div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">promod3.core</span> <span class="kn">import</span> <span class="n">helper</span> +<span class="kn">from</span> <span class="nn">promod3.core</span> <span class="kn">import</span> <span class="n">pm3argparse</span> + +<span class="n">p</span> <span class="o">=</span> <span class="n">pm3argparse</span><span class="o">.</span><span class="n">PM3ArgumentParser</span><span class="p">(</span><span class="n">__doc__</span><span class="p">)</span> +<span class="n">p</span><span class="o">.</span><span class="n">add_argument</span><span class="p">(</span><span class="s">'file'</span><span class="p">,</span> <span class="nb">type</span><span class="o">=</span><span class="nb">str</span><span class="p">)</span> +<span class="n">opts</span> <span class="o">=</span> <span class="n">p</span><span class="o">.</span><span class="n">Parse</span><span class="p">()</span> + +<span class="n">helper</span><span class="o">.</span><span class="n">FileExists</span><span class="p">(</span><span class="s">'Test file'</span><span class="p">,</span> <span class="mi">1</span><span class="p">,</span> <span class="n">opts</span><span class="o">.</span><span class="n">file</span><span class="p">)</span> + +<span class="n">opts</span><span class="o">.</span><span class="n">name</span><span class="p">,</span> <span class="n">opts</span><span class="o">.</span><span class="n">ext</span><span class="p">,</span> <span class="n">opts</span><span class="o">.</span><span class="n">gz</span> <span class="o">=</span> <span class="n">helper</span><span class="o">.</span><span class="n">FileExtension</span><span class="p">(</span><span class="s">'Test file'</span><span class="p">,</span> <span class="mi">2</span><span class="p">,</span> + <span class="n">opts</span><span class="o">.</span><span class="n">file</span><span class="p">,</span> + <span class="p">(</span><span class="s">'pdb'</span><span class="p">,</span> <span class="s">'mmcif'</span><span class="p">),</span> + <span class="n">gzip</span><span class="o">=</span><span class="bp">True</span><span class="p">)</span> +</pre></div> +</div> +<dl class="function"> +<dt id="promod3.core.helper.FileExists"> +<code class="descclassname">promod3.core.helper.</code><code class="descname">FileExists</code><span class="sig-paren">(</span><em>prefix</em>, <em>exit_status</em>, <em>filename</em><span class="sig-paren">)</span><a class="reference internal" href="../_modules/promod3/core/helper.html#FileExists"><span class="viewcode-link">[source]</span></a><a class="headerlink" href="#promod3.core.helper.FileExists" title="Permalink to this definition">¶</a></dt> +<dd><p>Checks if a file exists, terminates if not. The error message displayed is +fixed and only needs a <em>prefix</em> describing the specimen of file.</p> +<table class="docutils field-list" frame="void" rules="none"> +<col class="field-name" /> +<col class="field-body" /> +<tbody valign="top"> +<tr class="field-odd field"><th class="field-name">Parameters:</th><td class="field-body"><ul class="first simple"> +<li><strong>prefix</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#str" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">str</span></code></a>) – String to put in front of the failure-message +“file does not exist: <code class="docutils literal"><span class="pre">file</span></code>”.</li> +<li><strong>exit_status</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#int" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">int</span></code></a>) – Exit code on missing file, ends up in <code class="docutils literal"><span class="pre">$?</span></code> in the +shell. <code class="docutils literal"><span class="pre">0</span></code> is traditionally reserved to successful commands.</li> +<li><strong>file</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#str" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">str</span></code></a>) – Path including file name to be checked.</li> +</ul> +</td> +</tr> +<tr class="field-even field"><th class="field-name">Returns:</th><td class="field-body"><p class="first last">No return value, exits script with value <code class="docutils literal"><span class="pre">exit_status</span></code> if file +is missing.</p> +</td> +</tr> +</tbody> +</table> +</dd></dl> + +<dl class="function"> +<dt id="promod3.core.helper.FileExtension"> +<code class="descclassname">promod3.core.helper.</code><code class="descname">FileExtension</code><span class="sig-paren">(</span><em>prefix</em>, <em>exit_status</em>, <em>filename</em>, <em>extensions</em>, <em>gzip=False</em><span class="sig-paren">)</span><a class="reference internal" href="../_modules/promod3/core/helper.html#FileExtension"><span class="viewcode-link">[source]</span></a><a class="headerlink" href="#promod3.core.helper.FileExtension" title="Permalink to this definition">¶</a></dt> +<dd><p>Checks a file to carry a known extension given by a list of strings. Since +files are very often compressed these days, an additional “gz” suffix can be +tracked automatically by this function. Thus, the list of <em>extensions</em> only +needs to contain what you are really looking for, e.g. (“pdb”) instead of +(“pdb”, “pdb.gz”). The <em>gzip</em> flag also determines the output of this +function. If enabled, a triple is returned: name of the file without +extension, its extension and a Boolean to tell whether the file carries the +gzip extension or not. If <em>gzip</em> detection is turned of, only a tuple is +returned: file name and extension. If the tested file name has an +unrecognised extension, this function terminates the script.</p> +<table class="docutils field-list" frame="void" rules="none"> +<col class="field-name" /> +<col class="field-body" /> +<tbody valign="top"> +<tr class="field-odd field"><th class="field-name">Parameters:</th><td class="field-body"><ul class="first simple"> +<li><strong>prefix</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#str" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">str</span></code></a>) – String to put in front of the failure-message +“file extension not supported: <code class="docutils literal"><span class="pre">filename</span></code>”.</li> +<li><strong>exit_status</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#int" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">int</span></code></a>) – Exit code on missing file, ends up in <code class="docutils literal"><span class="pre">$?</span></code> in the +shell. <code class="docutils literal"><span class="pre">0</span></code> is traditionally reserved to successful commands.</li> +<li><strong>filename</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#str" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">str</span></code></a>) – Path including file name to be checked.</li> +<li><strong>extensions</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#list" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">list</span></code></a>) – List of strings without a leading ”.”.</li> +<li><strong>gzip</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#bool" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">bool</span></code></a>) – Indicates whether to check for an additional “gz” extension.</li> +</ul> +</td> +</tr> +<tr class="field-even field"><th class="field-name">Returns:</th><td class="field-body"><p class="first last">(base name of <code class="docutils literal"><span class="pre">filename</span></code> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#str" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">str</span></code></a>), extension of file +without a ”.gz” (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#str" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">str</span></code></a>), flag to indicate an additional +”.gz” (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#bool" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">bool</span></code></a>)) <strong>if</strong> <code class="docutils literal"><span class="pre">gzip</span></code> is set, (base name of +<code class="docutils literal"><span class="pre">filename</span></code> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#str" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">str</span></code></a>), extension of file) <strong>if not</strong>.</p> +</td> +</tr> +</tbody> +</table> +</dd></dl> + +<dl class="function"> +<dt id="promod3.core.helper.FileGzip"> +<code class="descclassname">promod3.core.helper.</code><code class="descname">FileGzip</code><span class="sig-paren">(</span><em>prefix</em>, <em>exit_status</em>, <em>filename</em>, <em>allowed=True</em><span class="sig-paren">)</span><a class="reference internal" href="../_modules/promod3/core/helper.html#FileGzip"><span class="viewcode-link">[source]</span></a><a class="headerlink" href="#promod3.core.helper.FileGzip" title="Permalink to this definition">¶</a></dt> +<dd><p>See if a file is gzipped or not. This is basically done by checking for a +“gz” suffix. May also be used to verify that a file is not compressed where +it does not apply. That is where <em>allowed</em> comes in. If “gz” is not allowed, +terminates the script on gzip files.</p> +<table class="docutils field-list" frame="void" rules="none"> +<col class="field-name" /> +<col class="field-body" /> +<tbody valign="top"> +<tr class="field-odd field"><th class="field-name">Parameters:</th><td class="field-body"><ul class="first simple"> +<li><strong>prefix</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#str" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">str</span></code></a>) – String to put in front of the failure-message where gzip +files are not allowed.</li> +<li><strong>exit_status</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#int" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">int</span></code></a>) – Exit code on gzip files to be avoided, ends up in +<code class="docutils literal"><span class="pre">$?</span></code> in the shell. <code class="docutils literal"><span class="pre">0</span></code> is traditionally reserved to +successful commands.</li> +<li><strong>filename</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#str" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">str</span></code></a>) – Path including file name to be checked.</li> +<li><strong>allowed</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#bool" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">bool</span></code></a>) – Set to <code class="docutils literal"><span class="pre">False</span></code> if gzipped files are not allowed. Then the +script will terminate if a gzip file is found.</li> +</ul> +</td> +</tr> +<tr class="field-even field"><th class="field-name">Returns:</th><td class="field-body"><p class="first last">Flag to indicate if file is gzipped (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#bool" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">bool</span></code></a>).</p> </td> </tr> </tbody> @@ -99,29 +215,32 @@ traditionally reserved to successful commands.</li> </div> </div> </div> - <div class="sphinxsidebar"> + <div class="sphinxsidebar" role="navigation" aria-label="main navigation"> <div class="sphinxsidebarwrapper"> <h3><a href="../index.html">Table Of Contents</a></h3> <ul> -<li><a class="reference internal" href="#"><tt class="docutils literal"><span class="pre">helper</span></tt> - Shared Functionality For the Everything</a><ul> +<li><a class="reference internal" href="#"><code class="docutils literal"><span class="pre">helper</span></code> - Shared Functionality For the Everything</a><ul> <li><a class="reference internal" href="#introduction">Introduction</a></li> <li><a class="reference internal" href="#messages">Messages</a></li> +<li><a class="reference internal" href="#file-tests">File Tests</a></li> </ul> </li> </ul> <h4>Previous topic</h4> - <p class="topless"><a href="argcheck.html" - title="previous chapter"><tt class="docutils literal"><span class="pre">argcheck</span></tt> - Standard Tests For Command Line Arguments</a></p> + <p class="topless"><a href="pm3argparse.html" + title="previous chapter"><code class="docutils literal"><span class="pre">pm3argparse</span></code> - Parsing Command Lines</a></p> <h4>Next topic</h4> <p class="topless"><a href="../rawmodel/index.html" - title="next chapter"><tt class="docutils literal"><span class="pre">rawmodel</span></tt> - Coordinate Modeling</a></p> - <h3>This Page</h3> - <ul class="this-page-menu"> - <li><a href="../_sources/core/helper.txt" - rel="nofollow">Show Source</a></li> - </ul> -<div id="searchbox" style="display: none"> + title="next chapter"><code class="docutils literal"><span class="pre">rawmodel</span></code> - Coordinate Modeling</a></p> + <div role="note" aria-label="source link"> + <h3>This Page</h3> + <ul class="this-page-menu"> + <li><a href="../_sources/core/helper.txt" + rel="nofollow">Show Source</a></li> + </ul> + </div> +<div id="searchbox" style="display: none" role="search"> <h3>Quick search</h3> <form class="search" action="../search.html" method="get"> <input type="text" name="q" /> @@ -138,30 +257,20 @@ traditionally reserved to successful commands.</li> </div> <div class="clearer"></div> </div> - <div class="related"> - <h3>Navigation</h3> - <ul> - <li class="right" style="margin-right: 10px"> - <a href="../genindex.html" title="General Index" - >index</a></li> - <li class="right" > - <a href="../py-modindex.html" title="Python Module Index" - >modules</a> |</li> - <li class="right" > - <a href="../rawmodel/index.html" title="rawmodel - Coordinate Modeling" - >next</a> |</li> - <li class="right" > - <a href="argcheck.html" title="argcheck - Standard Tests For Command Line Arguments" - >previous</a> |</li> - <li><a href="../index.html">ProMod3 0 documentation</a> »</li> - <li><a href="../developers.html" >Documentation For Developes</a> »</li> - <li><a href="index.html" ><tt class="docutils literal"><span class="pre">core</span></tt> - ProMod3 Core Functionality</a> »</li> - </ul> - </div> <div class="footer"> - © Copyright 2014, Bienchen. - Last updated on Mar 23 14:52, 2015. - Created using <a href="http://sphinx-doc.org/">Sphinx</a> 1.2.3. + ©2015, Bienchen. + + | + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.3</a> + + | + <a href="../_sources/core/helper.txt" + rel="nofollow">Page source</a></li> </div> + + + + </body> </html> \ No newline at end of file diff --git a/doc/html/core/index.html b/doc/html/core/index.html index c8c1c23d9c1b8e4ad89079de0efd7271f8dd6461..a916e4415a772584ca5361a705167a96560a03da 100644 --- a/doc/html/core/index.html +++ b/doc/html/core/index.html @@ -8,7 +8,7 @@ <title>core - ProMod3 Core Functionality — ProMod3 0 documentation</title> - <link rel="stylesheet" href="../_static/default.css" type="text/css" /> + <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> <script type="text/javascript"> @@ -25,11 +25,15 @@ <script type="text/javascript" src="../_static/doctools.js"></script> <link rel="top" title="ProMod3 0 documentation" href="../index.html" /> <link rel="up" title="Documentation For Developes" href="../developers.html" /> - <link rel="next" title="argcheck - Standard Tests For Command Line Arguments" href="argcheck.html" /> - <link rel="prev" title="SetCompoundsChemlib()" href="setcompoundschemlib.html" /> + <link rel="next" title="pm3argparse - Parsing Command Lines" href="pm3argparse.html" /> + <link rel="prev" title="SetCompoundsChemlib()" href="setcompoundschemlib.html" /> + + + <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9"> + </head> - <body> - <div class="related"> + <body role="document"> + <div class="related" role="navigation" aria-label="related navigation"> <h3>Navigation</h3> <ul> <li class="right" style="margin-right: 10px"> @@ -39,35 +43,36 @@ <a href="../py-modindex.html" title="Python Module Index" >modules</a> |</li> <li class="right" > - <a href="argcheck.html" title="argcheck - Standard Tests For Command Line Arguments" + <a href="pm3argparse.html" title="pm3argparse - Parsing Command Lines" accesskey="N">next</a> |</li> <li class="right" > <a href="setcompoundschemlib.html" title="SetCompoundsChemlib()" accesskey="P">previous</a> |</li> - <li><a href="../index.html">ProMod3 0 documentation</a> »</li> - <li><a href="../developers.html" accesskey="U">Documentation For Developes</a> »</li> + <li class="nav-item nav-item-0"><a href="../index.html">ProMod3 0 documentation</a> »</li> + <li class="nav-item nav-item-1"><a href="../developers.html" accesskey="U">Documentation For Developes</a> »</li> </ul> </div> <div class="document"> <div class="documentwrapper"> <div class="bodywrapper"> - <div class="body"> + <div class="body" role="main"> <div class="section" id="module-promod3.core"> -<span id="core-promod3-core-functionality"></span><h1><a class="reference internal" href="#module-promod3.core" title="promod3.core: Basic functionality, supporting standard tasks in your code."><tt class="xref py py-mod docutils literal"><span class="pre">core</span></tt></a> - ProMod3 Core Functionality<a class="headerlink" href="#module-promod3.core" title="Permalink to this headline">¶</a></h1> +<span id="core-promod3-core-functionality"></span><h1><a class="reference internal" href="#module-promod3.core" title="promod3.core: Basic functionality, supporting standard tasks in your code."><code class="xref py py-mod docutils literal"><span class="pre">core</span></code></a> - ProMod3 Core Functionality<a class="headerlink" href="#module-promod3.core" title="Permalink to this headline">¶</a></h1> <p>This module gathers functions and classes which are not devoted to homology modeling per se but cover standard programming issues.</p> <div class="toctree-wrapper compound"> <ul> -<li class="toctree-l1"><a class="reference internal" href="argcheck.html"><tt class="docutils literal"><span class="pre">argcheck</span></tt> - Standard Tests For Command Line Arguments</a><ul> -<li class="toctree-l2"><a class="reference internal" href="argcheck.html#introduction">Introduction</a></li> -<li class="toctree-l2"><a class="reference internal" href="argcheck.html#file-tests">File Tests</a></li> +<li class="toctree-l1"><a class="reference internal" href="pm3argparse.html"><code class="docutils literal"><span class="pre">pm3argparse</span></code> - Parsing Command Lines</a><ul> +<li class="toctree-l2"><a class="reference internal" href="pm3argparse.html#introduction">Introduction</a></li> +<li class="toctree-l2"><a class="reference internal" href="pm3argparse.html#argument-parser">Argument Parser</a></li> </ul> </li> -<li class="toctree-l1"><a class="reference internal" href="helper.html"><tt class="docutils literal"><span class="pre">helper</span></tt> - Shared Functionality For the Everything</a><ul> +<li class="toctree-l1"><a class="reference internal" href="helper.html"><code class="docutils literal"><span class="pre">helper</span></code> - Shared Functionality For the Everything</a><ul> <li class="toctree-l2"><a class="reference internal" href="helper.html#introduction">Introduction</a></li> <li class="toctree-l2"><a class="reference internal" href="helper.html#messages">Messages</a></li> +<li class="toctree-l2"><a class="reference internal" href="helper.html#file-tests">File Tests</a></li> </ul> </li> </ul> @@ -78,20 +83,22 @@ modeling per se but cover standard programming issues.</p> </div> </div> </div> - <div class="sphinxsidebar"> + <div class="sphinxsidebar" role="navigation" aria-label="main navigation"> <div class="sphinxsidebarwrapper"> <h4>Previous topic</h4> <p class="topless"><a href="setcompoundschemlib.html" - title="previous chapter"><tt class="docutils literal"><span class="pre">SetCompoundsChemlib()</span></tt></a></p> + title="previous chapter"><code class="docutils literal"><span class="pre">SetCompoundsChemlib()</span></code></a></p> <h4>Next topic</h4> - <p class="topless"><a href="argcheck.html" - title="next chapter"><tt class="docutils literal"><span class="pre">argcheck</span></tt> - Standard Tests For Command Line Arguments</a></p> - <h3>This Page</h3> - <ul class="this-page-menu"> - <li><a href="../_sources/core/index.txt" - rel="nofollow">Show Source</a></li> - </ul> -<div id="searchbox" style="display: none"> + <p class="topless"><a href="pm3argparse.html" + title="next chapter"><code class="docutils literal"><span class="pre">pm3argparse</span></code> - Parsing Command Lines</a></p> + <div role="note" aria-label="source link"> + <h3>This Page</h3> + <ul class="this-page-menu"> + <li><a href="../_sources/core/index.txt" + rel="nofollow">Show Source</a></li> + </ul> + </div> +<div id="searchbox" style="display: none" role="search"> <h3>Quick search</h3> <form class="search" action="../search.html" method="get"> <input type="text" name="q" /> @@ -108,29 +115,20 @@ modeling per se but cover standard programming issues.</p> </div> <div class="clearer"></div> </div> - <div class="related"> - <h3>Navigation</h3> - <ul> - <li class="right" style="margin-right: 10px"> - <a href="../genindex.html" title="General Index" - >index</a></li> - <li class="right" > - <a href="../py-modindex.html" title="Python Module Index" - >modules</a> |</li> - <li class="right" > - <a href="argcheck.html" title="argcheck - Standard Tests For Command Line Arguments" - >next</a> |</li> - <li class="right" > - <a href="setcompoundschemlib.html" title="SetCompoundsChemlib()" - >previous</a> |</li> - <li><a href="../index.html">ProMod3 0 documentation</a> »</li> - <li><a href="../developers.html" >Documentation For Developes</a> »</li> - </ul> - </div> <div class="footer"> - © Copyright 2014, Bienchen. - Last updated on Mar 23 14:52, 2015. - Created using <a href="http://sphinx-doc.org/">Sphinx</a> 1.2.3. + ©2015, Bienchen. + + | + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.3</a> + + | + <a href="../_sources/core/index.txt" + rel="nofollow">Page source</a></li> </div> + + + + </body> </html> \ No newline at end of file diff --git a/doc/html/core/pm3argparse.html b/doc/html/core/pm3argparse.html new file mode 100644 index 0000000000000000000000000000000000000000..fab963bfc644a5ff418865940df66bbcf9153b8d --- /dev/null +++ b/doc/html/core/pm3argparse.html @@ -0,0 +1,274 @@ +<!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" + "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> + + +<html xmlns="http://www.w3.org/1999/xhtml"> + <head> + <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> + + <title>pm3argparse - Parsing Command Lines — ProMod3 0 documentation</title> + + <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> + <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> + + <script type="text/javascript"> + var DOCUMENTATION_OPTIONS = { + URL_ROOT: '../', + VERSION: '0', + COLLAPSE_INDEX: false, + FILE_SUFFIX: '.html', + HAS_SOURCE: true + }; + </script> + <script type="text/javascript" src="../_static/jquery.js"></script> + <script type="text/javascript" src="../_static/underscore.js"></script> + <script type="text/javascript" src="../_static/doctools.js"></script> + <link rel="top" title="ProMod3 0 documentation" href="../index.html" /> + <link rel="up" title="core - ProMod3 Core Functionality" href="index.html" /> + <link rel="next" title="helper - Shared Functionality For the Everything" href="helper.html" /> + <link rel="prev" title="core - ProMod3 Core Functionality" href="index.html" /> + + + <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9"> + + </head> + <body role="document"> + <div class="related" role="navigation" aria-label="related navigation"> + <h3>Navigation</h3> + <ul> + <li class="right" style="margin-right: 10px"> + <a href="../genindex.html" title="General Index" + accesskey="I">index</a></li> + <li class="right" > + <a href="../py-modindex.html" title="Python Module Index" + >modules</a> |</li> + <li class="right" > + <a href="helper.html" title="helper - Shared Functionality For the Everything" + accesskey="N">next</a> |</li> + <li class="right" > + <a href="index.html" title="core - ProMod3 Core Functionality" + accesskey="P">previous</a> |</li> + <li class="nav-item nav-item-0"><a href="../index.html">ProMod3 0 documentation</a> »</li> + <li class="nav-item nav-item-1"><a href="../developers.html" >Documentation For Developes</a> »</li> + <li class="nav-item nav-item-2"><a href="index.html" accesskey="U"><code class="docutils literal"><span class="pre">core</span></code> - ProMod3 Core Functionality</a> »</li> + </ul> + </div> + + <div class="document"> + <div class="documentwrapper"> + <div class="bodywrapper"> + <div class="body" role="main"> + + <div class="section" id="module-promod3.core.pm3argparse"> +<span id="pm3argparse-parsing-command-lines"></span><h1><a class="reference internal" href="#module-promod3.core.pm3argparse" title="promod3.core.pm3argparse"><code class="xref py py-mod docutils literal"><span class="pre">pm3argparse</span></code></a> - Parsing Command Lines<a class="headerlink" href="#module-promod3.core.pm3argparse" title="Permalink to this headline">¶</a></h1> +<div class="section" id="introduction"> +<h2>Introduction<a class="headerlink" href="#introduction" title="Permalink to this headline">¶</a></h2> +<p>A lot of the actions in ProMod3 have a bunch of command line parameters/ +arguments in common. For example we need an input alignment quite often and +usually for an alignment we need information on what is the target sequence, +what identifies a template sequence and eventually a hint on the format. That +means we need the same functionality on the command line in several actions. +There <a class="reference internal" href="#promod3.core.pm3argparse.PM3ArgumentParser" title="promod3.core.pm3argparse.PM3ArgumentParser"><code class="xref py py-class docutils literal"><span class="pre">PM3ArgumentParser</span></code></a> serves as a +simplification. It provides a set of standard arguments you just need to +activate for your action plus it comes with some verification functionality for +input.</p> +</div> +<div class="section" id="argument-parser"> +<h2>Argument Parser<a class="headerlink" href="#argument-parser" title="Permalink to this headline">¶</a></h2> +<dl class="class"> +<dt id="promod3.core.pm3argparse.PM3ArgumentParser"> +<em class="property">class </em><code class="descclassname">promod3.core.pm3argparse.</code><code class="descname">PM3ArgumentParser</code><span class="sig-paren">(</span><em>description</em>, <em>action=True</em><span class="sig-paren">)</span><a class="reference internal" href="../_modules/promod3/core/pm3argparse.html#PM3ArgumentParser"><span class="viewcode-link">[source]</span></a><a class="headerlink" href="#promod3.core.pm3argparse.PM3ArgumentParser" title="Permalink to this definition">¶</a></dt> +<dd><p>This class is a child of <a class="reference external" href="https://docs.python.org/2.7/library/argparse.html#argparse.ArgumentParser" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">argparse.ArgumentParser</span></code></a>. It provides a +set of standard arguments which can be activated, rather than added via the +traditional way. This helps keeping up a common naming scheme throughout +all ProMod3 actions. As a real extension, this subclass provides checking +of input parameters on <a class="reference internal" href="#promod3.core.pm3argparse.PM3ArgumentParser.Parse" title="promod3.core.pm3argparse.PM3ArgumentParser.Parse"><code class="xref py py-meth docutils literal"><span class="pre">Parse()</span></code></a>. Beside +this, everything you can do with a ‘real’ <a class="reference external" href="https://docs.python.org/2.7/library/argparse.html#argparse.ArgumentParser" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">ArgumentParser</span></code></a> +instance is possible here.</p> +<p>A note on exit codes: if <code class="xref py py-meth docutils literal"><span class="pre">Parse()</span></code> is +called on unrecognised arguments, the script exits with a code 2 by +<code class="xref py py-class docutils literal"><span class="pre">argparse.ArgumentParser.parse_args()</span></code>.</p> +<p>Attributes beyond <a class="reference external" href="https://docs.python.org/2.7/library/argparse.html#argparse.ArgumentParser" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">argparse.ArgumentParser</span></code></a>:</p> +<dl class="attribute"> +<dt id="promod3.core.pm3argparse.PM3ArgumentParser.action"> +<code class="descname">action</code><a class="headerlink" href="#promod3.core.pm3argparse.PM3ArgumentParser.action" title="Permalink to this definition">¶</a></dt> +<dd></dd></dl> + +<p>Indicates if the calling script is a ProMod3 action.</p> +<table class="docutils field-list" frame="void" rules="none"> +<col class="field-name" /> +<col class="field-body" /> +<tbody valign="top"> +<tr class="field-odd field"><th class="field-name">Type:</th><td class="field-body"><a class="reference external" href="https://docs.python.org/2.7/library/functions.html#bool" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">bool</span></code></a></td> +</tr> +</tbody> +</table> +<dl class="method"> +<dt id="promod3.core.pm3argparse.PM3ArgumentParser.__init__"> +<code class="descname">__init__</code><span class="sig-paren">(</span><em>description</em>, <em>action=True</em><span class="sig-paren">)</span><a class="reference internal" href="../_modules/promod3/core/pm3argparse.html#PM3ArgumentParser.__init__"><span class="viewcode-link">[source]</span></a><a class="headerlink" href="#promod3.core.pm3argparse.PM3ArgumentParser.__init__" title="Permalink to this definition">¶</a></dt> +<dd><p>Create a new instance of <code class="xref py py-class docutils literal"><span class="pre">PM3ArgumentParser</span></code>.</p> +<table class="docutils field-list" frame="void" rules="none"> +<col class="field-name" /> +<col class="field-body" /> +<tbody valign="top"> +<tr class="field-odd field"><th class="field-name">Parameters:</th><td class="field-body"><ul class="first simple"> +<li><strong>description</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#str" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">str</span></code></a>) – Help text for this script, handed down to +<a class="reference external" href="https://docs.python.org/2.7/library/argparse.html#description"><code class="xref py py-attr docutils literal"><span class="pre">description</span></code></a> of <a class="reference external" href="https://docs.python.org/2.7/library/argparse.html#argparse.ArgumentParser"><code class="xref py py-meth docutils literal"><span class="pre">argparse.ArgumentParser.__init__()</span></code></a>.</li> +<li><strong>action</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#bool" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">bool</span></code></a>) – Indicates if the calling script is a ProMod3 action. +This influences <a class="reference external" href="https://docs.python.org/2.7/library/argparse.html#prog"><code class="xref py py-attr docutils literal"><span class="pre">prog</span></code></a> of +<a class="reference external" href="https://docs.python.org/2.7/library/argparse.html#argparse.ArgumentParser" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">ArgumentParser</span></code></a> by clipping of the +first 3 characters of the file name of the script. If +<code class="docutils literal"><span class="pre">False</span></code>, default behaviour of +<a class="reference external" href="https://docs.python.org/2.7/library/argparse.html#argparse.ArgumentParser" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">ArgumentParser</span></code></a> kicks in.</li> +</ul> +</td> +</tr> +<tr class="field-even field"><th class="field-name">Returns:</th><td class="field-body"><p class="first last"><a class="reference external" href="https://docs.python.org/2.7/library/argparse.html#argparse.ArgumentParser" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">argparse.ArgumentParser</span></code></a>.</p> +</td> +</tr> +</tbody> +</table> +</dd></dl> + +<dl class="method"> +<dt id="promod3.core.pm3argparse.PM3ArgumentParser.AddAlignment"> +<code class="descname">AddAlignment</code><span class="sig-paren">(</span><span class="sig-paren">)</span><a class="reference internal" href="../_modules/promod3/core/pm3argparse.html#PM3ArgumentParser.AddAlignment"><span class="viewcode-link">[source]</span></a><a class="headerlink" href="#promod3.core.pm3argparse.PM3ArgumentParser.AddAlignment" title="Permalink to this definition">¶</a></dt> +<dd><p>Add everything needed to load alignments to the argument parser. Creates +several options/ arguments and adds some checks for post processing. +This method only adds a flag to the parser to add alignment options on +<a class="reference internal" href="#promod3.core.pm3argparse.PM3ArgumentParser.AssembleParser" title="promod3.core.pm3argparse.PM3ArgumentParser.AssembleParser"><code class="xref py py-meth docutils literal"><span class="pre">AssembleParser()</span></code></a>. Depending on which options you activate, things +need to be added in a different order or have other constraints.</p> +<p>Options/ arguments added:</p> +<ul class="simple"> +<li><code class="docutils literal"><span class="pre">--fasta</span> <span class="pre">trg:<NAME></span> <span class="pre"><FILE></span></code> - describing a target-template alignment +with <code class="docutils literal"><span class="pre">trg:</span></code> marking the target sequence inside <code class="file docutils literal"><span class="pre"><FILE></span></code></li> +</ul> +<p>Exit codes related to alignment input:</p> +<ul class="simple"> +<li>11 - no prefix <code class="docutils literal"><span class="pre">trg:</span></code> found for an argument to ‘–fasta’</li> +<li>12 - a given alignment file does not exist</li> +<li>13 - never raised (parameter for checking gzip files)</li> +<li>14 - empty target name found (<code class="docutils literal"><span class="pre">trg:</span></code>)</li> +<li>15 - found an empty alignment file</li> +<li>16 - alignment with more than 2 sequences found</li> +<li>17 - target sequence name not found in alignment</li> +<li>18 - sequences in the alignment have different length</li> +</ul> +<p>Attributes added to the namespace returned by +<a class="reference internal" href="#promod3.core.pm3argparse.PM3ArgumentParser.Parse" title="promod3.core.pm3argparse.PM3ArgumentParser.Parse"><code class="xref py py-meth docutils literal"><span class="pre">Parse()</span></code></a>:</p> +<ul> +<li><dl class="first docutils"> +<dt><code class="xref py py-attr docutils literal"><span class="pre">fasta</span></code> - filled with the input of the ‘–fasta’ argument, a</dt> +<dd><p class="first last"><a class="reference external" href="https://docs.python.org/2.7/library/functions.html#list" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">list</span></code></a> with multiple <a class="reference external" href="https://docs.python.org/2.7/library/functions.html#list" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">list</span></code></a> objects</p> +</dd> +</dl> +</li> +<li><dl class="first docutils"> +<dt><code class="xref py py-attr docutils literal"><span class="pre">alignments</span></code> - <code class="xref py py-class docutils literal"><span class="pre">ost.AlignmentList</span></code>, same order as</dt> +<dd><p class="first last"><code class="xref py py-attr docutils literal"><span class="pre">fasta</span></code></p> +</dd> +</dl> +</li> +<li><dl class="first docutils"> +<dt><code class="xref py py-attr docutils literal"><span class="pre">aln_sources</span></code> - the original source of the alignment, may be</dt> +<dd><p class="first last">filename(s) or a string in JSON format, +<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#list" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">list</span></code></a> of all sources</p> +</dd> +</dl> +</li> +</ul> +</dd></dl> + +<dl class="method"> +<dt id="promod3.core.pm3argparse.PM3ArgumentParser.AssembleParser"> +<code class="descname">AssembleParser</code><span class="sig-paren">(</span><span class="sig-paren">)</span><a class="reference internal" href="../_modules/promod3/core/pm3argparse.html#PM3ArgumentParser.AssembleParser"><span class="viewcode-link">[source]</span></a><a class="headerlink" href="#promod3.core.pm3argparse.PM3ArgumentParser.AssembleParser" title="Permalink to this definition">¶</a></dt> +<dd><p>When adding options via the <code class="xref py py-meth docutils literal"><span class="pre">Add*()</span></code> methods, call this after you +are done. Everything before just tells the parser that it should +contain those option sets but does not actually add anything. +<a class="reference internal" href="#promod3.core.pm3argparse.PM3ArgumentParser.AssembleParser" title="promod3.core.pm3argparse.PM3ArgumentParser.AssembleParser"><code class="xref py py-meth docutils literal"><span class="pre">AssembleParser()</span></code></a> will put everything in place, in the right order +and with the right constraints.</p> +</dd></dl> + +<dl class="method"> +<dt id="promod3.core.pm3argparse.PM3ArgumentParser.Parse"> +<code class="descname">Parse</code><span class="sig-paren">(</span><em>args=None</em><span class="sig-paren">)</span><a class="reference internal" href="../_modules/promod3/core/pm3argparse.html#PM3ArgumentParser.Parse"><span class="viewcode-link">[source]</span></a><a class="headerlink" href="#promod3.core.pm3argparse.PM3ArgumentParser.Parse" title="Permalink to this definition">¶</a></dt> +<dd><p>Parse an argument string.</p> +<table class="docutils field-list" frame="void" rules="none"> +<col class="field-name" /> +<col class="field-body" /> +<tbody valign="top"> +<tr class="field-odd field"><th class="field-name">Parameters:</th><td class="field-body"><strong>args</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#list" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">list</span></code></a>) – The argument string. As default <a class="reference external" href="https://docs.python.org/2.7/library/sys.html#sys.argv"><code class="xref py py-attr docutils literal"><span class="pre">sys.argv</span></code></a> is used.</td> +</tr> +<tr class="field-even field"><th class="field-name">Returns:</th><td class="field-body"><code class="xref py py-class docutils literal"><span class="pre">promod3.cor.pm3argparse.PM3OptionsNamespace</span></code>.</td> +</tr> +</tbody> +</table> +</dd></dl> + +</dd></dl> + +</div> +</div> + + + </div> + </div> + </div> + <div class="sphinxsidebar" role="navigation" aria-label="main navigation"> + <div class="sphinxsidebarwrapper"> + <h3><a href="../index.html">Table Of Contents</a></h3> + <ul> +<li><a class="reference internal" href="#"><code class="docutils literal"><span class="pre">pm3argparse</span></code> - Parsing Command Lines</a><ul> +<li><a class="reference internal" href="#introduction">Introduction</a></li> +<li><a class="reference internal" href="#argument-parser">Argument Parser</a></li> +</ul> +</li> +</ul> + + <h4>Previous topic</h4> + <p class="topless"><a href="index.html" + title="previous chapter"><code class="docutils literal"><span class="pre">core</span></code> - ProMod3 Core Functionality</a></p> + <h4>Next topic</h4> + <p class="topless"><a href="helper.html" + title="next chapter"><code class="docutils literal"><span class="pre">helper</span></code> - Shared Functionality For the Everything</a></p> + <div role="note" aria-label="source link"> + <h3>This Page</h3> + <ul class="this-page-menu"> + <li><a href="../_sources/core/pm3argparse.txt" + rel="nofollow">Show Source</a></li> + </ul> + </div> +<div id="searchbox" style="display: none" role="search"> + <h3>Quick search</h3> + <form class="search" action="../search.html" method="get"> + <input type="text" name="q" /> + <input type="submit" value="Go" /> + <input type="hidden" name="check_keywords" value="yes" /> + <input type="hidden" name="area" value="default" /> + </form> + <p class="searchtip" style="font-size: 90%"> + Enter search terms or a module, class or function name. + </p> +</div> +<script type="text/javascript">$('#searchbox').show(0);</script> + </div> + </div> + <div class="clearer"></div> + </div> + <div class="footer"> + ©2015, Bienchen. + + | + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.3</a> + + | + <a href="../_sources/core/pm3argparse.txt" + rel="nofollow">Page source</a></li> + </div> + + + + + </body> +</html> \ No newline at end of file diff --git a/doc/html/core/setcompoundschemlib.html b/doc/html/core/setcompoundschemlib.html index 715c8be33ab2a412a89d435881994236d604d6b2..d80077365c77731ef1efd4b99da149fc20e10773 100644 --- a/doc/html/core/setcompoundschemlib.html +++ b/doc/html/core/setcompoundschemlib.html @@ -8,7 +8,7 @@ <title>SetCompoundsChemlib() — ProMod3 0 documentation</title> - <link rel="stylesheet" href="../_static/default.css" type="text/css" /> + <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> <script type="text/javascript"> @@ -26,10 +26,14 @@ <link rel="top" title="ProMod3 0 documentation" href="../index.html" /> <link rel="up" title="Documentation For Developes" href="../developers.html" /> <link rel="next" title="core - ProMod3 Core Functionality" href="index.html" /> - <link rel="prev" title="Documentation For Developes" href="../developers.html" /> + <link rel="prev" title="Documentation For Developes" href="../developers.html" /> + + + <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9"> + </head> - <body> - <div class="related"> + <body role="document"> + <div class="related" role="navigation" aria-label="related navigation"> <h3>Navigation</h3> <ul> <li class="right" style="margin-right: 10px"> @@ -44,18 +48,18 @@ <li class="right" > <a href="../developers.html" title="Documentation For Developes" accesskey="P">previous</a> |</li> - <li><a href="../index.html">ProMod3 0 documentation</a> »</li> - <li><a href="../developers.html" accesskey="U">Documentation For Developes</a> »</li> + <li class="nav-item nav-item-0"><a href="../index.html">ProMod3 0 documentation</a> »</li> + <li class="nav-item nav-item-1"><a href="../developers.html" accesskey="U">Documentation For Developes</a> »</li> </ul> </div> <div class="document"> <div class="documentwrapper"> <div class="bodywrapper"> - <div class="body"> + <div class="body" role="main"> <div class="section" id="setcompoundschemlib"> -<h1><a class="reference internal" href="#promod3.SetCompoundsChemlib" title="promod3.SetCompoundsChemlib"><tt class="xref py py-func docutils literal"><span class="pre">SetCompoundsChemlib()</span></tt></a><a class="headerlink" href="#setcompoundschemlib" title="Permalink to this headline">¶</a></h1> +<h1><a class="reference internal" href="#promod3.SetCompoundsChemlib" title="promod3.SetCompoundsChemlib"><code class="xref py py-func docutils literal"><span class="pre">SetCompoundsChemlib()</span></code></a><a class="headerlink" href="#setcompoundschemlib" title="Permalink to this headline">¶</a></h1> <p>This is the one function defined on the highest level of ProMod3‘s module hierarchy. It is used to load an OST compound library to avoid running Python code via the ancient OST wrapper. Applying this function at @@ -65,14 +69,14 @@ need to call this function, only if you want to load a different chemical components dictionary.</p> <dl class="function"> <dt id="promod3.SetCompoundsChemlib"> -<tt class="descclassname">promod3.</tt><tt class="descname">SetCompoundsChemlib</tt><big>(</big><em>path_to_chemlib</em><big>)</big><a class="reference internal" href="../_modules/promod3.html#SetCompoundsChemlib"><span class="viewcode-link">[source]</span></a><a class="headerlink" href="#promod3.SetCompoundsChemlib" title="Permalink to this definition">¶</a></dt> +<code class="descclassname">promod3.</code><code class="descname">SetCompoundsChemlib</code><span class="sig-paren">(</span><em>path_to_chemlib</em><span class="sig-paren">)</span><a class="reference internal" href="../_modules/promod3.html#SetCompoundsChemlib"><span class="viewcode-link">[source]</span></a><a class="headerlink" href="#promod3.SetCompoundsChemlib" title="Permalink to this definition">¶</a></dt> <dd><p>Load a compounds library. Does not return anything, the library is just enabled globally.</p> <table class="docutils field-list" frame="void" rules="none"> <col class="field-name" /> <col class="field-body" /> <tbody valign="top"> -<tr class="field-odd field"><th class="field-name">Parameters:</th><td class="field-body"><strong>path_to_chemlib</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#str" title="(in Python v2.7)"><tt class="xref py py-class docutils literal"><span class="pre">str</span></tt></a>) – Points to the file to be loaded.</td> +<tr class="field-odd field"><th class="field-name">Parameters:</th><td class="field-body"><strong>path_to_chemlib</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#str" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">str</span></code></a>) – Points to the file to be loaded.</td> </tr> </tbody> </table> @@ -84,20 +88,22 @@ enabled globally.</p> </div> </div> </div> - <div class="sphinxsidebar"> + <div class="sphinxsidebar" role="navigation" aria-label="main navigation"> <div class="sphinxsidebarwrapper"> <h4>Previous topic</h4> <p class="topless"><a href="../developers.html" title="previous chapter">Documentation For Developes</a></p> <h4>Next topic</h4> <p class="topless"><a href="index.html" - title="next chapter"><tt class="docutils literal"><span class="pre">core</span></tt> - ProMod3 Core Functionality</a></p> - <h3>This Page</h3> - <ul class="this-page-menu"> - <li><a href="../_sources/core/setcompoundschemlib.txt" - rel="nofollow">Show Source</a></li> - </ul> -<div id="searchbox" style="display: none"> + title="next chapter"><code class="docutils literal"><span class="pre">core</span></code> - ProMod3 Core Functionality</a></p> + <div role="note" aria-label="source link"> + <h3>This Page</h3> + <ul class="this-page-menu"> + <li><a href="../_sources/core/setcompoundschemlib.txt" + rel="nofollow">Show Source</a></li> + </ul> + </div> +<div id="searchbox" style="display: none" role="search"> <h3>Quick search</h3> <form class="search" action="../search.html" method="get"> <input type="text" name="q" /> @@ -114,29 +120,20 @@ enabled globally.</p> </div> <div class="clearer"></div> </div> - <div class="related"> - <h3>Navigation</h3> - <ul> - <li class="right" style="margin-right: 10px"> - <a href="../genindex.html" title="General Index" - >index</a></li> - <li class="right" > - <a href="../py-modindex.html" title="Python Module Index" - >modules</a> |</li> - <li class="right" > - <a href="index.html" title="core - ProMod3 Core Functionality" - >next</a> |</li> - <li class="right" > - <a href="../developers.html" title="Documentation For Developes" - >previous</a> |</li> - <li><a href="../index.html">ProMod3 0 documentation</a> »</li> - <li><a href="../developers.html" >Documentation For Developes</a> »</li> - </ul> - </div> <div class="footer"> - © Copyright 2014, Bienchen. - Last updated on Mar 23 14:52, 2015. - Created using <a href="http://sphinx-doc.org/">Sphinx</a> 1.2.3. + ©2015, Bienchen. + + | + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.3</a> + + | + <a href="../_sources/core/setcompoundschemlib.txt" + rel="nofollow">Page source</a></li> </div> + + + + </body> </html> \ No newline at end of file diff --git a/doc/html/developers.html b/doc/html/developers.html index 1aec1d8c3b439eef0453d2c71cc6d8921b408488..bffc7cd96b0898f4af66076ee2f949ee1b7d857f 100644 --- a/doc/html/developers.html +++ b/doc/html/developers.html @@ -8,7 +8,7 @@ <title>Documentation For Developes — ProMod3 0 documentation</title> - <link rel="stylesheet" href="_static/default.css" type="text/css" /> + <link rel="stylesheet" href="_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="_static/pygments.css" type="text/css" /> <script type="text/javascript"> @@ -25,10 +25,14 @@ <script type="text/javascript" src="_static/doctools.js"></script> <link rel="top" title="ProMod3 0 documentation" href="index.html" /> <link rel="next" title="SetCompoundsChemlib()" href="core/setcompoundschemlib.html" /> - <link rel="prev" title="Documentation For Users" href="users.html" /> + <link rel="prev" title="Documentation For Users" href="users.html" /> + + + <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9"> + </head> - <body> - <div class="related"> + <body role="document"> + <div class="related" role="navigation" aria-label="related navigation"> <h3>Navigation</h3> <ul> <li class="right" style="margin-right: 10px"> @@ -43,30 +47,35 @@ <li class="right" > <a href="users.html" title="Documentation For Users" accesskey="P">previous</a> |</li> - <li><a href="index.html">ProMod3 0 documentation</a> »</li> + <li class="nav-item nav-item-0"><a href="index.html">ProMod3 0 documentation</a> »</li> </ul> </div> <div class="document"> <div class="documentwrapper"> <div class="bodywrapper"> - <div class="body"> + <div class="body" role="main"> <div class="section" id="documentation-for-developes"> <h1>Documentation For Developes<a class="headerlink" href="#documentation-for-developes" title="Permalink to this headline">¶</a></h1> <p>Contents:</p> <div class="toctree-wrapper compound"> <ul> -<li class="toctree-l1"><a class="reference internal" href="core/setcompoundschemlib.html"><tt class="docutils literal"><span class="pre">SetCompoundsChemlib()</span></tt></a></li> -<li class="toctree-l1"><a class="reference internal" href="core/index.html"><tt class="docutils literal"><span class="pre">core</span></tt> - ProMod3 Core Functionality</a><ul> -<li class="toctree-l2"><a class="reference internal" href="core/argcheck.html"><tt class="docutils literal"><span class="pre">argcheck</span></tt> - Standard Tests For Command Line Arguments</a></li> -<li class="toctree-l2"><a class="reference internal" href="core/helper.html"><tt class="docutils literal"><span class="pre">helper</span></tt> - Shared Functionality For the Everything</a></li> +<li class="toctree-l1"><a class="reference internal" href="core/setcompoundschemlib.html"><code class="docutils literal"><span class="pre">SetCompoundsChemlib()</span></code></a></li> +<li class="toctree-l1"><a class="reference internal" href="core/index.html"><code class="docutils literal"><span class="pre">core</span></code> - ProMod3 Core Functionality</a><ul> +<li class="toctree-l2"><a class="reference internal" href="core/pm3argparse.html"><code class="docutils literal"><span class="pre">pm3argparse</span></code> - Parsing Command Lines</a></li> +<li class="toctree-l2"><a class="reference internal" href="core/helper.html"><code class="docutils literal"><span class="pre">helper</span></code> - Shared Functionality For the Everything</a></li> </ul> </li> -<li class="toctree-l1"><a class="reference internal" href="rawmodel/index.html"><tt class="docutils literal"><span class="pre">rawmodel</span></tt> - Coordinate Modeling</a><ul> +<li class="toctree-l1"><a class="reference internal" href="rawmodel/index.html"><code class="docutils literal"><span class="pre">rawmodel</span></code> - Coordinate Modeling</a><ul> <li class="toctree-l2"><a class="reference internal" href="rawmodel/index.html#raw-coordinate-modeling-api">Raw Coordinate Modeling API</a></li> </ul> </li> +<li class="toctree-l1"><a class="reference internal" href="actions/index_dev.html"><code class="docutils literal"><span class="pre">test_actions.ActionTestCase</span></code> - Testing Actions</a><ul> +<li class="toctree-l2"><a class="reference internal" href="actions/index_dev.html#creating-an-action-unit-test-script">Creating an Action Unit Test Script</a></li> +<li class="toctree-l2"><a class="reference internal" href="actions/index_dev.html#unit-test-actions-api">Unit Test Actions API</a></li> +</ul> +</li> <li class="toctree-l1"><a class="reference internal" href="buildsystem.html">Building ProMod3</a><ul> <li class="toctree-l2"><a class="reference internal" href="buildsystem.html#dependencies">Dependencies</a></li> <li class="toctree-l2"><a class="reference internal" href="buildsystem.html#using-cmake">Using CMake</a></li> @@ -77,10 +86,11 @@ <li class="toctree-l2"><a class="reference internal" href="contributing.html#git-hooks">Git Hooks</a></li> <li class="toctree-l2"><a class="reference internal" href="contributing.html#directory-structure">Directory Structure</a></li> <li class="toctree-l2"><a class="reference internal" href="contributing.html#cmake">CMake</a></li> -<li class="toctree-l2"><a class="reference internal" href="contributing.html#the-stage-directory">The <tt class="file docutils literal"><span class="pre">stage</span></tt> Directory</a></li> +<li class="toctree-l2"><a class="reference internal" href="contributing.html#the-stage-directory">The <code class="file docutils literal"><span class="pre">stage</span></code> Directory</a></li> <li class="toctree-l2"><a class="reference internal" href="contributing.html#unit-tests">Unit Tests</a></li> <li class="toctree-l2"><a class="reference internal" href="contributing.html#writing-documentation">Writing Documentation</a></li> <li class="toctree-l2"><a class="reference internal" href="contributing.html#how-to-start-your-own-module">How To Start Your Own Module</a></li> +<li class="toctree-l2"><a class="reference internal" href="contributing.html#how-to-start-your-own-action">How To Start Your Own Action</a></li> <li class="toctree-l2"><a class="reference internal" href="contributing.html#third-party-contributions-license-issues">Third Party Contributions (License Issues)</a></li> </ul> </li> @@ -97,20 +107,22 @@ </div> </div> </div> - <div class="sphinxsidebar"> + <div class="sphinxsidebar" role="navigation" aria-label="main navigation"> <div class="sphinxsidebarwrapper"> <h4>Previous topic</h4> <p class="topless"><a href="users.html" title="previous chapter">Documentation For Users</a></p> <h4>Next topic</h4> <p class="topless"><a href="core/setcompoundschemlib.html" - title="next chapter"><tt class="docutils literal"><span class="pre">SetCompoundsChemlib()</span></tt></a></p> - <h3>This Page</h3> - <ul class="this-page-menu"> - <li><a href="_sources/developers.txt" - rel="nofollow">Show Source</a></li> - </ul> -<div id="searchbox" style="display: none"> + title="next chapter"><code class="docutils literal"><span class="pre">SetCompoundsChemlib()</span></code></a></p> + <div role="note" aria-label="source link"> + <h3>This Page</h3> + <ul class="this-page-menu"> + <li><a href="_sources/developers.txt" + rel="nofollow">Show Source</a></li> + </ul> + </div> +<div id="searchbox" style="display: none" role="search"> <h3>Quick search</h3> <form class="search" action="search.html" method="get"> <input type="text" name="q" /> @@ -127,28 +139,20 @@ </div> <div class="clearer"></div> </div> - <div class="related"> - <h3>Navigation</h3> - <ul> - <li class="right" style="margin-right: 10px"> - <a href="genindex.html" title="General Index" - >index</a></li> - <li class="right" > - <a href="py-modindex.html" title="Python Module Index" - >modules</a> |</li> - <li class="right" > - <a href="core/setcompoundschemlib.html" title="SetCompoundsChemlib()" - >next</a> |</li> - <li class="right" > - <a href="users.html" title="Documentation For Users" - >previous</a> |</li> - <li><a href="index.html">ProMod3 0 documentation</a> »</li> - </ul> - </div> <div class="footer"> - © Copyright 2014, Bienchen. - Last updated on Mar 24 17:42, 2015. - Created using <a href="http://sphinx-doc.org/">Sphinx</a> 1.2.3. + ©2015, Bienchen. + + | + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.3</a> + + | + <a href="_sources/developers.txt" + rel="nofollow">Page source</a></li> </div> + + + + </body> </html> \ No newline at end of file diff --git a/doc/html/genindex.html b/doc/html/genindex.html index c3593cc12c1415302b71c66b6b732f42ad63484e..d53636a956ff9a11027dfb087325003083d64b85 100644 --- a/doc/html/genindex.html +++ b/doc/html/genindex.html @@ -9,7 +9,7 @@ <title>Index — ProMod3 0 documentation</title> - <link rel="stylesheet" href="_static/default.css" type="text/css" /> + <link rel="stylesheet" href="_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="_static/pygments.css" type="text/css" /> <script type="text/javascript"> @@ -24,10 +24,14 @@ <script type="text/javascript" src="_static/jquery.js"></script> <script type="text/javascript" src="_static/underscore.js"></script> <script type="text/javascript" src="_static/doctools.js"></script> - <link rel="top" title="ProMod3 0 documentation" href="index.html" /> + <link rel="top" title="ProMod3 0 documentation" href="index.html" /> + + + <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9"> + </head> - <body> - <div class="related"> + <body role="document"> + <div class="related" role="navigation" aria-label="related navigation"> <h3>Navigation</h3> <ul> <li class="right" style="margin-right: 10px"> @@ -36,20 +40,22 @@ <li class="right" > <a href="py-modindex.html" title="Python Module Index" >modules</a> |</li> - <li><a href="index.html">ProMod3 0 documentation</a> »</li> + <li class="nav-item nav-item-0"><a href="index.html">ProMod3 0 documentation</a> »</li> </ul> </div> <div class="document"> <div class="documentwrapper"> <div class="bodywrapper"> - <div class="body"> + <div class="body" role="main"> <h1 id="index">Index</h1> <div class="genindex-jumpbox"> - <a href="#B"><strong>B</strong></a> + <a href="#_"><strong>_</strong></a> + | <a href="#A"><strong>A</strong></a> + | <a href="#B"><strong>B</strong></a> | <a href="#C"><strong>C</strong></a> | <a href="#F"><strong>F</strong></a> | <a href="#G"><strong>G</strong></a> @@ -57,8 +63,65 @@ | <a href="#P"><strong>P</strong></a> | <a href="#R"><strong>R</strong></a> | <a href="#S"><strong>S</strong></a> + | <a href="#T"><strong>T</strong></a> </div> +<h2 id="_">_</h2> +<table style="width: 100%" class="indextable genindextable"><tr> + <td style="width: 33%" valign="top"><dl> + + <dt><a href="core/pm3argparse.html#promod3.core.pm3argparse.PM3ArgumentParser.__init__">__init__() (promod3.core.pm3argparse.PM3ArgumentParser method)</a> + </dt> + + </dl></td> +</tr></table> + +<h2 id="A">A</h2> +<table style="width: 100%" class="indextable genindextable"><tr> + <td style="width: 33%" valign="top"><dl> + + <dt><a href="core/pm3argparse.html#promod3.core.pm3argparse.PM3ArgumentParser.action">action (promod3.core.pm3argparse.PM3ArgumentParser attribute)</a> + </dt> + + + <dt><a href="actions/index_dev.html#test_actions.ActionTestCase">ActionTestCase (class in test_actions)</a> + </dt> + + + <dt> + add_doc_dependency + </dt> + + <dd><dl> + + <dt><a href="cmake/index.html#command:add_doc_dependency"><strong>command</strong></a> + </dt> + + </dl></dd> + </dl></td> + <td style="width: 33%" valign="top"><dl> + + <dt> + add_doc_source + </dt> + + <dd><dl> + + <dt><a href="cmake/index.html#index-0-command:add_doc_source">command</a>, <a href="cmake/index.html#index-1-command:add_doc_source">[1]</a>, <a href="cmake/index.html#command:add_doc_source"><strong>[2]</strong></a> + </dt> + + </dl></dd> + + <dt><a href="core/pm3argparse.html#promod3.core.pm3argparse.PM3ArgumentParser.AddAlignment">AddAlignment() (promod3.core.pm3argparse.PM3ArgumentParser method)</a> + </dt> + + + <dt><a href="core/pm3argparse.html#promod3.core.pm3argparse.PM3ArgumentParser.AssembleParser">AssembleParser() (promod3.core.pm3argparse.PM3ArgumentParser method)</a> + </dt> + + </dl></td> +</tr></table> + <h2 id="B">B</h2> <table style="width: 100%" class="indextable genindextable"><tr> <td style="width: 33%" valign="top"><dl> @@ -79,11 +142,19 @@ <dd><dl> - <dt><a href="cmake/index.html#command:pm_action"><strong>pm_action</strong></a> + <dt><a href="cmake/index.html#command:add_doc_dependency"><strong>add_doc_dependency</strong></a> </dt> - <dt><a href="cmake/index.html#command:promod3_unittest"><strong>promod3_unittest</strong></a>, <a href="cmake/index.html#index-0-command:promod3_unittest">[1]</a>, <a href="cmake/index.html#index-1-command:promod3_unittest">[2]</a> + <dt><a href="cmake/index.html#index-0-command:add_doc_source">add_doc_source</a>, <a href="cmake/index.html#index-1-command:add_doc_source">[1]</a>, <a href="cmake/index.html#command:add_doc_source"><strong>[2]</strong></a> + </dt> + + + <dt><a href="contributing.html#index-0-command:pm_action">pm_action</a>, <a href="cmake/index.html#command:pm_action"><strong>[1]</strong></a> + </dt> + + + <dt><a href="cmake/index.html#index-0-command:promod3_unittest">promod3_unittest</a>, <a href="cmake/index.html#index-1-command:promod3_unittest">[1]</a>, <a href="cmake/index.html#command:promod3_unittest"><strong>[2]</strong></a> </dt> </dl></dd> @@ -94,13 +165,17 @@ <table style="width: 100%" class="indextable genindextable"><tr> <td style="width: 33%" valign="top"><dl> - <dt><a href="core/argcheck.html#promod3.core.argcheck.FileExists">FileExists() (in module promod3.core.argcheck)</a> + <dt><a href="core/helper.html#promod3.core.helper.FileExists">FileExists() (in module promod3.core.helper)</a> + </dt> + + + <dt><a href="core/helper.html#promod3.core.helper.FileExtension">FileExtension() (in module promod3.core.helper)</a> </dt> </dl></td> <td style="width: 33%" valign="top"><dl> - <dt><a href="core/argcheck.html#promod3.core.argcheck.FileExtension">FileExtension() (in module promod3.core.argcheck)</a> + <dt><a href="core/helper.html#promod3.core.helper.FileGzip">FileGzip() (in module promod3.core.helper)</a> </dt> </dl></td> @@ -160,23 +235,43 @@ <table style="width: 100%" class="indextable genindextable"><tr> <td style="width: 33%" valign="top"><dl> + <dt><a href="core/pm3argparse.html#promod3.core.pm3argparse.PM3ArgumentParser.Parse">Parse() (promod3.core.pm3argparse.PM3ArgumentParser method)</a> + </dt> + + + <dt><a href="core/pm3argparse.html#promod3.core.pm3argparse.PM3ArgumentParser">PM3ArgumentParser (class in promod3.core.pm3argparse)</a> + </dt> + + <dt> pm_action </dt> <dd><dl> - <dt><a href="cmake/index.html#command:pm_action"><strong>command</strong></a> + <dt><a href="contributing.html#index-0-command:pm_action">command</a>, <a href="cmake/index.html#command:pm_action"><strong>[1]</strong></a> </dt> </dl></dd> - <dt><a href="core/index.html#module-promod3.core">promod3.core (module)</a> + <dt><a href="actions/index_dev.html#test_actions.ActionTestCase.pm_action">pm_action (test_actions.ActionTestCase attribute)</a> + </dt> + + + <dt><a href="actions/index_dev.html#test_actions.ActionTestCase.pm_bin">pm_bin (test_actions.ActionTestCase attribute)</a> </dt> </dl></td> <td style="width: 33%" valign="top"><dl> + <dt><a href="core/index.html#module-promod3.core">promod3.core (module)</a> + </dt> + + + <dt><a href="core/pm3argparse.html#module-promod3.core.pm3argparse">promod3.core.pm3argparse (module)</a> + </dt> + + <dt><a href="rawmodel/index.html#module-promod3.rawmodel">promod3.rawmodel (module)</a> </dt> @@ -187,7 +282,7 @@ <dd><dl> - <dt><a href="cmake/index.html#command:promod3_unittest"><strong>command</strong></a>, <a href="cmake/index.html#index-0-command:promod3_unittest">[1]</a>, <a href="cmake/index.html#index-1-command:promod3_unittest">[2]</a> + <dt><a href="cmake/index.html#index-0-command:promod3_unittest">command</a>, <a href="cmake/index.html#index-1-command:promod3_unittest">[1]</a>, <a href="cmake/index.html#command:promod3_unittest"><strong>[2]</strong></a> </dt> </dl></dd> @@ -201,6 +296,16 @@ <dt><a href="rawmodel/index.html#promod3.rawmodel.RawModelingResult">RawModelingResult (class in promod3.rawmodel)</a> </dt> + + <dt><a href="actions/index_dev.html#test_actions.ActionTestCase.RunAction">RunAction() (test_actions.ActionTestCase method)</a> + </dt> + + </dl></td> + <td style="width: 33%" valign="top"><dl> + + <dt><a href="actions/index_dev.html#test_actions.ActionTestCase.RunExitStatusTest">RunExitStatusTest() (test_actions.ActionTestCase method)</a> + </dt> + </dl></td> </tr></table> @@ -211,6 +316,22 @@ <dt><a href="core/setcompoundschemlib.html#promod3.SetCompoundsChemlib">SetCompoundsChemlib() (in module promod3)</a> </dt> + </dl></td> +</tr></table> + +<h2 id="T">T</h2> +<table style="width: 100%" class="indextable genindextable"><tr> + <td style="width: 33%" valign="top"><dl> + + <dt><a href="actions/index_dev.html#module-test_actions">test_actions (module)</a> + </dt> + + </dl></td> + <td style="width: 33%" valign="top"><dl> + + <dt><a href="actions/index_dev.html#test_actions.ActionTestCase.testPMExists">testPMExists() (test_actions.ActionTestCase method)</a> + </dt> + </dl></td> </tr></table> @@ -219,12 +340,12 @@ </div> </div> </div> - <div class="sphinxsidebar"> + <div class="sphinxsidebar" role="navigation" aria-label="main navigation"> <div class="sphinxsidebarwrapper"> -<div id="searchbox" style="display: none"> +<div id="searchbox" style="display: none" role="search"> <h3>Quick search</h3> <form class="search" action="search.html" method="get"> <input type="text" name="q" /> @@ -241,22 +362,17 @@ </div> <div class="clearer"></div> </div> - <div class="related"> - <h3>Navigation</h3> - <ul> - <li class="right" style="margin-right: 10px"> - <a href="#" title="General Index" - >index</a></li> - <li class="right" > - <a href="py-modindex.html" title="Python Module Index" - >modules</a> |</li> - <li><a href="index.html">ProMod3 0 documentation</a> »</li> - </ul> - </div> <div class="footer"> - © Copyright 2014, Bienchen. - Last updated on Mar 24 17:42, 2015. - Created using <a href="http://sphinx-doc.org/">Sphinx</a> 1.2.3. + ©2015, Bienchen. + + | + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.3</a> + </div> + + + + </body> </html> \ No newline at end of file diff --git a/doc/html/index.html b/doc/html/index.html index 91c6b3ef51e2b8f21725a79b8fc1ce2a11b93422..48254575ac08fe6e1f353ffcd173283460e8b4fe 100644 --- a/doc/html/index.html +++ b/doc/html/index.html @@ -8,7 +8,7 @@ <title>Welcome To ProMod3’s Documentation! — ProMod3 0 documentation</title> - <link rel="stylesheet" href="_static/default.css" type="text/css" /> + <link rel="stylesheet" href="_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="_static/pygments.css" type="text/css" /> <script type="text/javascript"> @@ -24,10 +24,14 @@ <script type="text/javascript" src="_static/underscore.js"></script> <script type="text/javascript" src="_static/doctools.js"></script> <link rel="top" title="ProMod3 0 documentation" href="#" /> - <link rel="next" title="Documentation For Users" href="users.html" /> + <link rel="next" title="Documentation For Users" href="users.html" /> + + + <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9"> + </head> - <body> - <div class="related"> + <body role="document"> + <div class="related" role="navigation" aria-label="related navigation"> <h3>Navigation</h3> <ul> <li class="right" style="margin-right: 10px"> @@ -39,14 +43,14 @@ <li class="right" > <a href="users.html" title="Documentation For Users" accesskey="N">next</a> |</li> - <li><a href="#">ProMod3 0 documentation</a> »</li> + <li class="nav-item nav-item-0"><a href="#">ProMod3 0 documentation</a> »</li> </ul> </div> <div class="document"> <div class="documentwrapper"> <div class="bodywrapper"> - <div class="body"> + <div class="body" role="main"> <div class="section" id="welcome-to-promod3-s-documentation"> <h1>Welcome To ProMod3’s Documentation!<a class="headerlink" href="#welcome-to-promod3-s-documentation" title="Permalink to this headline">¶</a></h1> @@ -55,9 +59,10 @@ <ul> <li class="toctree-l1"><a class="reference internal" href="users.html">Users</a></li> <li class="toctree-l1"><a class="reference internal" href="developers.html">Developers</a><ul> -<li class="toctree-l2"><a class="reference internal" href="core/setcompoundschemlib.html"><tt class="docutils literal"><span class="pre">SetCompoundsChemlib()</span></tt></a></li> -<li class="toctree-l2"><a class="reference internal" href="core/index.html"><tt class="docutils literal"><span class="pre">core</span></tt> - ProMod3 Core Functionality</a></li> -<li class="toctree-l2"><a class="reference internal" href="rawmodel/index.html"><tt class="docutils literal"><span class="pre">rawmodel</span></tt> - Coordinate Modeling</a></li> +<li class="toctree-l2"><a class="reference internal" href="core/setcompoundschemlib.html"><code class="docutils literal"><span class="pre">SetCompoundsChemlib()</span></code></a></li> +<li class="toctree-l2"><a class="reference internal" href="core/index.html"><code class="docutils literal"><span class="pre">core</span></code> - ProMod3 Core Functionality</a></li> +<li class="toctree-l2"><a class="reference internal" href="rawmodel/index.html"><code class="docutils literal"><span class="pre">rawmodel</span></code> - Coordinate Modeling</a></li> +<li class="toctree-l2"><a class="reference internal" href="actions/index_dev.html"><code class="docutils literal"><span class="pre">test_actions.ActionTestCase</span></code> - Testing Actions</a></li> <li class="toctree-l2"><a class="reference internal" href="buildsystem.html">Building ProMod3</a></li> <li class="toctree-l2"><a class="reference internal" href="contributing.html">Contributing</a></li> <li class="toctree-l2"><a class="reference internal" href="cmake/index.html">ProMod3‘s Share Of CMake</a></li> @@ -66,6 +71,7 @@ <li class="toctree-l1"><a class="reference internal" href="changelog.html">Changelog</a><ul> <li class="toctree-l2"><a class="reference internal" href="changelog.html#changes-in-release-0-1">Changes in Release 0.1</a></li> <li class="toctree-l2"><a class="reference internal" href="changelog.html#changes-in-release-0-2">Changes in Release 0.2</a></li> +<li class="toctree-l2"><a class="reference internal" href="changelog.html#changes-in-release-0-3-to-be-released">Changes in Release 0.3 (to be released)</a></li> </ul> </li> </ul> @@ -74,9 +80,9 @@ <div class="section" id="indices-and-tables"> <h1>Indices And Tables<a class="headerlink" href="#indices-and-tables" title="Permalink to this headline">¶</a></h1> <ul class="simple"> -<li><a class="reference internal" href="genindex.html"><em>Index</em></a></li> -<li><a class="reference internal" href="py-modindex.html"><em>Module Index</em></a></li> -<li><a class="reference internal" href="search.html"><em>Search Page</em></a></li> +<li><a class="reference internal" href="genindex.html"><span>Index</span></a></li> +<li><a class="reference internal" href="py-modindex.html"><span>Module Index</span></a></li> +<li><a class="reference internal" href="search.html"><span>Search Page</span></a></li> </ul> </div> @@ -84,7 +90,7 @@ </div> </div> </div> - <div class="sphinxsidebar"> + <div class="sphinxsidebar" role="navigation" aria-label="main navigation"> <div class="sphinxsidebarwrapper"> <h3><a href="#">Table Of Contents</a></h3> <ul> @@ -95,12 +101,14 @@ <h4>Next topic</h4> <p class="topless"><a href="users.html" title="next chapter">Documentation For Users</a></p> - <h3>This Page</h3> - <ul class="this-page-menu"> - <li><a href="_sources/index.txt" - rel="nofollow">Show Source</a></li> - </ul> -<div id="searchbox" style="display: none"> + <div role="note" aria-label="source link"> + <h3>This Page</h3> + <ul class="this-page-menu"> + <li><a href="_sources/index.txt" + rel="nofollow">Show Source</a></li> + </ul> + </div> +<div id="searchbox" style="display: none" role="search"> <h3>Quick search</h3> <form class="search" action="search.html" method="get"> <input type="text" name="q" /> @@ -117,25 +125,20 @@ </div> <div class="clearer"></div> </div> - <div class="related"> - <h3>Navigation</h3> - <ul> - <li class="right" style="margin-right: 10px"> - <a href="genindex.html" title="General Index" - >index</a></li> - <li class="right" > - <a href="py-modindex.html" title="Python Module Index" - >modules</a> |</li> - <li class="right" > - <a href="users.html" title="Documentation For Users" - >next</a> |</li> - <li><a href="#">ProMod3 0 documentation</a> »</li> - </ul> - </div> <div class="footer"> - © Copyright 2014, Bienchen. - Last updated on Mar 24 17:42, 2015. - Created using <a href="http://sphinx-doc.org/">Sphinx</a> 1.2.3. + ©2015, Bienchen. + + | + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.3</a> + + | + <a href="_sources/index.txt" + rel="nofollow">Page source</a></li> </div> + + + + </body> </html> \ No newline at end of file diff --git a/doc/html/py-modindex.html b/doc/html/py-modindex.html index 18411ab9ebf68f71ce61960ad6dac6c252fb32b9..f26f8cbf378161ed28c95d408117245fe4973c9b 100644 --- a/doc/html/py-modindex.html +++ b/doc/html/py-modindex.html @@ -8,7 +8,7 @@ <title>Python Module Index — ProMod3 0 documentation</title> - <link rel="stylesheet" href="_static/default.css" type="text/css" /> + <link rel="stylesheet" href="_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="_static/pygments.css" type="text/css" /> <script type="text/javascript"> @@ -24,12 +24,16 @@ <script type="text/javascript" src="_static/underscore.js"></script> <script type="text/javascript" src="_static/doctools.js"></script> <link rel="top" title="ProMod3 0 documentation" href="index.html" /> - + + + + <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9"> + </head> - <body> - <div class="related"> + <body role="document"> + <div class="related" role="navigation" aria-label="related navigation"> <h3>Navigation</h3> <ul> <li class="right" style="margin-right: 10px"> @@ -38,20 +42,21 @@ <li class="right" > <a href="#" title="Python Module Index" >modules</a> |</li> - <li><a href="index.html">ProMod3 0 documentation</a> »</li> + <li class="nav-item nav-item-0"><a href="index.html">ProMod3 0 documentation</a> »</li> </ul> </div> <div class="document"> <div class="documentwrapper"> <div class="bodywrapper"> - <div class="body"> + <div class="body" role="main"> <h1>Python Module Index</h1> <div class="modindex-jumpbox"> - <a href="#cap-p"><strong>p</strong></a> + <a href="#cap-p"><strong>p</strong></a> | + <a href="#cap-t"><strong>t</strong></a> </div> <table class="indextable modindextable" cellspacing="0" cellpadding="2"> @@ -62,27 +67,40 @@ <td><img src="_static/minus.png" class="toggler" id="toggle-1" style="display: none" alt="-" /></td> <td> - <tt class="xref">promod3</tt></td><td> + <code class="xref">promod3</code></td><td> <em></em></td></tr> <tr class="cg-1"> <td></td> <td> - <a href="core/index.html#module-promod3.core"><tt class="xref">promod3.core</tt></a></td><td> + <a href="core/index.html#module-promod3.core"><code class="xref">promod3.core</code></a></td><td> <em>Basic functionality, supporting standard tasks in your code.</em></td></tr> <tr class="cg-1"> <td></td> <td> - <a href="rawmodel/index.html#module-promod3.rawmodel"><tt class="xref">promod3.rawmodel</tt></a></td><td> + <a href="core/pm3argparse.html#module-promod3.core.pm3argparse"><code class="xref">promod3.core.pm3argparse</code></a></td><td> + <em></em></td></tr> + <tr class="cg-1"> + <td></td> + <td> + <a href="rawmodel/index.html#module-promod3.rawmodel"><code class="xref">promod3.rawmodel</code></a></td><td> <em>Raw Coordinate Model</em></td></tr> + <tr class="pcap"><td></td><td> </td><td></td></tr> + <tr class="cap" id="cap-t"><td></td><td> + <strong>t</strong></td><td></td></tr> + <tr> + <td></td> + <td> + <a href="actions/index_dev.html#module-test_actions"><code class="xref">test_actions</code></a></td><td> + <em></em></td></tr> </table> </div> </div> </div> - <div class="sphinxsidebar"> + <div class="sphinxsidebar" role="navigation" aria-label="main navigation"> <div class="sphinxsidebarwrapper"> -<div id="searchbox" style="display: none"> +<div id="searchbox" style="display: none" role="search"> <h3>Quick search</h3> <form class="search" action="search.html" method="get"> <input type="text" name="q" /> @@ -99,22 +117,17 @@ </div> <div class="clearer"></div> </div> - <div class="related"> - <h3>Navigation</h3> - <ul> - <li class="right" style="margin-right: 10px"> - <a href="genindex.html" title="General Index" - >index</a></li> - <li class="right" > - <a href="#" title="Python Module Index" - >modules</a> |</li> - <li><a href="index.html">ProMod3 0 documentation</a> »</li> - </ul> - </div> <div class="footer"> - © Copyright 2014, Bienchen. - Last updated on Mar 24 17:42, 2015. - Created using <a href="http://sphinx-doc.org/">Sphinx</a> 1.2.3. + ©2015, Bienchen. + + | + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.3</a> + </div> + + + + </body> </html> \ No newline at end of file diff --git a/doc/html/rawmodel/index.html b/doc/html/rawmodel/index.html index 7b46c952c114407105fb3c803fc3c2d62561a73c..7b6a865d6f489690d5eb996e4ba5d80cdf735e59 100644 --- a/doc/html/rawmodel/index.html +++ b/doc/html/rawmodel/index.html @@ -8,7 +8,7 @@ <title>rawmodel - Coordinate Modeling — ProMod3 0 documentation</title> - <link rel="stylesheet" href="../_static/default.css" type="text/css" /> + <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> <script type="text/javascript"> @@ -25,11 +25,15 @@ <script type="text/javascript" src="../_static/doctools.js"></script> <link rel="top" title="ProMod3 0 documentation" href="../index.html" /> <link rel="up" title="Documentation For Developes" href="../developers.html" /> - <link rel="next" title="Building ProMod3" href="../buildsystem.html" /> - <link rel="prev" title="helper - Shared Functionality For the Everything" href="../core/helper.html" /> + <link rel="next" title="test_actions.ActionTestCase - Testing Actions" href="../actions/index_dev.html" /> + <link rel="prev" title="helper - Shared Functionality For the Everything" href="../core/helper.html" /> + + + <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9"> + </head> - <body> - <div class="related"> + <body role="document"> + <div class="related" role="navigation" aria-label="related navigation"> <h3>Navigation</h3> <ul> <li class="right" style="margin-right: 10px"> @@ -39,23 +43,23 @@ <a href="../py-modindex.html" title="Python Module Index" >modules</a> |</li> <li class="right" > - <a href="../buildsystem.html" title="Building ProMod3" + <a href="../actions/index_dev.html" title="test_actions.ActionTestCase - Testing Actions" accesskey="N">next</a> |</li> <li class="right" > <a href="../core/helper.html" title="helper - Shared Functionality For the Everything" accesskey="P">previous</a> |</li> - <li><a href="../index.html">ProMod3 0 documentation</a> »</li> - <li><a href="../developers.html" accesskey="U">Documentation For Developes</a> »</li> + <li class="nav-item nav-item-0"><a href="../index.html">ProMod3 0 documentation</a> »</li> + <li class="nav-item nav-item-1"><a href="../developers.html" accesskey="U">Documentation For Developes</a> »</li> </ul> </div> <div class="document"> <div class="documentwrapper"> <div class="bodywrapper"> - <div class="body"> + <div class="body" role="main"> <div class="section" id="module-promod3.rawmodel"> -<span id="rawmodel-coordinate-modeling"></span><h1><a class="reference internal" href="#module-promod3.rawmodel" title="promod3.rawmodel: Raw Coordinate Model"><tt class="xref py py-mod docutils literal"><span class="pre">rawmodel</span></tt></a> - Coordinate Modeling<a class="headerlink" href="#module-promod3.rawmodel" title="Permalink to this headline">¶</a></h1> +<span id="rawmodel-coordinate-modeling"></span><h1><a class="reference internal" href="#module-promod3.rawmodel" title="promod3.rawmodel: Raw Coordinate Model"><code class="xref py py-mod docutils literal"><span class="pre">rawmodel</span></code></a> - Coordinate Modeling<a class="headerlink" href="#module-promod3.rawmodel" title="Permalink to this headline">¶</a></h1> <p>Functionality to build raw (pseudo) models based on a sequence alignment. Here is an example of how to build a model from an alignment and a structure.</p> <div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span> @@ -72,9 +76,9 @@ Here is an example of how to build a model from an alignment and a structure.</p <h2>Raw Coordinate Modeling API<a class="headerlink" href="#raw-coordinate-modeling-api" title="Permalink to this headline">¶</a></h2> <dl class="function"> <dt id="promod3.rawmodel.BuildRawModel"> -<tt class="descclassname">promod3.rawmodel.</tt><tt class="descname">BuildRawModel</tt><big>(</big><em>alignment</em>, <em>calpha_only=False</em><big>)</big><a class="headerlink" href="#promod3.rawmodel.BuildRawModel" title="Permalink to this definition">¶</a></dt> +<code class="descclassname">promod3.rawmodel.</code><code class="descname">BuildRawModel</code><span class="sig-paren">(</span><em>alignment</em>, <em>calpha_only=False</em><span class="sig-paren">)</span><a class="headerlink" href="#promod3.rawmodel.BuildRawModel" title="Permalink to this definition">¶</a></dt> <dt> -<tt class="descclassname">promod3.rawmodel.</tt><tt class="descname">BuildRawModel</tt><big>(</big><em>alignments</em>, <em>calpha_only=False</em><big>)</big></dt> +<code class="descclassname">promod3.rawmodel.</code><code class="descname">BuildRawModel</code><span class="sig-paren">(</span><em>alignments</em>, <em>calpha_only=False</em><span class="sig-paren">)</span></dt> <dd><p>Builds a raw (pseudo) model from the alignment. Can either take a single alignment handle or an alignment handle list. Every list item is treated as a single chain in the final raw model.</p> @@ -94,7 +98,7 @@ phosphoserine are copied as a whole with the modifications stripped off.</li> <p>Residue numbers are set such that missing residue in gaps are honoured and subsequent loop modeling can insert new residues without having to renumber.</p> -<p>The returned <a class="reference internal" href="#promod3.rawmodel.RawModelingResult" title="promod3.rawmodel.RawModelingResult"><tt class="xref py py-class docutils literal"><span class="pre">RawModelingResult</span></tt></a> stores the obtained raw model as well +<p>The returned <a class="reference internal" href="#promod3.rawmodel.RawModelingResult" title="promod3.rawmodel.RawModelingResult"><code class="xref py py-class docutils literal"><span class="pre">RawModelingResult</span></code></a> stores the obtained raw model as well as information about insertions and deletions in the gaps list.</p> <table class="docutils field-list" frame="void" rules="none"> <col class="field-name" /> @@ -103,7 +107,7 @@ as information about insertions and deletions in the gaps list.</p> <tr class="field-odd field"><th class="field-name">Parameters:</th><td class="field-body"><strong>calpha_only</strong> – If true, only Calpha atoms will be copied. Side chains and other backbone atoms are completely ignored.</td> </tr> -<tr class="field-even field"><th class="field-name">Raises:</th><td class="field-body">A <tt class="xref py py-exc docutils literal"><span class="pre">RuntimeError</span></tt> when the second sequence does not have an +<tr class="field-even field"><th class="field-name">Raises:</th><td class="field-body">A <code class="xref py py-exc docutils literal"><span class="pre">RuntimeError</span></code> when the second sequence does not have an attached structure</td> </tr> </tbody> @@ -112,19 +116,19 @@ attached structure</td> <dl class="class"> <dt id="promod3.rawmodel.RawModelingResult"> -<em class="property">class </em><tt class="descclassname">promod3.rawmodel.</tt><tt class="descname">RawModelingResult</tt><a class="headerlink" href="#promod3.rawmodel.RawModelingResult" title="Permalink to this definition">¶</a></dt> +<em class="property">class </em><code class="descclassname">promod3.rawmodel.</code><code class="descname">RawModelingResult</code><a class="headerlink" href="#promod3.rawmodel.RawModelingResult" title="Permalink to this definition">¶</a></dt> <dd><p>Holds the result of raw model building. Incredibly minimalistic for now. Will most likely grow a few more members over time to, e.g. to store a detailed report.</p> <dl class="attribute"> <dt id="promod3.rawmodel.RawModelingResult.model"> -<tt class="descname">model</tt><a class="headerlink" href="#promod3.rawmodel.RawModelingResult.model" title="Permalink to this definition">¶</a></dt> +<code class="descname">model</code><a class="headerlink" href="#promod3.rawmodel.RawModelingResult.model" title="Permalink to this definition">¶</a></dt> <dd><p>The resulting model.</p> <table class="docutils field-list" frame="void" rules="none"> <col class="field-name" /> <col class="field-body" /> <tbody valign="top"> -<tr class="field-odd field"><th class="field-name">Type:</th><td class="field-body"><a class="reference external" href="http://www.openstructure.org/docs/1.3/mol/base/entity/#ost.mol.EntityHandle" title="(in OpenStructure v1.3.3)"><tt class="xref py py-class docutils literal"><span class="pre">EntityHandle</span></tt></a></td> +<tr class="field-odd field"><th class="field-name">Type:</th><td class="field-body"><a class="reference external" href="http://www.openstructure.org/docs/1.3/mol/base/entity/#ost.mol.EntityHandle" title="(in OpenStructure v1.3.3)"><code class="xref py py-class docutils literal"><span class="pre">EntityHandle</span></code></a></td> </tr> </tbody> </table> @@ -132,7 +136,7 @@ report.</p> <dl class="attribute"> <dt id="promod3.rawmodel.RawModelingResult.gaps"> -<tt class="descname">gaps</tt><a class="headerlink" href="#promod3.rawmodel.RawModelingResult.gaps" title="Permalink to this definition">¶</a></dt> +<code class="descname">gaps</code><a class="headerlink" href="#promod3.rawmodel.RawModelingResult.gaps" title="Permalink to this definition">¶</a></dt> <dd><p>List of gaps in the model that could not be copied from the template. These gaps may be the result of insertions/deletions in the alignment or due to missing or incomplete backbone coordinates in the template structure.</p> @@ -140,7 +144,7 @@ missing or incomplete backbone coordinates in the template structure.</p> <col class="field-name" /> <col class="field-body" /> <tbody valign="top"> -<tr class="field-odd field"><th class="field-name">Type:</th><td class="field-body"><tt class="xref py py-class docutils literal"><span class="pre">StructuralGapList</span></tt></td> +<tr class="field-odd field"><th class="field-name">Type:</th><td class="field-body"><code class="xref py py-class docutils literal"><span class="pre">StructuralGapList</span></code></td> </tr> </tbody> </table> @@ -155,11 +159,11 @@ missing or incomplete backbone coordinates in the template structure.</p> </div> </div> </div> - <div class="sphinxsidebar"> + <div class="sphinxsidebar" role="navigation" aria-label="main navigation"> <div class="sphinxsidebarwrapper"> <h3><a href="../index.html">Table Of Contents</a></h3> <ul> -<li><a class="reference internal" href="#"><tt class="docutils literal"><span class="pre">rawmodel</span></tt> - Coordinate Modeling</a><ul> +<li><a class="reference internal" href="#"><code class="docutils literal"><span class="pre">rawmodel</span></code> - Coordinate Modeling</a><ul> <li><a class="reference internal" href="#raw-coordinate-modeling-api">Raw Coordinate Modeling API</a></li> </ul> </li> @@ -167,16 +171,18 @@ missing or incomplete backbone coordinates in the template structure.</p> <h4>Previous topic</h4> <p class="topless"><a href="../core/helper.html" - title="previous chapter"><tt class="docutils literal"><span class="pre">helper</span></tt> - Shared Functionality For the Everything</a></p> + title="previous chapter"><code class="docutils literal"><span class="pre">helper</span></code> - Shared Functionality For the Everything</a></p> <h4>Next topic</h4> - <p class="topless"><a href="../buildsystem.html" - title="next chapter">Building ProMod3</a></p> - <h3>This Page</h3> - <ul class="this-page-menu"> - <li><a href="../_sources/rawmodel/index.txt" - rel="nofollow">Show Source</a></li> - </ul> -<div id="searchbox" style="display: none"> + <p class="topless"><a href="../actions/index_dev.html" + title="next chapter"><code class="docutils literal"><span class="pre">test_actions.ActionTestCase</span></code> - Testing Actions</a></p> + <div role="note" aria-label="source link"> + <h3>This Page</h3> + <ul class="this-page-menu"> + <li><a href="../_sources/rawmodel/index.txt" + rel="nofollow">Show Source</a></li> + </ul> + </div> +<div id="searchbox" style="display: none" role="search"> <h3>Quick search</h3> <form class="search" action="../search.html" method="get"> <input type="text" name="q" /> @@ -193,29 +199,20 @@ missing or incomplete backbone coordinates in the template structure.</p> </div> <div class="clearer"></div> </div> - <div class="related"> - <h3>Navigation</h3> - <ul> - <li class="right" style="margin-right: 10px"> - <a href="../genindex.html" title="General Index" - >index</a></li> - <li class="right" > - <a href="../py-modindex.html" title="Python Module Index" - >modules</a> |</li> - <li class="right" > - <a href="../buildsystem.html" title="Building ProMod3" - >next</a> |</li> - <li class="right" > - <a href="../core/helper.html" title="helper - Shared Functionality For the Everything" - >previous</a> |</li> - <li><a href="../index.html">ProMod3 0 documentation</a> »</li> - <li><a href="../developers.html" >Documentation For Developes</a> »</li> - </ul> - </div> <div class="footer"> - © Copyright 2014, Bienchen. - Last updated on Mar 23 14:52, 2015. - Created using <a href="http://sphinx-doc.org/">Sphinx</a> 1.2.3. + ©2015, Bienchen. + + | + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.3</a> + + | + <a href="../_sources/rawmodel/index.txt" + rel="nofollow">Page source</a></li> </div> + + + + </body> </html> \ No newline at end of file diff --git a/doc/html/search.html b/doc/html/search.html index 0865bb82f3c8c89832b8fc7288f10e10937d0160..9b2f84d59d6dbbb3b7b652d55261b090015ba100 100644 --- a/doc/html/search.html +++ b/doc/html/search.html @@ -8,7 +8,7 @@ <title>Search — ProMod3 0 documentation</title> - <link rel="stylesheet" href="_static/default.css" type="text/css" /> + <link rel="stylesheet" href="_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="_static/pygments.css" type="text/css" /> <script type="text/javascript"> @@ -30,11 +30,15 @@ </script> <script type="text/javascript" id="searchindexloader"></script> + + + <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9"> + </head> - <body> - <div class="related"> + <body role="document"> + <div class="related" role="navigation" aria-label="related navigation"> <h3>Navigation</h3> <ul> <li class="right" style="margin-right: 10px"> @@ -43,14 +47,14 @@ <li class="right" > <a href="py-modindex.html" title="Python Module Index" >modules</a> |</li> - <li><a href="index.html">ProMod3 0 documentation</a> »</li> + <li class="nav-item nav-item-0"><a href="index.html">ProMod3 0 documentation</a> »</li> </ul> </div> <div class="document"> <div class="documentwrapper"> <div class="bodywrapper"> - <div class="body"> + <div class="body" role="main"> <h1 id="search-documentation">Search</h1> <div id="fallback" class="admonition warning"> @@ -79,28 +83,23 @@ </div> </div> </div> - <div class="sphinxsidebar"> + <div class="sphinxsidebar" role="navigation" aria-label="main navigation"> <div class="sphinxsidebarwrapper"> </div> </div> <div class="clearer"></div> </div> - <div class="related"> - <h3>Navigation</h3> - <ul> - <li class="right" style="margin-right: 10px"> - <a href="genindex.html" title="General Index" - >index</a></li> - <li class="right" > - <a href="py-modindex.html" title="Python Module Index" - >modules</a> |</li> - <li><a href="index.html">ProMod3 0 documentation</a> »</li> - </ul> - </div> <div class="footer"> - © Copyright 2014, Bienchen. - Last updated on Mar 24 17:42, 2015. - Created using <a href="http://sphinx-doc.org/">Sphinx</a> 1.2.3. + ©2015, Bienchen. + + | + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.3</a> + </div> + + + + </body> </html> \ No newline at end of file diff --git a/doc/html/searchindex.js b/doc/html/searchindex.js index c45772e23bbc7bb84ade2dabde410e3236247042..f019de0bc054943222f4609aee650ba7cd99889a 100644 --- a/doc/html/searchindex.js +++ b/doc/html/searchindex.js @@ -1 +1 @@ -Search.setIndex({envversion:42,terms:{aln:9,all:[8,0,4,11,9],code:[0,4,1,10,8,11],forget:[8,4],chain:[8,9],messi:8,skip:8,forbidden:8,particular:8,ost:[0,1,2,3,4,5,6,7,8,9,10,11],disable_document:[8,4],secondli:[],prefix:[8,0,11],concept:8,subclass:8,abil:8,follow:[8,9],content:[8,3,6],middl:8,test_foo:11,readabl:8,send:1,init:8,program:[11,7],under:8,autotestcas:[],introduc:8,emploi:8,sourc:[0,4,1,10,8,11],everi:[8,9],string:0,fals:[8,0,9],internet:8,worst:8,failur:[8,0],veri:[8,0],rawmodel:5,relev:[4,11],pm_action_init:[],tri:9,magic:8,solver:8,did:8,gui:[],list:[8,0,4,9],assertequ:8,item:[8,9],fileextens:0,setup:[8,5],dir:8,pleas:8,malici:8,promod_gcc_45:8,your_modul:8,direct:8,past:8,second:9,pm3_csc:8,design:0,pass:8,download:4,acid:9,even:[8,4],index:[8,3],what:[8,0,4],hide:8,sub:8,resembl:8,section:11,invok:[8,4,11,10],anywai:8,current:8,delet:9,version:[8,4],"new":[8,9],boost:[0,1,2,3,4,5,6,7,8,9,10,11],"public":[],meld:5,subtre:[8,11],submodule1:8,honour:9,gener:8,never:8,here:[0,4,1,9,8,11],lib_stage_path:8,let:8,set_directory_properti:8,path:[8,0,4,11],along:8,modifi:[8,9,5],implicit:4,valu:[4,0,1],wait:8,test_someth:8,search:[8,3,4],find_packag:8,executable_output_path:8,setup_boost:8,step:8,promod3_version_minor:8,gly:9,doctest:[8,4],action:[],implement:8,chanc:8,methionin:9,via:[8,10],extra:8,appli:[8,10],modul:5,submodul:8,filenam:[],unix:8,api:[],instal:[8,4],smallish:[8,4],unit:4,highli:4,fed:[8,11],from:[0,5,4,1,9,8,11],describ:[0,11],would:[8,4,1],etc:8,regist:[8,11],two:8,next:8,everybodi:8,few:[8,4,9],live:[8,11],call:[8,4,11,10],usr:[],recommend:4,msg:1,loadalign:9,checkout:8,tell:[8,0],tightli:8,more:[8,4,11,9],sort:11,chapter:8,wrapper:10,mol:8,peopl:8,relat:8,pylint:8,notic:[8,11],warn:8,flag:[8,0,11],include_directori:8,sidechains_unit_test:8,known:0,rare:8,hold:9,cach:[8,4],must:8,ost_double_precis:4,word:11,py_run:[8,11],hous:8,generalis:8,prepar:[],work:[8,4,11],histori:8,left:1,paragraph:8,can:[8,0,4,9,10],purpos:8,root:8,fetch:[8,0],def:8,test_suite_:11,control:8,give:[8,11],process:8,add_argu:0,indic:0,topic:8,abort:8,want:[8,4,10],phrase:8,hydrogen:9,unus:8,alwai:8,gcc:8,cours:8,end:[8,0,1,11,4],sit:8,rather:[8,1],peptid:9,comfort:0,"_xml":11,calpha_onli:9,snippet:[],"__init__":8,env:[],instead:[8,0,4,11],config:8,updat:8,python_vers:8,product:8,entityhandl:9,rebas:8,mess:8,dive:8,after:[8,4],usabl:8,befor:[8,11],wrong:4,attent:8,date:8,multipl:8,data:[8,11],grow:9,man:[8,4],subsequ:9,"short":8,essenti:8,practic:[8,11],mol_alg:8,python_binari:8,correspond:8,stash:8,pylintrc:8,caus:8,alias:8,"switch":8,maintain:8,environ:8,allow:8,exclus:8,croak:8,oper:8,promod3_version_major:8,eigen:[8,4],over:[8,4,9],insight:8,becaus:[8,4],through:8,files_to_be_remov:8,affect:8,hierarchi:10,gitignor:8,still:8,pointer:4,disable_disable_doctest:8,paramet:[0,1,11,9,10],perfect:8,output_vari:8,binari:8,fix:[8,0],selenium:9,structuralgaplist:9,runnabl:8,carri:[8,0],complex:8,helper:[],sidechains_pymod:8,python_doc_url:8,match:[8,11,9],main:[],linkcheck:[8,4],them:[8,11],good:8,"return":[0,1,9,10],thei:[8,4],python:[0,1,2,3,4,5,6,7,8,9,10,11],dai:0,exot:8,"break":[8,11],framework:8,conquer:8,verifi:[8,0],front:[8,0,4],now:[8,9],align:9,pre_commit:8,minimalist:9,cmake_cxx_flags_releas:8,libexec_stage_path:8,somewher:11,name:[8,0,11],anyth:[8,4,10],drop:8,separ:8,easili:[8,11],achiev:8,each:8,debug:8,found:[8,11],went:8,higher:4,side:[8,9],mean:[8,0,4,11],compil:8,monolith:8,strip:9,idea:[8,5],realli:[8,0,4],runtest:8,"static":8,connect:[8,11],our:[8,11],extract:8,special:[8,4,11],out:[8,4,11],variabl:[8,4],"try":[],shown:8,goe:[8,4],promod3_unittest:[8,11],crucial:8,categori:11,rel:11,reader:8,print:4,got:4,exec_program:8,ref:[],clone:8,common:[8,0],model:7,insid:11,make_directori:8,runtimeerror:9,given:[0,11],free:8,standard:4,headlin:8,reason:8,base:[0,9],term:8,dictionari:10,ask:8,org:8,hand:4,basi:[8,11],could:[8,11,9],put:[8,0,4,11],keep:8,thing:[8,4],place:[8,1],think:8,first:[8,5],origin:8,softwar:8,major:8,suffix:0,obviou:8,prevent:8,feel:8,onc:8,number:9,yourself:[8,4],restrict:8,mai:[8,4,11,9],alreadi:8,done:8,messag:0,blank:8,stabl:8,miss:[0,9],exit_statu:[0,1],differ:[8,4,11,10],ancient:10,level:[8,4,10],script:[8,0,1,11,4],top:[8,4,10],perfectli:8,mkdir:8,system:[8,4,5],least:[8,4,11],tradition:[0,1],attach:[11,9],stori:8,master:8,too:8,"_run":11,termin:0,scheme:8,"final":[8,9],store:[8,9],shell:[4,0,1],option:[8,0,4],cope:8,tool:[0,11],copi:[8,11,9],restrict_chain:9,specifi:11,openstructur:[0,1,2,3,4,5,6,7,8,9,10,11],part:8,pars:0,boost_include_dir:8,mostli:8,rst:8,conop:8,exactli:4,than:8,kind:8,grep:4,target:[8,4,11],whenev:8,provid:[8,4,11],seamlessli:8,tree:[8,11],unrecognis:0,project:[8,11],matter:11,reus:9,str:[0,1,10],were:8,posit:0,toward:8,markup:8,pre:8,cmake_c_compiler_vers:8,linker:11,mind:8,argument:4,packag:[8,11],manner:8,have:[8,4,11,9],"__main__":8,need:[8,0,4,11,10],dedic:[8,4,11],turn:[8,0],tidi:8,cmake_current_source_dir:8,optimis:8,imagin:8,built:8,advic:8,inform:9,diverg:8,latter:8,mix:11,exampl:[8,4,9],take:[8,9],which:[8,4,1,9,7],thoroughli:8,data1:11,noth:[8,11],singl:[8,11,9],data2:11,compat:8,"_opt":8,sure:8,distribut:8,track:0,buildrawmodel:9,compress:0,strict:8,somethingtest:8,most:[8,0,9],eigen3_found:8,hotfix:8,why:8,charg:8,renam:5,url:8,doc:[8,4],later:8,cover:[8,0,7],doe:[8,0,11,9,10],ext:0,declar:[8,11],clean:[8,4],brew:11,usual:[8,4,11],someth:[8,1],came:8,cmakelist:[8,4,11],show:8,enumer:8,dbg:8,attachview:9,bring:8,permiss:8,extern:[8,11],add_doc_sourc:8,fine:8,find:[8,11],help:[8,4,11],involv:8,onli:[8,0,11,9,10],inlin:8,locat:[4,11],execut:11,explain:8,configur:[8,4],activ:8,figur:8,should:[8,0,1,11],suppos:8,templat:9,folder:8,move:8,hit:8,contribut:[],variou:[8,4,11],get:[8,4],watch:8,autom:11,repo:[],solut:8,cannot:8,loadpdb:9,chemic:10,report:[8,9],toolbox:8,requir:[8,4],setup_compiler_flag:8,add_changelog_to_doc:8,bar:[],enabl:[0,10],ever:8,automatis:[],"2b1":4,gather:[8,11,7],whether:0,feed:11,integr:[8,11],contain:[8,0,4,11,9],python_root:4,where:8,remov:4,view:8,user:[],set:[0,4,9,8,10,11],project_nam:8,seq:[8,9],frame:8,around:8,ost_include_dir:8,see:8,temporarili:8,mandatori:8,result:[8,4,9],smng:5,arg:8,testcas:8,close:8,sport:8,servic:8,best:11,subject:8,awar:8,statu:8,detect:0,msgerrorandexit:1,inconveni:8,vari:11,review:8,version_great:8,test_suite_your_module_run:8,label:8,state:[8,4],header_stage_path:8,subdir:8,simplest:8,"import":[8,0,4,1,9],awai:8,bunch:8,approach:8,attribut:8,accord:8,extend:[8,11],sole:8,cmake_cxx_compiler_vers:8,job:[],test_your_modul:8,recent:8,solv:8,come:[8,0],popul:[8,4],fail:[8,1],last:11,extens:0,alon:1,disable_doctest:[8,4],promod3_version_patch:8,tutori:8,grain:8,fno:8,mani:1,whole:[8,9],pdb:[0,9],pm_action:11,load:10,sidechains_rst:8,author:8,point:[8,4,10],cxx:8,overview:8,unittest:8,argumentpars:0,chmod:[],walk:8,residu:9,header:[8,4],exclud:8,throughout:8,assum:8,amino:9,quit:8,template_structur:9,evalu:8,coupl:8,addition:11,decent:10,rebuild:[8,4],three:[8,11],been:8,sinc:[8,0,4,11],compon:[8,10],trigger:[8,11],besid:[4,11],treat:[8,9],basic:[8,4,9],ost_root:[8,4],addit:[8,0,11],seq_alg:8,tini:8,quickli:8,life:8,immed:[],convert:9,ani:[8,11,10],coordin:[],understand:8,togeth:8,input:0,fileexist:0,educ:8,those:[8,4,11],"case":8,therefor:8,uncertain:8,look:[8,0],raw:[],launcher:11,disable_disable_linkcheck:8,straight:8,properti:8,commerci:8,trick:8,defin:[11,10],"while":[8,0],smart:8,abov:8,error:[0,1],wild:11,dost_root:[8,4],loop:[8,9],stage_dir:8,spawn:8,bin:8,test_sidechain:8,test_action_awesom:[],almost:11,sidechain:8,henc:8,non:8,itself:[8,11],clutter:8,conf:[8,4],protein:9,vanish:8,fasta:9,sever:[8,4],reviv:8,parent:9,disabl:8,develop:[],fedora:8,"_startmodul":[],perform:8,suggest:8,belong:8,savepdb:9,same:[8,4,11],member:[8,9],funni:4,drawback:8,flag2:11,flag1:11,admir:8,document:[4,5],start:4,conflict:8,complet:[8,9],http:8,again:[8,4],optim:[8,4],bienchen:8,argpars:0,effect:11,detour:[],driven:8,moment:8,rais:9,disable_linkcheck:[8,4],initi:5,kic:8,immedi:[8,10],respons:8,stack:8,expand:8,codetest:[8,11],libexec:11,task:8,off:[8,9],pymod:8,nevertheless:8,macro:[8,11],builder:4,well:[8,4,9],full:[],know:4,without:[8,0,11,9],command:[],branchnam:8,thi:[0,4,10,8,9,7,11],endif:8,entiti:8,everyth:[],academ:8,loss:8,spend:8,latest:4,comment:8,cmake_support:[8,11],entri:8,just:[8,4,10],less:8,sound:8,compound:10,obtain:9,rest:[0,1,2,3,4,5,6,7,8,9,10,11],detail:[8,9],behind:[],touch:8,languag:11,web:[8,4],easi:[],also:[8,0,4,11,9],lapack:[8,4],scenario:[],filecheck:8,makefil:[8,4],except:8,littl:[8,11],add:[8,11],valid:8,eigen3:8,els:8,save:8,boost_root:4,opt:[8,0],complaint:8,advis:8,format:8,handl:9,specimen:0,setup_stag:8,piec:8,source2:[8,11],source1:[8,11],pop:8,background:4,elabor:8,bit:[8,4],cmake_compiler_is_gnucxx:8,dare:11,mod:8,eigen3_include_dir:[8,4],insert:9,like:[8,4,11,9],success:[0,1],incred:9,manual:[8,4],resolv:8,test_:8,test_awesome_featur:8,collect:1,"boolean":0,either:[8,9],output:[8,0],per:[8,11,7],page:[8,3,4],www:8,right:[8,4],often:[8,0],acknowledg:8,test_submodule1:8,some:[8,0,4],begin:8,self:8,global:10,intern:8,flush:8,proper:8,home:11,librari:[8,11,10],qmean:[8,4],thu:0,txt:[8,4,11],mood:[],lead:0,avoid:[8,10],definit:8,legal:8,exit:[0,1],select:9,recognis:8,sequenc:9,condit:8,foo:[],overli:8,manag:[8,11],core:[0,1],plu:[8,10],cmake_source_dir:8,backbon:9,host:[8,11],promot:8,repositori:[8,11,5],fulli:8,"__name__":8,cmake_minimum_requir:8,intervent:8,mmcif:0,stage:4,trustworthi:8,src:8,about:[8,11,9],pep:8,actual:8,reappear:8,materi:8,unfortun:8,interpret:1,coars:8,commit:8,ost_doc_url:8,produc:[4,11],qmean_root:[8,4],own:[],real:8,within:[8,4],automat:[8,0],due:9,promod3_version_str:8,empti:[8,1],cmake_cxx_flag:8,cmake_module_path:8,announc:8,soon:8,your:4,merg:8,testfileexistsfals:8,git:[4,5],fill:8,log:[8,1],wai:[8,4,11],pictur:8,qmean_include_dir:8,support:[8,0],renumb:9,custom:8,avail:[8,4,10],lost:8,much:[8,9],interfac:8,includ:[8,0,5],lot:[8,0],suit:8,forward:8,parse_arg:0,headach:8,gzip:0,unexpect:4,enough:8,tupl:0,forg:8,wno:8,back:8,link:[8,4,11],atom:9,don:[8,4],line:[],highest:10,"true":[8,0,9],bug:8,pull:[8,4],tripl:0,made:11,wise:11,consist:8,possibl:[8,9],"default":[8,4,10],type:[0,9],displai:0,until:[],below:8,otherwis:8,problem:8,similar:[8,4],eigenvector:8,testutil:8,reserv:[0,1],featur:8,creat:[8,4,11],"int":[0,1],certain:[8,4,11],utilis:[8,0],html:[8,4,5],fellow:8,incomplet:9,exist:[8,0,11],file:4,dqmean_root:[8,4],deuterium:9,check:[8,0,4],probabl:[8,4,11],echo:8,cmakecach:4,readi:4,calpha:9,modif:9,path_to_chemlib:10,when:[8,9],add_custom_target:[],other:[8,4,9],bool:0,seem:8,test:4,you:[8,0,4,11,10],phosphoserin:9,intermedi:[],nice:8,restructuredtext:[0,1,2,3,4,5,6,7,8,9,10,11],sometim:8,additional_make_clean_fil:8,intend:[],determin:0,rawmodelingresult:9,devot:7,"class":[8,9,7],cmake_build_typ:8,add_subdirectori:8,propag:[],formatt:8,briefli:8,eigenvalu:8,consid:[8,11],gap:9,homolog:7,doptim:8,fatal_error:8,stai:8,library2:11,library1:11,sphinx:[0,1,2,3,4,5,6,7,8,9,10,11],algorithm:[8,9],project_binary_dir:8,directori:4,descript:8,pseudo:9,rule:8,ignor:9,awesom:[],time:[8,9],push:8},objtypes:{"0":"cmake:command","1":"py:module","2":"py:function","3":"py:attribute","4":"py:class"},objnames:{"0":["cmake","command","CMake command"],"1":["py","module","Python module"],"2":["py","function","Python function"],"3":["py","attribute","Python attribute"],"4":["py","class","Python class"]},filenames:["core/argcheck","core/helper","users","index","buildsystem","changelog","developers","core/index","contributing","rawmodel/index","core/setcompoundschemlib","cmake/index"],titles:["<tt class=\"docutils literal\"><span class=\"pre\">argcheck</span></tt> - Standard Tests For Command Line Arguments","<tt class=\"docutils literal\"><span class=\"pre\">helper</span></tt> - Shared Functionality For the Everything","Documentation For Users","Welcome To ProMod3’s Documentation!","Building ProMod3","Changelog","Documentation For Developes","<tt class=\"docutils literal\"><span class=\"pre\">core</span></tt> - ProMod3 Core Functionality","Contributing","<tt class=\"docutils literal\"><span class=\"pre\">rawmodel</span></tt> - Coordinate Modeling","<tt class=\"docutils literal\"><span class=\"pre\">SetCompoundsChemlib()</span></tt>","ProMod3‘s Share Of CMake"],objects:{"":{"command:promod3_unittest":[11,0,1,""],"command:pm_action":[11,0,1,""]},"promod3.rawmodel":{BuildRawModel:[9,2,1,""],RawModelingResult:[9,4,1,""]},"promod3.core.argcheck":{FileExtension:[0,2,1,""],FileExists:[0,2,1,""]},"promod3.rawmodel.RawModelingResult":{model:[9,3,1,""],gaps:[9,3,1,""]},promod3:{core:[7,1,0,"-"],SetCompoundsChemlib:[10,2,1,""],rawmodel:[9,1,0,"-"]},"promod3.core.helper":{MsgErrorAndExit:[1,2,1,""]}},titleterms:{model:9,own:8,helper:1,modul:[8,11],share:[1,11],argument:0,indic:3,raw:9,api:9,file:0,tabl:3,argcheck:0,your:8,unit:[8,11],setcompoundschemlib:10,git:8,cmake:[8,4,11],welcom:3,start:8,parti:8,make:4,messag:1,write:8,how:8,build:4,branch:8,test:[8,0,11],stage:8,promod3:[4,3,11,7],"function":[1,11,7],core:7,run:4,contribut:8,standard:0,coordin:9,mainten:11,user:2,releas:5,develop:6,line:0,everyth:1,introduct:[0,1,11],document:[8,3,6,2],third:8,hook:8,directori:8,changelog:5,structur:8,issu:8,command:0,rawmodel:9,action:11,chang:5,licens:8,depend:4}}) +Search.setIndex({envversion:46,filenames:["actions/index_dev","buildsystem","changelog","cmake/index","contributing","core/helper","core/index","core/pm3argparse","core/setcompoundschemlib","developers","index","rawmodel/index","users"],objects:{"":{"command:add_doc_dependency":[3,0,1,""],"command:add_doc_source":[3,0,1,""],"command:pm_action":[3,0,1,""],"command:promod3_unittest":[3,0,1,""],test_actions:[0,1,0,"-"]},"promod3.core":{pm3argparse:[7,1,0,"-"]},"promod3.core.helper":{FileExists:[5,3,1,""],FileExtension:[5,3,1,""],FileGzip:[5,3,1,""],MsgErrorAndExit:[5,3,1,""]},"promod3.core.pm3argparse":{PM3ArgumentParser:[7,5,1,""]},"promod3.core.pm3argparse.PM3ArgumentParser":{"__init__":[7,2,1,""],AddAlignment:[7,2,1,""],AssembleParser:[7,2,1,""],Parse:[7,2,1,""],action:[7,4,1,""]},"promod3.rawmodel":{BuildRawModel:[11,3,1,""],RawModelingResult:[11,5,1,""]},"promod3.rawmodel.RawModelingResult":{gaps:[11,4,1,""],model:[11,4,1,""]},"test_actions.ActionTestCase":{RunAction:[0,2,1,""],RunExitStatusTest:[0,2,1,""],pm_action:[0,4,1,""],pm_bin:[0,4,1,""],testPMExists:[0,2,1,""]},promod3:{SetCompoundsChemlib:[8,3,1,""],core:[6,1,0,"-"],rawmodel:[11,1,0,"-"]},test_actions:{ActionTestCase:[0,5,1,""]}},objnames:{"0":["cmake","command","CMake command"],"1":["py","module","Python module"],"2":["py","method","Python method"],"3":["py","function","Python function"],"4":["py","attribute","Python attribute"],"5":["py","class","Python class"]},objtypes:{"0":"cmake:command","1":"py:module","2":"py:method","3":"py:function","4":"py:attribute","5":"py:class"},terms:{"2b1":1,"__doc__":5,"__init__":[0,4,7],"__main__":[0,4],"__name__":[0,4],"_opt":4,"_run":[0,3],"_xml":3,"boolean":5,"break":[3,4],"case":4,"class":[0,4,6,7,11],"default":[0,1,4,7,8],"final":[4,11],"function":0,"import":[0,1,4,5,11],"int":[0,5],"new":[0,4,7,11],"public":4,"return":[0,5,7,8,11],"short":4,"static":4,"switch":4,"throw":0,"true":[0,4,5,7,11],"try":[0,4],"while":[0,3,4],abil:4,abort:4,about:[0,3,4,11],abov:[0,4],absolut:3,academ:4,accord:4,achiev:4,acid:11,acknowledg:4,across:0,action_unit_test:0,actiontest:0,activ:[4,7],actual:[4,7],add:[0,3,4,7],add_argu:5,add_changelog_to_doc:4,add_custom_target:4,add_doc_depend:3,add_doc_sourc:[3,4],add_subdirectori:4,addalign:7,addit:[3,4,5],addition:[0,3],additional_make_clean_fil:4,admir:4,advic:4,advis:4,affect:4,after:[0,1,4,7],again:[1,4],ago:0,algorithm:[4,11],alias:4,align:[7,11],alignmentlist:7,all:[0,1,3,4,7,11],allow:[4,5],almost:3,aln:11,aln_sourc:7,alon:5,along:[0,4],alot:4,alreadi:[0,3,4],also:[0,1,3,4,5,11],alwai:[0,4],amino:11,ancient:8,ani:[0,3,4,8],announc:[0,4],anyth:[1,4,7,8],anywai:4,apart:0,appli:[4,5,8],applic:0,approach:4,arg:[0,4,7],argcheck:2,argpars:7,argument:[0,1],argumentpars:7,argv:7,around:[0,4],ask:4,assemblepars:7,assertequ:4,assum:[0,4],atom:11,attach:[3,11],attachview:11,attent:[0,4],attribut:[4,7],author:4,autom:3,automat:[0,4,5],automatis:4,avail:[0,1,4,8],avoid:[4,5,8],awai:4,awar:4,awesom:[0,4],awesomeactiontest:4,back:[0,4],backbon:11,background:1,base:[5,11],basi:[3,4],basic:[0,1,4,5,11],becaus:[1,4],been:4,befor:[0,3,4,7],begin:[0,4],behav:0,behaviour:7,behind:4,bell:4,belong:[3,4],below:4,besid:[1,3,7],best:3,between:0,beyond:7,bienchen:4,bin:[0,4],binari:[0,4],bit:[0,1,4],blank:4,bool:[0,5,7],boost:[0,1,2,3,4,5,6,7,8,9,10,11,12],boost_include_dir:4,boost_root:1,branch:3,branchnam:4,brew:3,briefli:4,bring:4,broken:0,bug:4,build:0,builder:1,buildrawmodel:11,built:[3,4],bunch:[0,4,7],bytecod:0,cach:[1,4],call:[0,1,3,4,7,8],calpha:11,calpha_onli:11,came:4,can:[0,1,4,5,7,8,11],cannot:4,captur:0,carri:[4,5],categori:3,caus:4,certain:[0,1,3,4],certainli:0,chain:[4,11],chanc:4,chang:0,chapter:4,charact:7,charg:4,check:[0,1,4,5,7],checkout:4,chemic:8,child:7,childclass:0,chmod:4,clean:[1,4],clip:7,clone:4,close:4,clutter:[0,4],cmake_build_typ:4,cmake_c_compiler_vers:4,cmake_compiler_is_gnucxx:4,cmake_current_source_dir:4,cmake_cxx_compiler_vers:4,cmake_cxx_flag:4,cmake_cxx_flags_releas:4,cmake_minimum_requir:4,cmake_module_path:4,cmake_source_dir:4,cmake_support:[3,4],cmakecach:1,cmakelist:[0,1,3,4],coars:4,code:[0,1,3,4,5,7,8],codetest:[3,4],collect:5,come:[0,3,4,5,7],command:[0,4],comment:4,commerci:4,commit:4,common:[4,7],compat:4,compil:[0,4],complain:0,complaint:4,complet:[4,11],complex:4,compon:[4,8],compound:8,compress:5,concept:4,condit:4,conf:[1,4],config:4,configur:[1,4],conflict:4,connect:[3,4],conop:4,conquer:4,consid:[3,4],consist:4,constraint:7,contain:[0,1,3,4,5,7,11],content:[4,9,10],continu:0,contribut:3,control:4,conveni:0,convent:0,convert:11,coordin:[],cope:4,copi:[3,4,11],cor:7,core:4,correspond:4,could:[0,3,4,11],coupl:[0,4],cours:4,cover:[0,4,6],croak:4,crucial:4,current:4,custom:4,cxx:4,dai:5,dare:3,data1:3,data2:3,data:[0,3,4],date:4,dbg:4,debug:4,decent:8,decid:4,declar:[3,4],dedic:[1,3,4],def:[0,4],defin:[0,3,8],definit:4,delet:11,deliv:0,dep:3,dependency1:3,dependency2:3,deriv:0,describ:[3,5,7],descript:[4,7],design:0,detail:[4,11],detect:5,determin:5,deuterium:11,develop:[0,4],devot:6,dictionari:8,did:4,differ:[0,1,3,4,7,8],dir:4,direct:4,directori:[0,1,3],dirti:0,disabl:[0,4],disable_disable_doctest:4,disable_disable_linkcheck:4,disable_doctest:[1,4],disable_document:[1,4],disable_linkcheck:[1,4],displai:5,distribut:[0,4],dive:4,diverg:4,doawesomeactiontest:0,doc:[1,3,4],doctest:[1,4],document:[0,1],doe:[0,3,4,5,7,8,11],don:[1,4],done:[0,4,5,7],dont_write_bytecod:[0,4],doptim:4,dost_root:[1,4],down:7,download:1,dqmean_root:[1,4],drawback:4,driven:4,drop:4,due:11,dure:0,each:4,easi:4,easier:[0,4],easili:[3,4],echo:4,editor:0,educ:4,effect:[3,4],eigen3:4,eigen3_found:4,eigen3_include_dir:[1,4],eigen:[1,4],eigenvalu:4,eigenvector:4,either:[4,11],elabor:4,element:0,els:4,emerg:0,emploi:4,empti:[4,5,7],enabl:[0,5,8],end:[0,1,3,4,5],endif:4,enough:4,entiti:4,entityhandl:11,entri:4,enumer:4,env:4,environ:[0,4],error:5,essenti:4,etc:[0,4],evalu:[3,4],even:[1,4],eventu:7,ever:4,everi:[0,4,11],everybodi:4,everyth:[0,4],exactli:1,exampl:[0,1,4,7,11],except:4,exclud:4,exclus:[0,4],exec_program:4,executable_output_path:4,exist:[0,3,4,5,7],exit:[0,5,7],exit_cod:0,exit_statu:5,exot:4,expand:4,expect:0,explain:4,explan:4,ext:5,extend:[0,3,4],extens:[5,7],extern:[3,4],extra:4,extract:4,fail:[0,4,5],failur:[4,5],fals:[0,4,5,7,11],fasta:[7,11],fatal_error:4,favourit:0,featur:4,fed:[3,4],fedora:4,feed:3,feel:4,fellow:4,fetch:4,few:[1,4,11],figur:4,file:[0,1,3,4],filecheck:4,fileexist:5,fileextens:5,filegzip:5,filenam:[4,5,7],files_to_be_remov:4,fill:[3,4,7],find:[3,4],find_packag:4,fine:4,fire:0,first:[0,2,4,7],fix:[4,5],flag1:3,flag2:3,flag:[3,4,5,7],flush:[0,4],fno:4,folder:4,follow:[0,4,11],forbidden:4,forg:4,forget:[0,1,4],format:[4,7],formatt:4,forward:4,found:[0,3,4,5,7],foundat:0,frame:4,framework:4,free:4,from:[0,1,2,3,4,5,11],front:[0,1,4,5],full:[0,4],fulli:4,functions_specific_to_your_act:4,funni:[1,4],gap:11,gather:[3,4,6],gcc:4,gener:[0,4],generalis:4,get:[0,1,4],git:[0,1,3],gitignor:4,give:[3,4],given:[0,3,5,7],global:8,gly:11,goal:0,goe:[1,4],good:[3,4],got:1,grain:4,grep:1,grow:11,gui:4,gzip:[5,7],hand:[1,3,7],handl:11,happen:[0,4],headach:4,header:[1,4],header_stage_path:4,headlin:4,help:[0,1,3,4,7],helper:3,henc:4,here:[0,1,3,4,5,7,11],hide:4,hierarchi:8,higher:1,highest:8,highli:1,hint:7,histori:4,hit:[0,4],hold:11,home:3,homolog:6,honour:11,host:[3,4],hotfix:4,hous:4,html:[1,2,4],http:4,hydrogen:11,hyphen:0,idea:[0,2,4],identifi:7,ignor:11,imagin:4,imaginari:0,immedi:[0,4,8],implement:4,implicit:1,includ:[2,4,5],include_directori:4,incomplet:11,inconveni:4,incred:11,index:[4,10],indic:[],influenc:7,inform:[4,7,11],inherit:0,init:4,initi:2,initialis:0,inlin:4,input:[0,7],insert:11,insid:[0,3,7],insight:4,instal:[1,4],instanc:7,instead:[0,1,3,4,5],intend:[0,4],interest:0,interfac:4,intermedi:4,intern:[0,3,4],internet:4,interpret:[4,5],intervent:4,introduc:[0,3,4],invok:[1,3,4,8],involv:4,item:[0,4,11],itself:[3,4],job:4,json:7,just:[0,1,4,7,8],keep:[0,3,4,7],kic:4,kick:7,kind:[0,4],know:1,known:[3,5],kwarg:[0,4],label:4,languag:3,lapack:[1,4],last:[0,3],later:[0,4],latest:1,latter:4,launcher:[3,4],lead:[4,5],least:[1,3,4],leav:0,left:5,legal:4,length:7,less:4,let:[0,4],level:[1,4,8],lib_stage_path:4,libexec:[3,4],libexec_stage_path:4,librari:[3,4,8],library1:3,library2:3,life:4,like:[0,1,3,4,11],line:[0,4],link:[1,3,4],linkcheck:[1,4],linker:3,list:[0,1,3,4,5,7,11],littl:[3,4],live:[3,4],load:[0,7,8],loadalign:11,loadpdb:11,locat:[1,3],log:[4,5],look:[4,5],loop:[4,11],loss:4,lost:[0,4],lot:[0,4,7],low:0,macro:[3,4],made:3,magic:4,mai:[0,1,3,4,5,7,11],maintain:4,major:4,make_directori:4,makefil:[1,4],malici:4,man:[1,4],manag:[3,4],mandatori:4,mani:5,manner:4,manual:[0,1,4],mark:7,markup:4,master:4,match:[3,4,11],materi:[0,4],matter:3,mean:[1,3,4,7],meld:2,member:[4,11],mention:0,merg:[2,4],mess:4,messag:4,messi:4,methionin:11,method:[0,7],middl:4,mind:[0,4],minimalist:11,miss:[5,11],mix:3,mkdir:4,mmcif:5,mod:4,mode:0,model:0,modif:11,modifi:[2,4,11],modul:0,mol:4,mol_alg:4,moment:4,monitor:0,monolith:4,mood:4,more:[0,1,3,4,7,11],most:[3,4,11],mostli:[3,4],move:4,msg:5,msgerrorandexit:5,much:[4,11],multipl:[4,7],name:[0,3,4,5,7],namespac:7,need:[0,1,3,4,5,7,8],neg:0,never:[4,7],nevertheless:4,next:[0,4],nice:4,nobodi:0,non:4,none:7,note:[4,7],noth:[3,4],notic:[0,3,4],now:[0,4,11],number:[0,11],object:7,obtain:11,obviou:4,off:[0,4,11],often:[4,5,7],onc:[0,4],onli:[0,3,4,5,7,8,11],onto:0,openstructur:[0,1,2,3,4,5,6,7,8,9,10,11,12],oper:4,opt:[4,5],optim:[1,4],optimis:4,option:[1,4,7],order:7,org:4,origin:[4,7],ost:[0,1,2,3,4,5,6,7,8,9,10,11,12],ost_doc_url:4,ost_double_precis:1,ost_include_dir:4,ost_root:[1,4],other:[0,1,4,7,11],otherwis:[0,3,4],our:[3,4],out:[0,1,3,4],output_vari:4,outsid:4,over:[1,3,4,11],overli:4,overview:4,own:[0,3],packag:[3,4],page:[1,4,10],pai:0,paragraph:[0,4],paramet:[0,3,5,7,8,11],parent:11,pars:[],parse_arg:7,parser:[],part:[0,4],particular:4,pass:4,past:4,path:[0,1,3,4,5],path_to_chemlib:8,pdb:[5,11],peopl:4,pep:[0,1,2,3,4,5,6,7,8,9,10,11,12],peptid:11,per:[3,4,6],perfect:4,perfectli:4,perform:4,permiss:4,phosphoserin:11,phrase:4,pictur:4,piec:4,place:[0,4,5,7],pleas:4,plu:[4,7,8],pm3_csc:4,pm3argpars:[],pm3argumentpars:[5,7],pm3optionsnamespac:7,pm_action:[0,3,4],pm_action_init:4,pm_bin:0,point:[1,4,8],pointer:1,pop:4,popul:[1,4],possibl:[4,7,11],post:7,practic:[3,4],pre:4,pre_commit:4,prefer:3,prefix:[0,3,4,5,7],prepar:4,prevent:[0,4],print:[0,1],privat:0,probabl:[1,3,4],problem:4,process:[0,4,7],produc:[0,1,3,4],product:[0,4],prog:7,program:[3,4,6],project:[3,4],project_binary_dir:4,project_nam:4,promod3:0,promod3_unittest:[0,3,4],promod3_version_major:4,promod3_version_minor:4,promod3_version_patch:4,promod3_version_str:4,promod_gcc_45:4,promot:4,propag:4,proper:4,properli:0,properti:4,protein:11,provid:[0,1,3,4,7],pseudo:11,pull:[1,4],punch:0,purpos:4,push:4,put:[0,1,3,4,5,7],py_run:[0,3,4],pyc:[0,4],pylint:4,pylintrc:4,pymod:4,python:[0,1,2,3,4,5,6,7,8,9,10,11,12],python_binari:4,python_doc_url:4,python_root:1,python_vers:4,qmean:[1,4],qmean_include_dir:4,qmean_root:[1,4],quickli:4,quit:[4,7],rais:[7,11],rare:4,rather:[4,5,7],raw:[],rawmodel:4,rawmodelingresult:11,read:4,readabl:4,reader:4,readi:1,real:[4,7],realli:[0,1,4,5],reappear:4,reason:4,rebas:4,rebuild:[1,4],recent:4,recognis:[0,4],recommend:1,record:0,refer:[0,3],regist:[3,4],rel:3,relat:[3,4,7],relev:[1,3],rememb:0,remov:1,renam:2,renumb:11,report:[0,4,11],repositori:[0,2,3,4],requir:[1,4],resembl:4,reserv:5,residu:11,resolv:4,respons:4,rest:[0,1,2,3,4,5,6,7,8,9,10,11,12],restrict:4,restrict_chain:11,restructuredtext:[0,1,2,3,4,5,6,7,8,9,10,11,12],result:[1,4,11],reus:11,review:4,reviv:4,rewrit:0,right:[0,1,4,7],root:[3,4],routin:0,rst1:3,rst2:3,rst:[3,4],rule:4,runact:0,runexitstatustest:[0,4],runnabl:4,runtest:[0,4],runtimeerror:11,same:[0,1,3,4,7],save:4,savepdb:11,scheme:[0,4,7],seamlessli:4,search:[1,4,10],second:11,secondli:4,section:[0,3],see:[0,4,5],seem:4,select:11,selenium:11,self:[0,4],send:5,separ:[0,4],seq:[4,11],seq_alg:4,sequenc:[7,11],serv:[0,7],servic:4,set:[0,1,3,4,5,7,8,11],set_directory_properti:4,setup:[2,4],setup_boost:4,setup_compiler_flag:4,setup_stag:4,sever:[1,4,7],shebang:4,shell:[0,1,4,5],should:[0,3,4,5,7],show:[0,4],shown:4,side:[4,11],sidechain:4,sidechains_pymod:4,sidechains_rst:4,sidechains_unit_test:4,silent:0,similar:[0,1,4],simplest:4,simplif:7,sinc:[0,1,3,4,5],singl:[3,4,11],sit:4,skip:[0,4],smallish:[1,4],smart:4,smng:2,softwar:4,sole:[0,4],solut:4,solv:4,solver:4,some:[0,1,3,4,7],someth:[0,4,5],somethingtest:4,sometim:4,somewher:3,soon:4,sort:[0,3],sound:4,sourc:[0,1,3,4,5,7,8],source1:[3,4],source2:[3,4],spawn:[0,4],special:[0,1,3,4],specif:0,specifi:3,specimen:5,spend:4,sphinx:[0,1,2,3,4,5,6,7,8,9,10,11,12],sport:4,src:4,stabl:4,stack:4,stage:[0,1],stage_dir:4,stai:[0,4],standard:[1,4,6,7],start:[0,1,3],starter:0,stash:4,state:[0,1,4],statu:[0,4],stderr:0,stdout:0,step:4,still:4,stop:0,store:[0,4,11],stori:4,str:[0,5,7,8],straight:4,strict:4,string:[5,7],strip:11,structuralgaplist:11,sub:4,subdir:4,subject:4,submodul:4,submodule1:4,subsequ:11,subtre:[3,4],success:5,suffix:5,suggest:4,suit:[0,4],supervis:0,support:[0,4,5],suppos:4,sure:4,system:[0,1,2,3,4],take:[4,11],talk:0,target:[0,1,3,4,7],task:4,tell:[0,4,5,7],templat:[0,7,11],template_structur:11,temporarili:4,term:4,termin:[0,5],test_:4,test_action_:0,test_action_awesom:4,test_action_do_awesom:0,test_action_help:0,test_awesome_featur:4,test_foo:3,test_sidechain:4,test_someth:4,test_submodule1:4,test_suite_:3,test_suite_your_module_run:4,test_your_modul:4,testcas:[0,4],testexit0:[0,4],testfileexistsfals:4,testpmexist:0,testutil:[0,4],text:[0,7],than:[4,7],thei:[1,4],them:[3,4],therefor:4,thi:[0,1,3,4,5,6,7,8,11],thing:[0,1,4,7],think:4,thoroughli:4,those:[0,1,3,4,7],three:[0,3,4],through:[0,4],throughout:[4,7],thu:5,tidi:4,tightli:4,time:[0,4,11],tini:4,togeth:4,too:4,tool:3,toolbox:4,top:[1,4,8],topic:[0,4],touch:[0,4],toward:4,track:5,tradit:7,tradition:5,treat:[4,11],tree:[0,3,4],trg:7,tri:11,trick:[0,4],trigger:[0,3,4],tripl:5,trustworthi:4,tupl:5,turn:[0,4,5],tutori:4,two:[0,4],txt:[0,1,3,4],type:[0,5,7,11],uncertain:4,under:[3,4],underscor:0,understand:4,unexpect:1,unfortun:4,unittest:[0,4],unix:4,unrecognis:[5,7],until:4,untrack:0,unus:4,updat:4,url:4,usabl:4,user:0,userlevel:0,usr:4,usual:[0,1,3,4,7],utilis:4,valid:4,valu:[1,5],vanish:4,vari:3,variabl:[0,1,4],variou:[0,1,3,4],verbos:0,veri:[0,4,5],verif:7,verifi:[0,4,5],version:[1,4],version_great:4,via:[0,4,7,8],view:4,virtual:4,wai:[0,1,3,4,7],wait:4,walk:[0,4],want:[0,1,4,8],warn:4,watch:4,web:[1,4],well:[1,3,4,11],went:4,were:4,what:[0,1,4,5,7],when:[0,3,4,7,11],whenev:4,where:[0,4,5],whether:5,which:[0,1,4,5,6,7,11],whistl:4,whole:[0,4,11],why:[0,4],wild:3,wise:3,within:[1,4],without:[0,3,4,5,11],wno:4,word:3,work:[0,1,3,4],worst:4,would:[0,1,4,5],wrapper:[0,4,8],wrong:1,www:4,year:0,you:[0,1,3,4,5,7,8],your:[0,1,3],your_modul:4,yourself:[1,4]},titles:["<code class=\"docutils literal\"><span class=\"pre\">test_actions.ActionTestCase</span></code> - Testing Actions","Building ProMod3","Changelog","ProMod3‘s Share Of CMake","Contributing","<code class=\"docutils literal\"><span class=\"pre\">helper</span></code> - Shared Functionality For the Everything","<code class=\"docutils literal\"><span class=\"pre\">core</span></code> - ProMod3 Core Functionality","<code class=\"docutils literal\"><span class=\"pre\">pm3argparse</span></code> - Parsing Command Lines","<code class=\"docutils literal\"><span class=\"pre\">SetCompoundsChemlib()</span></code>","Documentation For Developes","Welcome To ProMod3’s Documentation!","<code class=\"docutils literal\"><span class=\"pre\">rawmodel</span></code> - Coordinate Modeling","Documentation For Users"],titleterms:{"function":[3,5,6],action:[0,3,4],actiontestcas:0,api:[0,11],argument:7,branch:4,build:1,chang:2,changelog:2,cmake:[0,1,3,4],command:7,contribut:4,coordin:11,core:6,creat:0,depend:1,develop:9,directori:4,document:[3,4,9,10,12],everyth:5,execut:0,file:5,git:4,have:0,helper:5,hook:4,how:4,indic:10,integr:0,introduct:[3,5,7],issu:4,licens:4,line:7,mainten:3,make:[0,1],messag:5,model:11,modul:[3,4],must:0,output:0,own:4,pars:7,parser:7,parti:4,pm3argpars:7,promod3:[1,3,6,10],raw:11,rawmodel:11,releas:2,run:[0,1],script:0,setcompoundschemlib:8,share:[3,5],stage:4,start:4,structur:4,subclass:0,tabl:10,test:[0,3,4,5],test_act:0,third:4,unit:[0,3,4],user:12,welcom:10,write:4,your:4}}) \ No newline at end of file diff --git a/doc/html/users.html b/doc/html/users.html index c7c1665e5611c24a1897edf77b682173c6463e26..aaf3c84354abaf3ebad1e647e34e817b228ac081 100644 --- a/doc/html/users.html +++ b/doc/html/users.html @@ -8,7 +8,7 @@ <title>Documentation For Users — ProMod3 0 documentation</title> - <link rel="stylesheet" href="_static/default.css" type="text/css" /> + <link rel="stylesheet" href="_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="_static/pygments.css" type="text/css" /> <script type="text/javascript"> @@ -25,10 +25,14 @@ <script type="text/javascript" src="_static/doctools.js"></script> <link rel="top" title="ProMod3 0 documentation" href="index.html" /> <link rel="next" title="Documentation For Developes" href="developers.html" /> - <link rel="prev" title="Welcome To ProMod3’s Documentation!" href="index.html" /> + <link rel="prev" title="Welcome To ProMod3’s Documentation!" href="index.html" /> + + + <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9"> + </head> - <body> - <div class="related"> + <body role="document"> + <div class="related" role="navigation" aria-label="related navigation"> <h3>Navigation</h3> <ul> <li class="right" style="margin-right: 10px"> @@ -43,14 +47,14 @@ <li class="right" > <a href="index.html" title="Welcome To ProMod3’s Documentation!" accesskey="P">previous</a> |</li> - <li><a href="index.html">ProMod3 0 documentation</a> »</li> + <li class="nav-item nav-item-0"><a href="index.html">ProMod3 0 documentation</a> »</li> </ul> </div> <div class="document"> <div class="documentwrapper"> <div class="bodywrapper"> - <div class="body"> + <div class="body" role="main"> <div class="section" id="documentation-for-users"> <h1>Documentation For Users<a class="headerlink" href="#documentation-for-users" title="Permalink to this headline">¶</a></h1> @@ -60,7 +64,7 @@ </div> </div> </div> - <div class="sphinxsidebar"> + <div class="sphinxsidebar" role="navigation" aria-label="main navigation"> <div class="sphinxsidebarwrapper"> <h4>Previous topic</h4> <p class="topless"><a href="index.html" @@ -68,12 +72,14 @@ <h4>Next topic</h4> <p class="topless"><a href="developers.html" title="next chapter">Documentation For Developes</a></p> - <h3>This Page</h3> - <ul class="this-page-menu"> - <li><a href="_sources/users.txt" - rel="nofollow">Show Source</a></li> - </ul> -<div id="searchbox" style="display: none"> + <div role="note" aria-label="source link"> + <h3>This Page</h3> + <ul class="this-page-menu"> + <li><a href="_sources/users.txt" + rel="nofollow">Show Source</a></li> + </ul> + </div> +<div id="searchbox" style="display: none" role="search"> <h3>Quick search</h3> <form class="search" action="search.html" method="get"> <input type="text" name="q" /> @@ -90,28 +96,20 @@ </div> <div class="clearer"></div> </div> - <div class="related"> - <h3>Navigation</h3> - <ul> - <li class="right" style="margin-right: 10px"> - <a href="genindex.html" title="General Index" - >index</a></li> - <li class="right" > - <a href="py-modindex.html" title="Python Module Index" - >modules</a> |</li> - <li class="right" > - <a href="developers.html" title="Documentation For Developes" - >next</a> |</li> - <li class="right" > - <a href="index.html" title="Welcome To ProMod3’s Documentation!" - >previous</a> |</li> - <li><a href="index.html">ProMod3 0 documentation</a> »</li> - </ul> - </div> <div class="footer"> - © Copyright 2014, Bienchen. - Last updated on Mar 23 14:52, 2015. - Created using <a href="http://sphinx-doc.org/">Sphinx</a> 1.2.3. + ©2015, Bienchen. + + | + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.3</a> + + | + <a href="_sources/users.txt" + rel="nofollow">Page source</a></li> </div> + + + + </body> </html> \ No newline at end of file diff --git a/extras/pre_commit/pm3_csc/filecheck/base.py b/extras/pre_commit/pm3_csc/filecheck/base.py index 102b874789162173ab894550910d5338c924403b..134a5069a9cdd868b2d190555411f84381b5dd72 100644 --- a/extras/pre_commit/pm3_csc/filecheck/base.py +++ b/extras/pre_commit/pm3_csc/filecheck/base.py @@ -24,6 +24,7 @@ class FileCheck(object): """ def __init__(self, filepath): self.filepath = filepath + self.absfilepath = os.path.abspath(filepath) self.current_line = None def Check(self, ignore_line_width=False): diff --git a/extras/pre_commit/pm3_csc/filecheck/pylint-unittest-rc b/extras/pre_commit/pm3_csc/filecheck/pylint-unittest-rc index 1fae9d08dd225b7ead7244e0afd2507a12f7614c..9fbc13a8ad1c5f942c0f520d56acd811db87a803 100644 --- a/extras/pre_commit/pm3_csc/filecheck/pylint-unittest-rc +++ b/extras/pre_commit/pm3_csc/filecheck/pylint-unittest-rc @@ -173,7 +173,7 @@ module-rgx=(([a-z_][a-z0-9_]*)|([A-Z][a-zA-Z0-9]+))$ module-name-hint=(([a-z_][a-z0-9_]*)|([A-Z][a-zA-Z0-9]+))$ # Regular expression matching correct method names -method-rgx=(?:setUp|(?:[A-Z]|test[A-Z])[a-zA-Z0-9_]{2,30})$ +method-rgx=(?:setUp|(?:[_A-Z]|test[A-Z])[a-zA-Z0-9_]{2,30})$ # Naming hint for method names method-name-hint=(?:setUp|(?:[A-Z]|test[A-Z])[a-zA-Z0-9_]{2,30})$ @@ -283,7 +283,7 @@ max-parents=7 max-attributes=7 # Minimum number of public methods for a class (see R0903). -min-public-methods=2 +min-public-methods=1 # Maximum number of public methods for a class (see R0904). max-public-methods=25 diff --git a/extras/pre_commit/pm3_csc/filecheck/pylintrc b/extras/pre_commit/pm3_csc/filecheck/pylintrc index 66347b07c03d811f78ebcd2f93b44d80de13dc73..b9244937e453b7f8865f36d5e7778372b66c1fd5 100644 --- a/extras/pre_commit/pm3_csc/filecheck/pylintrc +++ b/extras/pre_commit/pm3_csc/filecheck/pylintrc @@ -290,7 +290,7 @@ max-attributes=7 min-public-methods=2 # Maximum number of public methods for a class (see R0904). -max-public-methods=20 +max-public-methods=21 [IMPORTS] diff --git a/extras/pre_commit/pm3_csc/filecheck/python.py b/extras/pre_commit/pm3_csc/filecheck/python.py index 71b864dffe4849d3ed52d62eec204c2cf30a5907..b860ce9eeb938f5817e2e2f3874ee171bc0175af 100644 --- a/extras/pre_commit/pm3_csc/filecheck/python.py +++ b/extras/pre_commit/pm3_csc/filecheck/python.py @@ -14,7 +14,7 @@ class Python(base.FileCheck): def __init__(self, filepath): base.FileCheck.__init__(self, filepath) - def CheckPylint(self, outline): + def CheckPylint(self, outline, rcfile): """ Translate Pylint messages to something more meaningful. @@ -26,7 +26,9 @@ class Python(base.FileCheck): pm3_csc.FailMsg("ERROR in parsing pylint output, message seems to"+ "contain more than one ':': '%s'" % outline, 15) # for the message translation, we provide tags %(line)s and %(file)s, - # they will be filled if a message gets invoked. + # they will be filled if a message gets invoked. The original pylint + # command runs with '--msg-template="{line}:{symbol}"' to reveal the + # first bit of an entry. msg_dict = { 'missing-docstring': "Line %(line)s: Documentation is missing. We want "+ @@ -36,7 +38,7 @@ class Python(base.FileCheck): "different modules and that way we can easily see where we are.", 'unused-variable': "Line %(line)s: Variable not used. Those things just confuse "+ - "people trying reading your code. Please remove variables which "+ + "people trying to read your code. Please remove variables which "+ "do nothing.", 'bad-indentation': "Line %(line)s: Wrong indentation. Its best practice in modern "+ @@ -49,7 +51,22 @@ class Python(base.FileCheck): 'unused-import': "Line %(line)s: A module is imported but never used in the code. "+ "This increases execution time and may create an unnecessary "+ - "dependency. Please remove the import." + "dependency. Please remove the import.", + 'redefined-builtin': + "Line %(line)s: Some function or variable name is defined which "+ + "already exists in Python. This may lead to funny effects and "+ + "needs to be avoided.", + 'bad-continuation': + "Line %(line)s: A multi-line command is not aligned like Python "+ + "wants it. Usually things should all align along opening "+ + "parenthesis or similar landmarks. Sometimes this means to "+ + "introduce an awkward looking '=\\' in a function call.", + 'invalid-name': + "Line %(line)s: Some variable/ function/ parameter does not "+ + "comply with naming conventions. E.g. variables usually need at "+ + "least three characters.", + 'undefined-variable': + "Line %(line)s: Pylint found an undefined variable." } if msg[1] not in msg_dict.keys(): pm3_csc.FailMsg("Found a pylint message for the first time: "+ @@ -57,7 +74,9 @@ class Python(base.FileCheck): "the kind of issue by running 'pylint "+ "--help-msg=%s'. Once this is resolved, " % msg[1] + "you could extend '%s' with more " % __file__ + - "meaningful information.", 16) + "meaningful information. You can run pylint on "+ + "this file by 'pylint --rcfile=%s " % rcfile + + "-r n %s'." % self.absfilepath, 16) subst_dict = {'line' : msg[0], 'file' : self.filepath} return msg_dict[msg[1]] % subst_dict @@ -93,13 +112,15 @@ class Python(base.FileCheck): for line in sout.splitlines(): if line.startswith('*************'): continue - msg_stack.append(self.CheckPylint(line)) + msg_stack.append(self.CheckPylint(line, pylintrc)) for line in serr.splitlines(): if line.startswith('*************'): continue - msg_stack.append(self.CheckPylint(line)) + msg_stack.append(self.CheckPylint(line, pylintrc)) if len(msg_stack): pm3_csc.FailMsg(os.linesep + "Found issues:" + os.linesep + os.linesep.join(msg_stack), 17) __all__ = ('Python', ) + +# LocalWords: multi diff --git a/extras/pre_commit/pm3_csc/filecheck/rest.py b/extras/pre_commit/pm3_csc/filecheck/rest.py index 0ae713cc18da993e899f8c781778a09aaf34f922..315c2f86dfde1eb55012e147454bf298adcb6391 100644 --- a/extras/pre_commit/pm3_csc/filecheck/rest.py +++ b/extras/pre_commit/pm3_csc/filecheck/rest.py @@ -24,7 +24,9 @@ class Rest(base.FileCheck): if re_head1.match(line) and len(last_line): ma_title = re_title1.match(last_line) if ma_title: - wl_title = ma_title.group(1).split(' ()') + wl_title = ma_title.group(1).replace("(", " ") + wl_title = wl_title.replace(")", " ") + wl_title = wl_title.split() for wrd in wl_title: if wrd not in ['-', 'a', 'an', 'the'] and wrd[0] != '|': if re.match(r':.+:`.+`', wrd): @@ -39,7 +41,8 @@ class Rest(base.FileCheck): "of, to, ...' are written "+ "uppercase since those are "+ "prepositions like 'around, "+ - "under'.", 16) + "under'. Look for '%s'" % wrd, + 16) last_line = line __all__ = ('Rest', ) diff --git a/extras/pre_commit/pm3_csc/git.py b/extras/pre_commit/pm3_csc/git.py index 0f2f77cbb2e215020a3da4ced402a40ca99d3bf6..c6097e796fd8248404476f982aebe4d2461c6ecf 100644 --- a/extras/pre_commit/pm3_csc/git.py +++ b/extras/pre_commit/pm3_csc/git.py @@ -98,7 +98,8 @@ def _GetFileType(filepath): 'CMakeLists.txt' : 'cmake', '.cmake' : 'cmake', '.pdb' : 'ukn', - '.fasta' : 'ukn'} + '.fasta' : 'ukn', + '.fas' : 'ukn'} for ext in known_extensions.keys(): if filepath.endswith(ext): return known_extensions[ext] diff --git a/scripts/CMakeLists.txt b/scripts/CMakeLists.txt index 29c561532e6d478739aa73998fbd4ebe2edfbb68..a2f36dcc9ddf9c1b489c6759c9d9078c1e5f8814 100644 --- a/scripts/CMakeLists.txt +++ b/scripts/CMakeLists.txt @@ -19,4 +19,6 @@ foreach(_pm3_script PROMOD3_SCRIPTS) list(APPEND _PROMOD3_BUILD_SCRIPTS ${_pm3_script}) endforeach() +add_dependencies(codetest promod3_scripts) + install(FILES ${PROMOD3_BUILD_SCRIPTS} DESTINATION "bin/") diff --git a/scripts/pm.in b/scripts/pm.in index ea20068de4a12cd2364092e7fef4a44684d883f3..52fbada825501aa9a5779a118716904cf27d33d7 100755 --- a/scripts/pm.in +++ b/scripts/pm.in @@ -36,6 +36,7 @@ else case "$ACTION_BASENAME" in *.py ) python "$ACTION" $@;; * ) echo "Unknown action '${ACTION}'" - echo "type 'pm help' to get started" ;; + echo "type 'pm help' to get started" + exit 1 ;; esac fi