From 7982dfb4be12e194c7dc8b89242b64b422b0a15f Mon Sep 17 00:00:00 2001 From: Gerardo Tauriello <gerardo.tauriello@unibas.ch> Date: Sun, 2 Dec 2018 06:42:46 +0100 Subject: [PATCH] Updated static doc for new version --- doc/html/_modules/index.html | 17 +- doc/html/_modules/promod3.html | 27 +- doc/html/_modules/promod3/core/helper.html | 19 +- .../_modules/promod3/core/pm3argparse.html | 19 +- .../promod3/modelling/_closegaps.html | 19 +- .../_modules/promod3/modelling/_denovo.html | 19 +- .../promod3/modelling/_fragger_handle.html | 19 +- .../promod3/modelling/_molprobity.html | 19 +- .../promod3/modelling/_monte_carlo.html | 19 +- .../_modules/promod3/modelling/_pipeline.html | 19 +- .../modelling/_reconstruct_sidechains.html | 19 +- .../promod3/modelling/_ring_punches.html | 19 +- doc/html/_modules/test_actions.html | 19 +- doc/html/_sources/buildsystem.txt | 15 +- doc/html/_static/alabaster.css | 26 +- doc/html/_static/basic.css | 9 + doc/html/_static/custom.css | 1 + doc/html/_static/doctools.js | 26 +- doc/html/_static/jquery-1.11.1.js | 10308 +++++++++++++++ doc/html/_static/jquery.js | 10355 +--------------- doc/html/_static/searchtools.js | 4 +- doc/html/_static/underscore-1.3.1.js | 999 ++ doc/html/_static/underscore.js | 1446 +-- doc/html/_static/websupport.js | 2 +- doc/html/actions/index.html | 31 +- doc/html/actions/index_dev.html | 63 +- doc/html/buildsystem.html | 37 +- doc/html/changelog.html | 17 +- doc/html/cmake/index.html | 31 +- doc/html/container/docker.html | 31 +- doc/html/container/index.html | 17 +- doc/html/container/singularity.html | 37 +- doc/html/contributing.html | 75 +- doc/html/core/geometry.html | 17 +- doc/html/core/graph_minimizer.html | 19 +- doc/html/core/helper.html | 27 +- doc/html/core/index.html | 17 +- doc/html/core/pm3argparse.html | 25 +- doc/html/core/runtime_profiling.html | 17 +- doc/html/core/setcompoundschemlib.html | 17 +- doc/html/dev_setup.html | 47 +- doc/html/developers.html | 17 +- doc/html/genindex.html | 17 +- doc/html/gettingstarted.html | 27 +- doc/html/index.html | 17 +- doc/html/license.html | 19 +- doc/html/loop/all_atom.html | 21 +- doc/html/loop/backbone.html | 29 +- doc/html/loop/index.html | 33 +- doc/html/loop/load_loop_objects.html | 17 +- doc/html/loop/mm_system_creation.html | 33 +- doc/html/loop/structure_db.html | 43 +- doc/html/loop/torsion_sampler.html | 29 +- doc/html/modelling/algorithms.html | 17 +- doc/html/modelling/gap_handling.html | 19 +- doc/html/modelling/index.html | 21 +- doc/html/modelling/loop_candidates.html | 59 +- doc/html/modelling/loop_closing.html | 23 +- doc/html/modelling/model_checking.html | 19 +- doc/html/modelling/monte_carlo.html | 43 +- doc/html/modelling/pipeline.html | 63 +- .../modelling/sidechain_reconstruction.html | 31 +- doc/html/objects.inv | Bin 6497 -> 7474 bytes doc/html/portableIO.html | 23 +- doc/html/py-modindex.html | 17 +- doc/html/references.html | 17 +- doc/html/scoring/all_atom_scorers.html | 25 +- doc/html/scoring/backbone_score_env.html | 17 +- doc/html/scoring/backbone_scorers.html | 41 +- doc/html/scoring/index.html | 25 +- doc/html/scoring/other_scoring_functions.html | 17 +- doc/html/search.html | 14 +- doc/html/searchindex.js | 2 +- doc/html/sidechain/disulfid.html | 17 +- doc/html/sidechain/frame.html | 17 +- doc/html/sidechain/graph.html | 17 +- doc/html/sidechain/index.html | 25 +- doc/html/sidechain/loading.html | 17 +- doc/html/sidechain/rotamer.html | 17 +- doc/html/sidechain/rotamer_constructor.html | 17 +- doc/html/sidechain/rotamer_id.html | 17 +- doc/html/sidechain/rotamer_lib.html | 25 +- doc/html/sidechain/subrotamer_optimizer.html | 17 +- doc/html/users.html | 17 +- 84 files changed, 12259 insertions(+), 12708 deletions(-) create mode 100644 doc/html/_static/custom.css create mode 100644 doc/html/_static/jquery-1.11.1.js create mode 100644 doc/html/_static/underscore-1.3.1.js diff --git a/doc/html/_modules/index.html b/doc/html/_modules/index.html index 138cf9cd..34b3643f 100644 --- a/doc/html/_modules/index.html +++ b/doc/html/_modules/index.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Overview: module code — ProMod3 1.2.0 documentation</title> + <title>Overview: module code — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,13 +24,15 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -143,9 +145,6 @@ <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -156,8 +155,8 @@ ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> </div> diff --git a/doc/html/_modules/promod3.html b/doc/html/_modules/promod3.html index da882aa2..8a204800 100644 --- a/doc/html/_modules/promod3.html +++ b/doc/html/_modules/promod3.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>promod3 — ProMod3 1.2.0 documentation</title> + <title>promod3 — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,14 +24,16 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="Module code" href="index.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -39,7 +41,7 @@ <div class="body" role="main"> <h1>Source code for promod3</h1><div class="highlight"><pre> -<span class="c1"># Copyright (c) 2013-2018, SIB - Swiss Institute of Bioinformatics and </span> +<span></span><span class="c1"># Copyright (c) 2013-2018, SIB - Swiss Institute of Bioinformatics and </span> <span class="c1"># Biozentrum - University of Basel</span> <span class="c1"># </span> <span class="c1"># Licensed under the Apache License, Version 2.0 (the "License");</span> @@ -69,7 +71,7 @@ <span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">conop</span> <span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span> -<div class="viewcode-block" id="SetCompoundsChemlib"><a class="viewcode-back" href="../core/setcompoundschemlib.html#promod3.SetCompoundsChemlib">[docs]</a><span class="k">def</span> <span class="nf">SetCompoundsChemlib</span><span class="p">(</span><span class="n">path_to_chemlib</span><span class="o">=</span><span class="s2">"/home/schdaude/prog/ost/build/stage/share/openstructure/compounds.chemlib"</span><span class="p">):</span> +<div class="viewcode-block" id="SetCompoundsChemlib"><a class="viewcode-back" href="../core/setcompoundschemlib.html#promod3.SetCompoundsChemlib">[docs]</a><span class="k">def</span> <span class="nf">SetCompoundsChemlib</span><span class="p">(</span><span class="n">path_to_chemlib</span><span class="o">=</span><span class="s2">"/home/taurielg/GT/Code/ost/build/stage/share/openstructure/compounds.chemlib"</span><span class="p">):</span> <span class="sd">"""SetCompoundsChemlib(path_to_chemlib)</span> <span class="sd"> Load a compounds library. Does not return anything, the library is just</span> <span class="sd"> enabled globally.</span> @@ -103,7 +105,7 @@ <span class="k">try</span><span class="p">:</span> <span class="n">ost</span><span class="o">.</span><span class="n">GetSharedDataPath</span><span class="p">()</span> <span class="k">except</span> <span class="ne">RuntimeError</span><span class="p">,</span> <span class="n">rt_err</span><span class="p">:</span> - <span class="n">ost</span><span class="o">.</span><span class="n">SetPrefixPath</span><span class="p">(</span><span class="s2">"/home/schdaude/prog/ost/build/stage"</span><span class="p">)</span> + <span class="n">ost</span><span class="o">.</span><span class="n">SetPrefixPath</span><span class="p">(</span><span class="s2">"/home/taurielg/GT/Code/ost/build/stage"</span><span class="p">)</span> <span class="k">except</span><span class="p">:</span> <span class="k">raise</span> @@ -121,8 +123,8 @@ <span class="n">SetProMod3SharedDataPath</span><span class="p">(</span><span class="n">os</span><span class="o">.</span><span class="n">path</span><span class="o">.</span><span class="n">join</span><span class="p">(</span><span class="n">promod3_root</span><span class="p">,</span> <span class="s2">"share"</span><span class="p">,</span> <span class="s2">"promod3"</span><span class="p">))</span> <span class="c1"># set version</span> -<span class="n">__version__</span> <span class="o">=</span> <span class="s2">"1.2.0"</span> -<span class="n">__version_extended__</span> <span class="o">=</span> <span class="s2">"1.2.0 (develop|58db1e5)"</span> +<span class="n">__version__</span> <span class="o">=</span> <span class="s2">"1.3.0"</span> +<span class="n">__version_extended__</span> <span class="o">=</span> <span class="s2">"1.3.0 (release-1.3.0|01e00a8)"</span> <span class="n">__all__</span> <span class="o">=</span> <span class="p">(</span><span class="s1">'SetCompoundsChemlib'</span><span class="p">,</span> <span class="s1">'GetProMod3SharedDataPath'</span><span class="p">,</span> <span class="s1">'SetProMod3SharedDataPath'</span><span class="p">)</span> @@ -153,9 +155,6 @@ <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -166,8 +165,8 @@ ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> </div> diff --git a/doc/html/_modules/promod3/core/helper.html b/doc/html/_modules/promod3/core/helper.html index a9658001..6b8aadaa 100644 --- a/doc/html/_modules/promod3/core/helper.html +++ b/doc/html/_modules/promod3/core/helper.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>promod3.core.helper — ProMod3 1.2.0 documentation</title> + <title>promod3.core.helper — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../../../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../../../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../../../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,14 +24,16 @@ <script type="text/javascript" src="../../../_static/underscore.js"></script> <script type="text/javascript" src="../../../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../../../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../../../index.html" /> <link rel="up" title="promod3" href="../../promod3.html" /> + <link rel="stylesheet" href="../../../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -39,7 +41,7 @@ <div class="body" role="main"> <h1>Source code for promod3.core.helper</h1><div class="highlight"><pre> -<span class="c1"># Copyright (c) 2013-2018, SIB - Swiss Institute of Bioinformatics and </span> +<span></span><span class="c1"># Copyright (c) 2013-2018, SIB - Swiss Institute of Bioinformatics and </span> <span class="c1"># Biozentrum - University of Basel</span> <span class="c1"># </span> <span class="c1"># Licensed under the Apache License, Version 2.0 (the "License");</span> @@ -239,9 +241,6 @@ <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -252,8 +251,8 @@ ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> </div> diff --git a/doc/html/_modules/promod3/core/pm3argparse.html b/doc/html/_modules/promod3/core/pm3argparse.html index 0905f2ca..8f04b467 100644 --- a/doc/html/_modules/promod3/core/pm3argparse.html +++ b/doc/html/_modules/promod3/core/pm3argparse.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>promod3.core.pm3argparse — ProMod3 1.2.0 documentation</title> + <title>promod3.core.pm3argparse — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../../../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../../../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../../../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,14 +24,16 @@ <script type="text/javascript" src="../../../_static/underscore.js"></script> <script type="text/javascript" src="../../../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../../../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../../../index.html" /> <link rel="up" title="promod3" href="../../promod3.html" /> + <link rel="stylesheet" href="../../../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -39,7 +41,7 @@ <div class="body" role="main"> <h1>Source code for promod3.core.pm3argparse</h1><div class="highlight"><pre> -<span class="c1"># Copyright (c) 2013-2018, SIB - Swiss Institute of Bioinformatics and </span> +<span></span><span class="c1"># Copyright (c) 2013-2018, SIB - Swiss Institute of Bioinformatics and </span> <span class="c1"># Biozentrum - University of Basel</span> <span class="c1"># </span> <span class="c1"># Licensed under the Apache License, Version 2.0 (the "License");</span> @@ -834,9 +836,6 @@ <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -847,8 +846,8 @@ ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> </div> diff --git a/doc/html/_modules/promod3/modelling/_closegaps.html b/doc/html/_modules/promod3/modelling/_closegaps.html index 88a45e13..f7cc176c 100644 --- a/doc/html/_modules/promod3/modelling/_closegaps.html +++ b/doc/html/_modules/promod3/modelling/_closegaps.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>promod3.modelling._closegaps — ProMod3 1.2.0 documentation</title> + <title>promod3.modelling._closegaps — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../../../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../../../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../../../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,14 +24,16 @@ <script type="text/javascript" src="../../../_static/underscore.js"></script> <script type="text/javascript" src="../../../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../../../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../../../index.html" /> <link rel="up" title="promod3" href="../../promod3.html" /> + <link rel="stylesheet" href="../../../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -39,7 +41,7 @@ <div class="body" role="main"> <h1>Source code for promod3.modelling._closegaps</h1><div class="highlight"><pre> -<span class="c1"># Copyright (c) 2013-2018, SIB - Swiss Institute of Bioinformatics and </span> +<span></span><span class="c1"># Copyright (c) 2013-2018, SIB - Swiss Institute of Bioinformatics and </span> <span class="c1"># Biozentrum - University of Basel</span> <span class="c1"># </span> <span class="c1"># Licensed under the Apache License, Version 2.0 (the "License");</span> @@ -1635,9 +1637,6 @@ <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -1648,8 +1647,8 @@ ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> </div> diff --git a/doc/html/_modules/promod3/modelling/_denovo.html b/doc/html/_modules/promod3/modelling/_denovo.html index 8c1bfe5e..efcbd769 100644 --- a/doc/html/_modules/promod3/modelling/_denovo.html +++ b/doc/html/_modules/promod3/modelling/_denovo.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>promod3.modelling._denovo — ProMod3 1.2.0 documentation</title> + <title>promod3.modelling._denovo — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../../../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../../../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../../../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,14 +24,16 @@ <script type="text/javascript" src="../../../_static/underscore.js"></script> <script type="text/javascript" src="../../../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../../../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../../../index.html" /> <link rel="up" title="promod3" href="../../promod3.html" /> + <link rel="stylesheet" href="../../../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -39,7 +41,7 @@ <div class="body" role="main"> <h1>Source code for promod3.modelling._denovo</h1><div class="highlight"><pre> -<span class="c1"># Copyright (c) 2013-2018, SIB - Swiss Institute of Bioinformatics and </span> +<span></span><span class="c1"># Copyright (c) 2013-2018, SIB - Swiss Institute of Bioinformatics and </span> <span class="c1"># Biozentrum - University of Basel</span> <span class="c1"># </span> <span class="c1"># Licensed under the Apache License, Version 2.0 (the "License");</span> @@ -208,9 +210,6 @@ <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -221,8 +220,8 @@ ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> </div> diff --git a/doc/html/_modules/promod3/modelling/_fragger_handle.html b/doc/html/_modules/promod3/modelling/_fragger_handle.html index 2ffd9280..8b753363 100644 --- a/doc/html/_modules/promod3/modelling/_fragger_handle.html +++ b/doc/html/_modules/promod3/modelling/_fragger_handle.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>promod3.modelling._fragger_handle — ProMod3 1.2.0 documentation</title> + <title>promod3.modelling._fragger_handle — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../../../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../../../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../../../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,14 +24,16 @@ <script type="text/javascript" src="../../../_static/underscore.js"></script> <script type="text/javascript" src="../../../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../../../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../../../index.html" /> <link rel="up" title="promod3" href="../../promod3.html" /> + <link rel="stylesheet" href="../../../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -39,7 +41,7 @@ <div class="body" role="main"> <h1>Source code for promod3.modelling._fragger_handle</h1><div class="highlight"><pre> -<span class="c1"># Copyright (c) 2013-2018, SIB - Swiss Institute of Bioinformatics and </span> +<span></span><span class="c1"># Copyright (c) 2013-2018, SIB - Swiss Institute of Bioinformatics and </span> <span class="c1"># Biozentrum - University of Basel</span> <span class="c1"># </span> <span class="c1"># Licensed under the Apache License, Version 2.0 (the "License");</span> @@ -431,9 +433,6 @@ <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -444,8 +443,8 @@ ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> </div> diff --git a/doc/html/_modules/promod3/modelling/_molprobity.html b/doc/html/_modules/promod3/modelling/_molprobity.html index bd5ebc58..d06f4a24 100644 --- a/doc/html/_modules/promod3/modelling/_molprobity.html +++ b/doc/html/_modules/promod3/modelling/_molprobity.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>promod3.modelling._molprobity — ProMod3 1.2.0 documentation</title> + <title>promod3.modelling._molprobity — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../../../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../../../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../../../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,14 +24,16 @@ <script type="text/javascript" src="../../../_static/underscore.js"></script> <script type="text/javascript" src="../../../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../../../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../../../index.html" /> <link rel="up" title="promod3" href="../../promod3.html" /> + <link rel="stylesheet" href="../../../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -39,7 +41,7 @@ <div class="body" role="main"> <h1>Source code for promod3.modelling._molprobity</h1><div class="highlight"><pre> -<span class="c1"># Copyright (c) 2013-2018, SIB - Swiss Institute of Bioinformatics and </span> +<span></span><span class="c1"># Copyright (c) 2013-2018, SIB - Swiss Institute of Bioinformatics and </span> <span class="c1"># Biozentrum - University of Basel</span> <span class="c1"># </span> <span class="c1"># Licensed under the Apache License, Version 2.0 (the "License");</span> @@ -197,9 +199,6 @@ <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -210,8 +209,8 @@ ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> </div> diff --git a/doc/html/_modules/promod3/modelling/_monte_carlo.html b/doc/html/_modules/promod3/modelling/_monte_carlo.html index a49d8de7..f7f1be54 100644 --- a/doc/html/_modules/promod3/modelling/_monte_carlo.html +++ b/doc/html/_modules/promod3/modelling/_monte_carlo.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>promod3.modelling._monte_carlo — ProMod3 1.2.0 documentation</title> + <title>promod3.modelling._monte_carlo — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../../../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../../../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../../../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,14 +24,16 @@ <script type="text/javascript" src="../../../_static/underscore.js"></script> <script type="text/javascript" src="../../../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../../../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../../../index.html" /> <link rel="up" title="promod3" href="../../promod3.html" /> + <link rel="stylesheet" href="../../../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -39,7 +41,7 @@ <div class="body" role="main"> <h1>Source code for promod3.modelling._monte_carlo</h1><div class="highlight"><pre> -<span class="c1"># Copyright (c) 2013-2018, SIB - Swiss Institute of Bioinformatics and </span> +<span></span><span class="c1"># Copyright (c) 2013-2018, SIB - Swiss Institute of Bioinformatics and </span> <span class="c1"># Biozentrum - University of Basel</span> <span class="c1"># </span> <span class="c1"># Licensed under the Apache License, Version 2.0 (the "License");</span> @@ -170,9 +172,6 @@ <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -183,8 +182,8 @@ ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> </div> diff --git a/doc/html/_modules/promod3/modelling/_pipeline.html b/doc/html/_modules/promod3/modelling/_pipeline.html index 97fed14b..fa63da28 100644 --- a/doc/html/_modules/promod3/modelling/_pipeline.html +++ b/doc/html/_modules/promod3/modelling/_pipeline.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>promod3.modelling._pipeline — ProMod3 1.2.0 documentation</title> + <title>promod3.modelling._pipeline — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../../../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../../../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../../../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,14 +24,16 @@ <script type="text/javascript" src="../../../_static/underscore.js"></script> <script type="text/javascript" src="../../../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../../../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../../../index.html" /> <link rel="up" title="promod3" href="../../promod3.html" /> + <link rel="stylesheet" href="../../../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -39,7 +41,7 @@ <div class="body" role="main"> <h1>Source code for promod3.modelling._pipeline</h1><div class="highlight"><pre> -<span class="c1"># Copyright (c) 2013-2018, SIB - Swiss Institute of Bioinformatics and </span> +<span></span><span class="c1"># Copyright (c) 2013-2018, SIB - Swiss Institute of Bioinformatics and </span> <span class="c1"># Biozentrum - University of Basel</span> <span class="c1"># </span> <span class="c1"># Licensed under the Apache License, Version 2.0 (the "License");</span> @@ -577,9 +579,6 @@ <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -590,8 +589,8 @@ ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> </div> diff --git a/doc/html/_modules/promod3/modelling/_reconstruct_sidechains.html b/doc/html/_modules/promod3/modelling/_reconstruct_sidechains.html index 22bbfa1a..61d1d54b 100644 --- a/doc/html/_modules/promod3/modelling/_reconstruct_sidechains.html +++ b/doc/html/_modules/promod3/modelling/_reconstruct_sidechains.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>promod3.modelling._reconstruct_sidechains — ProMod3 1.2.0 documentation</title> + <title>promod3.modelling._reconstruct_sidechains — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../../../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../../../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../../../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,14 +24,16 @@ <script type="text/javascript" src="../../../_static/underscore.js"></script> <script type="text/javascript" src="../../../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../../../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../../../index.html" /> <link rel="up" title="promod3" href="../../promod3.html" /> + <link rel="stylesheet" href="../../../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -39,7 +41,7 @@ <div class="body" role="main"> <h1>Source code for promod3.modelling._reconstruct_sidechains</h1><div class="highlight"><pre> -<span class="c1"># Copyright (c) 2013-2018, SIB - Swiss Institute of Bioinformatics and </span> +<span></span><span class="c1"># Copyright (c) 2013-2018, SIB - Swiss Institute of Bioinformatics and </span> <span class="c1"># Biozentrum - University of Basel</span> <span class="c1"># </span> <span class="c1"># Licensed under the Apache License, Version 2.0 (the "License");</span> @@ -601,9 +603,6 @@ <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -614,8 +613,8 @@ ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> </div> diff --git a/doc/html/_modules/promod3/modelling/_ring_punches.html b/doc/html/_modules/promod3/modelling/_ring_punches.html index 8c31c33b..810839fc 100644 --- a/doc/html/_modules/promod3/modelling/_ring_punches.html +++ b/doc/html/_modules/promod3/modelling/_ring_punches.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>promod3.modelling._ring_punches — ProMod3 1.2.0 documentation</title> + <title>promod3.modelling._ring_punches — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../../../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../../../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../../../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,14 +24,16 @@ <script type="text/javascript" src="../../../_static/underscore.js"></script> <script type="text/javascript" src="../../../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../../../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../../../index.html" /> <link rel="up" title="promod3" href="../../promod3.html" /> + <link rel="stylesheet" href="../../../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -39,7 +41,7 @@ <div class="body" role="main"> <h1>Source code for promod3.modelling._ring_punches</h1><div class="highlight"><pre> -<span class="c1"># Copyright (c) 2013-2018, SIB - Swiss Institute of Bioinformatics and </span> +<span></span><span class="c1"># Copyright (c) 2013-2018, SIB - Swiss Institute of Bioinformatics and </span> <span class="c1"># Biozentrum - University of Basel</span> <span class="c1"># </span> <span class="c1"># Licensed under the Apache License, Version 2.0 (the "License");</span> @@ -316,9 +318,6 @@ <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -329,8 +328,8 @@ ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> </div> diff --git a/doc/html/_modules/test_actions.html b/doc/html/_modules/test_actions.html index ea2f10de..8e193e5e 100644 --- a/doc/html/_modules/test_actions.html +++ b/doc/html/_modules/test_actions.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>test_actions — ProMod3 1.2.0 documentation</title> + <title>test_actions — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,14 +24,16 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="Module code" href="index.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -39,7 +41,7 @@ <div class="body" role="main"> <h1>Source code for test_actions</h1><div class="highlight"><pre> -<span class="c1"># Copyright (c) 2013-2018, SIB - Swiss Institute of Bioinformatics and </span> +<span></span><span class="c1"># Copyright (c) 2013-2018, SIB - Swiss Institute of Bioinformatics and </span> <span class="c1"># Biozentrum - University of Basel</span> <span class="c1"># </span> <span class="c1"># Licensed under the Apache License, Version 2.0 (the "License");</span> @@ -205,9 +207,6 @@ <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -218,8 +217,8 @@ ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> </div> diff --git a/doc/html/_sources/buildsystem.txt b/doc/html/_sources/buildsystem.txt index 11430700..7f975230 100644 --- a/doc/html/_sources/buildsystem.txt +++ b/doc/html/_sources/buildsystem.txt @@ -23,18 +23,15 @@ Building |project| Dependencies -------------------------------------------------------------------------------- -|project| is build on top of |ost_l|_ (|ost_s|), requiring at least version -1.7. |ost_s| must be configured and compiled with ``ENABLE_MM=1`` to use |openmm|_. -To create the build system, |cmake|_ is required in version -2.8.7 or higher. |python|_ works well from version 2.7. For |ost_s| and the -|C++| bit of |project|, |boost|_ is required in version 1.53.0 (the same as -used for |ost_s|). Also |eigen3|_ is needed. To build -documentation, |sphinx|_ 1.2b1 is required. - +|project| is build on top of |ost_l|_ (|ost_s|), requiring at least version 1.8. +|ost_s| must be configured and compiled with ``ENABLE_MM=1`` to use |openmm|_. +To create the build system, |cmake|_ is required. The same versions of |python|_ +and |boost|_ are needed as used in |ost_s|. For |eigen3|_ we need at least +version 3.3.0. To build the documentation, |sphinx|_ is required. The currently preferred versions are: -* |ost_s|_ 1.7 +* |ost_s|_ 1.9 * |openmm|_ 7.1.1 * |cmake|_ 2.8.12 * |python|_ 2.7.5 diff --git a/doc/html/_static/alabaster.css b/doc/html/_static/alabaster.css index bc420a48..517cb43e 100644 --- a/doc/html/_static/alabaster.css +++ b/doc/html/_static/alabaster.css @@ -28,6 +28,7 @@ body { padding: 0; } + div.document { width: 940px; margin: 30px auto 0 auto; @@ -44,6 +45,8 @@ div.bodywrapper { div.sphinxsidebar { width: 220px; + font-size: 14px; + line-height: 1.5; } hr { @@ -72,6 +75,11 @@ div.footer a { color: #888; } +p.caption { + font-family: ; + font-size: inherit; +} + div.relations { display: none; @@ -88,11 +96,6 @@ div.sphinxsidebar a:hover { border-bottom: 1px solid #999; } -div.sphinxsidebar { - font-size: 14px; - line-height: 1.5; -} - div.sphinxsidebarwrapper { padding: 18px 10px; } @@ -359,7 +362,7 @@ table.field-list p { } table.footnote td.label { - width: 0px; + width: .1px; padding: 0.3em 0 0.3em 0.5em; } @@ -382,6 +385,7 @@ blockquote { } ul, ol { + /* Matches the 30px from the narrow-screen "li > ul" selector below */ margin: 10px 0 10px 30px; padding: 0; } @@ -419,6 +423,11 @@ a.reference { border-bottom: 1px dotted #004B6B; } +/* Don't put an underline on images */ +a.image-reference, a.image-reference:hover { + border-bottom: none; +} + a.reference:hover { border-bottom: 1px solid #6D4100; } @@ -468,6 +477,11 @@ a:hover tt, a:hover code { margin-left: 0; } + li > ul { + /* Matches the 30px from the "ul, ol" selector above */ + margin-left: 30px; + } + .document { width: auto; } diff --git a/doc/html/_static/basic.css b/doc/html/_static/basic.css index c89fc7e9..65dfd7df 100644 --- a/doc/html/_static/basic.css +++ b/doc/html/_static/basic.css @@ -52,6 +52,8 @@ div.sphinxsidebar { width: 230px; margin-left: -100%; font-size: 90%; + word-wrap: break-word; + overflow-wrap : break-word; } div.sphinxsidebar ul { @@ -187,6 +189,13 @@ div.genindex-jumpbox { /* -- general body styles --------------------------------------------------- */ +div.body p, div.body dd, div.body li, div.body blockquote { + -moz-hyphens: auto; + -ms-hyphens: auto; + -webkit-hyphens: auto; + hyphens: auto; +} + a.headerlink { visibility: hidden; } diff --git a/doc/html/_static/custom.css b/doc/html/_static/custom.css new file mode 100644 index 00000000..2a924f1d --- /dev/null +++ b/doc/html/_static/custom.css @@ -0,0 +1 @@ +/* This file intentionally left blank. */ diff --git a/doc/html/_static/doctools.js b/doc/html/_static/doctools.js index e2e70cc2..81634956 100644 --- a/doc/html/_static/doctools.js +++ b/doc/html/_static/doctools.js @@ -124,6 +124,7 @@ var Documentation = { this.fixFirefoxAnchorBug(); this.highlightSearchWords(); this.initIndexTable(); + }, /** @@ -252,6 +253,29 @@ var Documentation = { }); var url = parts.join('/'); return path.substring(url.lastIndexOf('/') + 1, path.length - 1); + }, + + initOnKeyListeners: function() { + $(document).keyup(function(event) { + var activeElementType = document.activeElement.tagName; + // don't navigate when in search box or textarea + if (activeElementType !== 'TEXTAREA' && activeElementType !== 'INPUT' && activeElementType !== 'SELECT') { + switch (event.keyCode) { + case 37: // left + var prevHref = $('link[rel="prev"]').prop('href'); + if (prevHref) { + window.location.href = prevHref; + return false; + } + case 39: // right + var nextHref = $('link[rel="next"]').prop('href'); + if (nextHref) { + window.location.href = nextHref; + return false; + } + } + } + }); } }; @@ -260,4 +284,4 @@ _ = Documentation.gettext; $(document).ready(function() { Documentation.init(); -}); +}); \ No newline at end of file diff --git a/doc/html/_static/jquery-1.11.1.js b/doc/html/_static/jquery-1.11.1.js new file mode 100644 index 00000000..d4b67f7e --- /dev/null +++ b/doc/html/_static/jquery-1.11.1.js @@ -0,0 +1,10308 @@ +/*! + * jQuery JavaScript Library v1.11.1 + * http://jquery.com/ + * + * Includes Sizzle.js + * http://sizzlejs.com/ + * + * Copyright 2005, 2014 jQuery Foundation, Inc. and other contributors + * Released under the MIT license + * http://jquery.org/license + * + * Date: 2014-05-01T17:42Z + */ + +(function( global, factory ) { + + if ( typeof module === "object" && typeof module.exports === "object" ) { + // For CommonJS and CommonJS-like environments where a proper window is present, + // execute the factory and get jQuery + // For environments that do not inherently posses a window with a document + // (such as Node.js), expose a jQuery-making factory as module.exports + // This accentuates the need for the creation of a real window + // e.g. var jQuery = require("jquery")(window); + // See ticket #14549 for more info + module.exports = global.document ? + factory( global, true ) : + function( w ) { + if ( !w.document ) { + throw new Error( "jQuery requires a window with a document" ); + } + return factory( w ); + }; + } else { + factory( global ); + } + +// Pass this if window is not defined yet +}(typeof window !== "undefined" ? window : this, function( window, noGlobal ) { + +// Can't do this because several apps including ASP.NET trace +// the stack via arguments.caller.callee and Firefox dies if +// you try to trace through "use strict" call chains. (#13335) +// Support: Firefox 18+ +// + +var deletedIds = []; + +var slice = deletedIds.slice; + +var concat = deletedIds.concat; + +var push = deletedIds.push; + +var indexOf = deletedIds.indexOf; + +var class2type = {}; + +var toString = class2type.toString; + +var hasOwn = class2type.hasOwnProperty; + +var support = {}; + + + +var + version = "1.11.1", + + // Define a local copy of jQuery + jQuery = function( selector, context ) { + // The jQuery object is actually just the init constructor 'enhanced' + // Need init if jQuery is called (just allow error to be thrown if not included) + return new jQuery.fn.init( selector, context ); + }, + + // Support: Android<4.1, IE<9 + // Make sure we trim BOM and NBSP + rtrim = /^[\s\uFEFF\xA0]+|[\s\uFEFF\xA0]+$/g, + + // Matches dashed string for camelizing + rmsPrefix = /^-ms-/, + rdashAlpha = /-([\da-z])/gi, + + // Used by jQuery.camelCase as callback to replace() + fcamelCase = function( all, letter ) { + return letter.toUpperCase(); + }; + +jQuery.fn = jQuery.prototype = { + // The current version of jQuery being used + jquery: version, + + constructor: jQuery, + + // Start with an empty selector + selector: "", + + // The default length of a jQuery object is 0 + length: 0, + + toArray: function() { + return slice.call( this ); + }, + + // Get the Nth element in the matched element set OR + // Get the whole matched element set as a clean array + get: function( num ) { + return num != null ? + + // Return just the one element from the set + ( num < 0 ? this[ num + this.length ] : this[ num ] ) : + + // Return all the elements in a clean array + slice.call( this ); + }, + + // Take an array of elements and push it onto the stack + // (returning the new matched element set) + pushStack: function( elems ) { + + // Build a new jQuery matched element set + var ret = jQuery.merge( this.constructor(), elems ); + + // Add the old object onto the stack (as a reference) + ret.prevObject = this; + ret.context = this.context; + + // Return the newly-formed element set + return ret; + }, + + // Execute a callback for every element in the matched set. + // (You can seed the arguments with an array of args, but this is + // only used internally.) + each: function( callback, args ) { + return jQuery.each( this, callback, args ); + }, + + map: function( callback ) { + return this.pushStack( jQuery.map(this, function( elem, i ) { + return callback.call( elem, i, elem ); + })); + }, + + slice: function() { + return this.pushStack( slice.apply( this, arguments ) ); + }, + + first: function() { + return this.eq( 0 ); + }, + + last: function() { + return this.eq( -1 ); + }, + + eq: function( i ) { + var len = this.length, + j = +i + ( i < 0 ? len : 0 ); + return this.pushStack( j >= 0 && j < len ? [ this[j] ] : [] ); + }, + + end: function() { + return this.prevObject || this.constructor(null); + }, + + // For internal use only. + // Behaves like an Array's method, not like a jQuery method. + push: push, + sort: deletedIds.sort, + splice: deletedIds.splice +}; + +jQuery.extend = jQuery.fn.extend = function() { + var src, copyIsArray, copy, name, options, clone, + target = arguments[0] || {}, + i = 1, + length = arguments.length, + deep = false; + + // Handle a deep copy situation + if ( typeof target === "boolean" ) { + deep = target; + + // skip the boolean and the target + target = arguments[ i ] || {}; + i++; + } + + // Handle case when target is a string or something (possible in deep copy) + if ( typeof target !== "object" && !jQuery.isFunction(target) ) { + target = {}; + } + + // extend jQuery itself if only one argument is passed + if ( i === length ) { + target = this; + i--; + } + + for ( ; i < length; i++ ) { + // Only deal with non-null/undefined values + if ( (options = arguments[ i ]) != null ) { + // Extend the base object + for ( name in options ) { + src = target[ name ]; + copy = options[ name ]; + + // Prevent never-ending loop + if ( target === copy ) { + continue; + } + + // Recurse if we're merging plain objects or arrays + if ( deep && copy && ( jQuery.isPlainObject(copy) || (copyIsArray = jQuery.isArray(copy)) ) ) { + if ( copyIsArray ) { + copyIsArray = false; + clone = src && jQuery.isArray(src) ? src : []; + + } else { + clone = src && jQuery.isPlainObject(src) ? src : {}; + } + + // Never move original objects, clone them + target[ name ] = jQuery.extend( deep, clone, copy ); + + // Don't bring in undefined values + } else if ( copy !== undefined ) { + target[ name ] = copy; + } + } + } + } + + // Return the modified object + return target; +}; + +jQuery.extend({ + // Unique for each copy of jQuery on the page + expando: "jQuery" + ( version + Math.random() ).replace( /\D/g, "" ), + + // Assume jQuery is ready without the ready module + isReady: true, + + error: function( msg ) { + throw new Error( msg ); + }, + + noop: function() {}, + + // See test/unit/core.js for details concerning isFunction. + // Since version 1.3, DOM methods and functions like alert + // aren't supported. They return false on IE (#2968). + isFunction: function( obj ) { + return jQuery.type(obj) === "function"; + }, + + isArray: Array.isArray || function( obj ) { + return jQuery.type(obj) === "array"; + }, + + isWindow: function( obj ) { + /* jshint eqeqeq: false */ + return obj != null && obj == obj.window; + }, + + isNumeric: function( obj ) { + // parseFloat NaNs numeric-cast false positives (null|true|false|"") + // ...but misinterprets leading-number strings, particularly hex literals ("0x...") + // subtraction forces infinities to NaN + return !jQuery.isArray( obj ) && obj - parseFloat( obj ) >= 0; + }, + + isEmptyObject: function( obj ) { + var name; + for ( name in obj ) { + return false; + } + return true; + }, + + isPlainObject: function( obj ) { + var key; + + // Must be an Object. + // Because of IE, we also have to check the presence of the constructor property. + // Make sure that DOM nodes and window objects don't pass through, as well + if ( !obj || jQuery.type(obj) !== "object" || obj.nodeType || jQuery.isWindow( obj ) ) { + return false; + } + + try { + // Not own constructor property must be Object + if ( obj.constructor && + !hasOwn.call(obj, "constructor") && + !hasOwn.call(obj.constructor.prototype, "isPrototypeOf") ) { + return false; + } + } catch ( e ) { + // IE8,9 Will throw exceptions on certain host objects #9897 + return false; + } + + // Support: IE<9 + // Handle iteration over inherited properties before own properties. + if ( support.ownLast ) { + for ( key in obj ) { + return hasOwn.call( obj, key ); + } + } + + // Own properties are enumerated firstly, so to speed up, + // if last one is own, then all properties are own. + for ( key in obj ) {} + + return key === undefined || hasOwn.call( obj, key ); + }, + + type: function( obj ) { + if ( obj == null ) { + return obj + ""; + } + return typeof obj === "object" || typeof obj === "function" ? + class2type[ toString.call(obj) ] || "object" : + typeof obj; + }, + + // Evaluates a script in a global context + // Workarounds based on findings by Jim Driscoll + // http://weblogs.java.net/blog/driscoll/archive/2009/09/08/eval-javascript-global-context + globalEval: function( data ) { + if ( data && jQuery.trim( data ) ) { + // We use execScript on Internet Explorer + // We use an anonymous function so that context is window + // rather than jQuery in Firefox + ( window.execScript || function( data ) { + window[ "eval" ].call( window, data ); + } )( data ); + } + }, + + // Convert dashed to camelCase; used by the css and data modules + // Microsoft forgot to hump their vendor prefix (#9572) + camelCase: function( string ) { + return string.replace( rmsPrefix, "ms-" ).replace( rdashAlpha, fcamelCase ); + }, + + nodeName: function( elem, name ) { + return elem.nodeName && elem.nodeName.toLowerCase() === name.toLowerCase(); + }, + + // args is for internal usage only + each: function( obj, callback, args ) { + var value, + i = 0, + length = obj.length, + isArray = isArraylike( obj ); + + if ( args ) { + if ( isArray ) { + for ( ; i < length; i++ ) { + value = callback.apply( obj[ i ], args ); + + if ( value === false ) { + break; + } + } + } else { + for ( i in obj ) { + value = callback.apply( obj[ i ], args ); + + if ( value === false ) { + break; + } + } + } + + // A special, fast, case for the most common use of each + } else { + if ( isArray ) { + for ( ; i < length; i++ ) { + value = callback.call( obj[ i ], i, obj[ i ] ); + + if ( value === false ) { + break; + } + } + } else { + for ( i in obj ) { + value = callback.call( obj[ i ], i, obj[ i ] ); + + if ( value === false ) { + break; + } + } + } + } + + return obj; + }, + + // Support: Android<4.1, IE<9 + trim: function( text ) { + return text == null ? + "" : + ( text + "" ).replace( rtrim, "" ); + }, + + // results is for internal usage only + makeArray: function( arr, results ) { + var ret = results || []; + + if ( arr != null ) { + if ( isArraylike( Object(arr) ) ) { + jQuery.merge( ret, + typeof arr === "string" ? + [ arr ] : arr + ); + } else { + push.call( ret, arr ); + } + } + + return ret; + }, + + inArray: function( elem, arr, i ) { + var len; + + if ( arr ) { + if ( indexOf ) { + return indexOf.call( arr, elem, i ); + } + + len = arr.length; + i = i ? i < 0 ? Math.max( 0, len + i ) : i : 0; + + for ( ; i < len; i++ ) { + // Skip accessing in sparse arrays + if ( i in arr && arr[ i ] === elem ) { + return i; + } + } + } + + return -1; + }, + + merge: function( first, second ) { + var len = +second.length, + j = 0, + i = first.length; + + while ( j < len ) { + first[ i++ ] = second[ j++ ]; + } + + // Support: IE<9 + // Workaround casting of .length to NaN on otherwise arraylike objects (e.g., NodeLists) + if ( len !== len ) { + while ( second[j] !== undefined ) { + first[ i++ ] = second[ j++ ]; + } + } + + first.length = i; + + return first; + }, + + grep: function( elems, callback, invert ) { + var callbackInverse, + matches = [], + i = 0, + length = elems.length, + callbackExpect = !invert; + + // Go through the array, only saving the items + // that pass the validator function + for ( ; i < length; i++ ) { + callbackInverse = !callback( elems[ i ], i ); + if ( callbackInverse !== callbackExpect ) { + matches.push( elems[ i ] ); + } + } + + return matches; + }, + + // arg is for internal usage only + map: function( elems, callback, arg ) { + var value, + i = 0, + length = elems.length, + isArray = isArraylike( elems ), + ret = []; + + // Go through the array, translating each of the items to their new values + if ( isArray ) { + for ( ; i < length; i++ ) { + value = callback( elems[ i ], i, arg ); + + if ( value != null ) { + ret.push( value ); + } + } + + // Go through every key on the object, + } else { + for ( i in elems ) { + value = callback( elems[ i ], i, arg ); + + if ( value != null ) { + ret.push( value ); + } + } + } + + // Flatten any nested arrays + return concat.apply( [], ret ); + }, + + // A global GUID counter for objects + guid: 1, + + // Bind a function to a context, optionally partially applying any + // arguments. + proxy: function( fn, context ) { + var args, proxy, tmp; + + if ( typeof context === "string" ) { + tmp = fn[ context ]; + context = fn; + fn = tmp; + } + + // Quick check to determine if target is callable, in the spec + // this throws a TypeError, but we will just return undefined. + if ( !jQuery.isFunction( fn ) ) { + return undefined; + } + + // Simulated bind + args = slice.call( arguments, 2 ); + proxy = function() { + return fn.apply( context || this, args.concat( slice.call( arguments ) ) ); + }; + + // Set the guid of unique handler to the same of original handler, so it can be removed + proxy.guid = fn.guid = fn.guid || jQuery.guid++; + + return proxy; + }, + + now: function() { + return +( new Date() ); + }, + + // jQuery.support is not used in Core but other projects attach their + // properties to it so it needs to exist. + support: support +}); + +// Populate the class2type map +jQuery.each("Boolean Number String Function Array Date RegExp Object Error".split(" "), function(i, name) { + class2type[ "[object " + name + "]" ] = name.toLowerCase(); +}); + +function isArraylike( obj ) { + var length = obj.length, + type = jQuery.type( obj ); + + if ( type === "function" || jQuery.isWindow( obj ) ) { + return false; + } + + if ( obj.nodeType === 1 && length ) { + return true; + } + + return type === "array" || length === 0 || + typeof length === "number" && length > 0 && ( length - 1 ) in obj; +} +var Sizzle = +/*! + * Sizzle CSS Selector Engine v1.10.19 + * http://sizzlejs.com/ + * + * Copyright 2013 jQuery Foundation, Inc. and other contributors + * Released under the MIT license + * http://jquery.org/license + * + * Date: 2014-04-18 + */ +(function( window ) { + +var i, + support, + Expr, + getText, + isXML, + tokenize, + compile, + select, + outermostContext, + sortInput, + hasDuplicate, + + // Local document vars + setDocument, + document, + docElem, + documentIsHTML, + rbuggyQSA, + rbuggyMatches, + matches, + contains, + + // Instance-specific data + expando = "sizzle" + -(new Date()), + preferredDoc = window.document, + dirruns = 0, + done = 0, + classCache = createCache(), + tokenCache = createCache(), + compilerCache = createCache(), + sortOrder = function( a, b ) { + if ( a === b ) { + hasDuplicate = true; + } + return 0; + }, + + // General-purpose constants + strundefined = typeof undefined, + MAX_NEGATIVE = 1 << 31, + + // Instance methods + hasOwn = ({}).hasOwnProperty, + arr = [], + pop = arr.pop, + push_native = arr.push, + push = arr.push, + slice = arr.slice, + // Use a stripped-down indexOf if we can't use a native one + indexOf = arr.indexOf || function( elem ) { + var i = 0, + len = this.length; + for ( ; i < len; i++ ) { + if ( this[i] === elem ) { + return i; + } + } + return -1; + }, + + booleans = "checked|selected|async|autofocus|autoplay|controls|defer|disabled|hidden|ismap|loop|multiple|open|readonly|required|scoped", + + // Regular expressions + + // Whitespace characters http://www.w3.org/TR/css3-selectors/#whitespace + whitespace = "[\\x20\\t\\r\\n\\f]", + // http://www.w3.org/TR/css3-syntax/#characters + characterEncoding = "(?:\\\\.|[\\w-]|[^\\x00-\\xa0])+", + + // Loosely modeled on CSS identifier characters + // An unquoted value should be a CSS identifier http://www.w3.org/TR/css3-selectors/#attribute-selectors + // Proper syntax: http://www.w3.org/TR/CSS21/syndata.html#value-def-identifier + identifier = characterEncoding.replace( "w", "w#" ), + + // Attribute selectors: http://www.w3.org/TR/selectors/#attribute-selectors + attributes = "\\[" + whitespace + "*(" + characterEncoding + ")(?:" + whitespace + + // Operator (capture 2) + "*([*^$|!~]?=)" + whitespace + + // "Attribute values must be CSS identifiers [capture 5] or strings [capture 3 or capture 4]" + "*(?:'((?:\\\\.|[^\\\\'])*)'|\"((?:\\\\.|[^\\\\\"])*)\"|(" + identifier + "))|)" + whitespace + + "*\\]", + + pseudos = ":(" + characterEncoding + ")(?:\\((" + + // To reduce the number of selectors needing tokenize in the preFilter, prefer arguments: + // 1. quoted (capture 3; capture 4 or capture 5) + "('((?:\\\\.|[^\\\\'])*)'|\"((?:\\\\.|[^\\\\\"])*)\")|" + + // 2. simple (capture 6) + "((?:\\\\.|[^\\\\()[\\]]|" + attributes + ")*)|" + + // 3. anything else (capture 2) + ".*" + + ")\\)|)", + + // Leading and non-escaped trailing whitespace, capturing some non-whitespace characters preceding the latter + rtrim = new RegExp( "^" + whitespace + "+|((?:^|[^\\\\])(?:\\\\.)*)" + whitespace + "+$", "g" ), + + rcomma = new RegExp( "^" + whitespace + "*," + whitespace + "*" ), + rcombinators = new RegExp( "^" + whitespace + "*([>+~]|" + whitespace + ")" + whitespace + "*" ), + + rattributeQuotes = new RegExp( "=" + whitespace + "*([^\\]'\"]*?)" + whitespace + "*\\]", "g" ), + + rpseudo = new RegExp( pseudos ), + ridentifier = new RegExp( "^" + identifier + "$" ), + + matchExpr = { + "ID": new RegExp( "^#(" + characterEncoding + ")" ), + "CLASS": new RegExp( "^\\.(" + characterEncoding + ")" ), + "TAG": new RegExp( "^(" + characterEncoding.replace( "w", "w*" ) + ")" ), + "ATTR": new RegExp( "^" + attributes ), + "PSEUDO": new RegExp( "^" + pseudos ), + "CHILD": new RegExp( "^:(only|first|last|nth|nth-last)-(child|of-type)(?:\\(" + whitespace + + "*(even|odd|(([+-]|)(\\d*)n|)" + whitespace + "*(?:([+-]|)" + whitespace + + "*(\\d+)|))" + whitespace + "*\\)|)", "i" ), + "bool": new RegExp( "^(?:" + booleans + ")$", "i" ), + // For use in libraries implementing .is() + // We use this for POS matching in `select` + "needsContext": new RegExp( "^" + whitespace + "*[>+~]|:(even|odd|eq|gt|lt|nth|first|last)(?:\\(" + + whitespace + "*((?:-\\d)?\\d*)" + whitespace + "*\\)|)(?=[^-]|$)", "i" ) + }, + + rinputs = /^(?:input|select|textarea|button)$/i, + rheader = /^h\d$/i, + + rnative = /^[^{]+\{\s*\[native \w/, + + // Easily-parseable/retrievable ID or TAG or CLASS selectors + rquickExpr = /^(?:#([\w-]+)|(\w+)|\.([\w-]+))$/, + + rsibling = /[+~]/, + rescape = /'|\\/g, + + // CSS escapes http://www.w3.org/TR/CSS21/syndata.html#escaped-characters + runescape = new RegExp( "\\\\([\\da-f]{1,6}" + whitespace + "?|(" + whitespace + ")|.)", "ig" ), + funescape = function( _, escaped, escapedWhitespace ) { + var high = "0x" + escaped - 0x10000; + // NaN means non-codepoint + // Support: Firefox<24 + // Workaround erroneous numeric interpretation of +"0x" + return high !== high || escapedWhitespace ? + escaped : + high < 0 ? + // BMP codepoint + String.fromCharCode( high + 0x10000 ) : + // Supplemental Plane codepoint (surrogate pair) + String.fromCharCode( high >> 10 | 0xD800, high & 0x3FF | 0xDC00 ); + }; + +// Optimize for push.apply( _, NodeList ) +try { + push.apply( + (arr = slice.call( preferredDoc.childNodes )), + preferredDoc.childNodes + ); + // Support: Android<4.0 + // Detect silently failing push.apply + arr[ preferredDoc.childNodes.length ].nodeType; +} catch ( e ) { + push = { apply: arr.length ? + + // Leverage slice if possible + function( target, els ) { + push_native.apply( target, slice.call(els) ); + } : + + // Support: IE<9 + // Otherwise append directly + function( target, els ) { + var j = target.length, + i = 0; + // Can't trust NodeList.length + while ( (target[j++] = els[i++]) ) {} + target.length = j - 1; + } + }; +} + +function Sizzle( selector, context, results, seed ) { + var match, elem, m, nodeType, + // QSA vars + i, groups, old, nid, newContext, newSelector; + + if ( ( context ? context.ownerDocument || context : preferredDoc ) !== document ) { + setDocument( context ); + } + + context = context || document; + results = results || []; + + if ( !selector || typeof selector !== "string" ) { + return results; + } + + if ( (nodeType = context.nodeType) !== 1 && nodeType !== 9 ) { + return []; + } + + if ( documentIsHTML && !seed ) { + + // Shortcuts + if ( (match = rquickExpr.exec( selector )) ) { + // Speed-up: Sizzle("#ID") + if ( (m = match[1]) ) { + if ( nodeType === 9 ) { + elem = context.getElementById( m ); + // Check parentNode to catch when Blackberry 4.6 returns + // nodes that are no longer in the document (jQuery #6963) + if ( elem && elem.parentNode ) { + // Handle the case where IE, Opera, and Webkit return items + // by name instead of ID + if ( elem.id === m ) { + results.push( elem ); + return results; + } + } else { + return results; + } + } else { + // Context is not a document + if ( context.ownerDocument && (elem = context.ownerDocument.getElementById( m )) && + contains( context, elem ) && elem.id === m ) { + results.push( elem ); + return results; + } + } + + // Speed-up: Sizzle("TAG") + } else if ( match[2] ) { + push.apply( results, context.getElementsByTagName( selector ) ); + return results; + + // Speed-up: Sizzle(".CLASS") + } else if ( (m = match[3]) && support.getElementsByClassName && context.getElementsByClassName ) { + push.apply( results, context.getElementsByClassName( m ) ); + return results; + } + } + + // QSA path + if ( support.qsa && (!rbuggyQSA || !rbuggyQSA.test( selector )) ) { + nid = old = expando; + newContext = context; + newSelector = nodeType === 9 && selector; + + // qSA works strangely on Element-rooted queries + // We can work around this by specifying an extra ID on the root + // and working up from there (Thanks to Andrew Dupont for the technique) + // IE 8 doesn't work on object elements + if ( nodeType === 1 && context.nodeName.toLowerCase() !== "object" ) { + groups = tokenize( selector ); + + if ( (old = context.getAttribute("id")) ) { + nid = old.replace( rescape, "\\$&" ); + } else { + context.setAttribute( "id", nid ); + } + nid = "[id='" + nid + "'] "; + + i = groups.length; + while ( i-- ) { + groups[i] = nid + toSelector( groups[i] ); + } + newContext = rsibling.test( selector ) && testContext( context.parentNode ) || context; + newSelector = groups.join(","); + } + + if ( newSelector ) { + try { + push.apply( results, + newContext.querySelectorAll( newSelector ) + ); + return results; + } catch(qsaError) { + } finally { + if ( !old ) { + context.removeAttribute("id"); + } + } + } + } + } + + // All others + return select( selector.replace( rtrim, "$1" ), context, results, seed ); +} + +/** + * Create key-value caches of limited size + * @returns {Function(string, Object)} Returns the Object data after storing it on itself with + * property name the (space-suffixed) string and (if the cache is larger than Expr.cacheLength) + * deleting the oldest entry + */ +function createCache() { + var keys = []; + + function cache( key, value ) { + // Use (key + " ") to avoid collision with native prototype properties (see Issue #157) + if ( keys.push( key + " " ) > Expr.cacheLength ) { + // Only keep the most recent entries + delete cache[ keys.shift() ]; + } + return (cache[ key + " " ] = value); + } + return cache; +} + +/** + * Mark a function for special use by Sizzle + * @param {Function} fn The function to mark + */ +function markFunction( fn ) { + fn[ expando ] = true; + return fn; +} + +/** + * Support testing using an element + * @param {Function} fn Passed the created div and expects a boolean result + */ +function assert( fn ) { + var div = document.createElement("div"); + + try { + return !!fn( div ); + } catch (e) { + return false; + } finally { + // Remove from its parent by default + if ( div.parentNode ) { + div.parentNode.removeChild( div ); + } + // release memory in IE + div = null; + } +} + +/** + * Adds the same handler for all of the specified attrs + * @param {String} attrs Pipe-separated list of attributes + * @param {Function} handler The method that will be applied + */ +function addHandle( attrs, handler ) { + var arr = attrs.split("|"), + i = attrs.length; + + while ( i-- ) { + Expr.attrHandle[ arr[i] ] = handler; + } +} + +/** + * Checks document order of two siblings + * @param {Element} a + * @param {Element} b + * @returns {Number} Returns less than 0 if a precedes b, greater than 0 if a follows b + */ +function siblingCheck( a, b ) { + var cur = b && a, + diff = cur && a.nodeType === 1 && b.nodeType === 1 && + ( ~b.sourceIndex || MAX_NEGATIVE ) - + ( ~a.sourceIndex || MAX_NEGATIVE ); + + // Use IE sourceIndex if available on both nodes + if ( diff ) { + return diff; + } + + // Check if b follows a + if ( cur ) { + while ( (cur = cur.nextSibling) ) { + if ( cur === b ) { + return -1; + } + } + } + + return a ? 1 : -1; +} + +/** + * Returns a function to use in pseudos for input types + * @param {String} type + */ +function createInputPseudo( type ) { + return function( elem ) { + var name = elem.nodeName.toLowerCase(); + return name === "input" && elem.type === type; + }; +} + +/** + * Returns a function to use in pseudos for buttons + * @param {String} type + */ +function createButtonPseudo( type ) { + return function( elem ) { + var name = elem.nodeName.toLowerCase(); + return (name === "input" || name === "button") && elem.type === type; + }; +} + +/** + * Returns a function to use in pseudos for positionals + * @param {Function} fn + */ +function createPositionalPseudo( fn ) { + return markFunction(function( argument ) { + argument = +argument; + return markFunction(function( seed, matches ) { + var j, + matchIndexes = fn( [], seed.length, argument ), + i = matchIndexes.length; + + // Match elements found at the specified indexes + while ( i-- ) { + if ( seed[ (j = matchIndexes[i]) ] ) { + seed[j] = !(matches[j] = seed[j]); + } + } + }); + }); +} + +/** + * Checks a node for validity as a Sizzle context + * @param {Element|Object=} context + * @returns {Element|Object|Boolean} The input node if acceptable, otherwise a falsy value + */ +function testContext( context ) { + return context && typeof context.getElementsByTagName !== strundefined && context; +} + +// Expose support vars for convenience +support = Sizzle.support = {}; + +/** + * Detects XML nodes + * @param {Element|Object} elem An element or a document + * @returns {Boolean} True iff elem is a non-HTML XML node + */ +isXML = Sizzle.isXML = function( elem ) { + // documentElement is verified for cases where it doesn't yet exist + // (such as loading iframes in IE - #4833) + var documentElement = elem && (elem.ownerDocument || elem).documentElement; + return documentElement ? documentElement.nodeName !== "HTML" : false; +}; + +/** + * Sets document-related variables once based on the current document + * @param {Element|Object} [doc] An element or document object to use to set the document + * @returns {Object} Returns the current document + */ +setDocument = Sizzle.setDocument = function( node ) { + var hasCompare, + doc = node ? node.ownerDocument || node : preferredDoc, + parent = doc.defaultView; + + // If no document and documentElement is available, return + if ( doc === document || doc.nodeType !== 9 || !doc.documentElement ) { + return document; + } + + // Set our document + document = doc; + docElem = doc.documentElement; + + // Support tests + documentIsHTML = !isXML( doc ); + + // Support: IE>8 + // If iframe document is assigned to "document" variable and if iframe has been reloaded, + // IE will throw "permission denied" error when accessing "document" variable, see jQuery #13936 + // IE6-8 do not support the defaultView property so parent will be undefined + if ( parent && parent !== parent.top ) { + // IE11 does not have attachEvent, so all must suffer + if ( parent.addEventListener ) { + parent.addEventListener( "unload", function() { + setDocument(); + }, false ); + } else if ( parent.attachEvent ) { + parent.attachEvent( "onunload", function() { + setDocument(); + }); + } + } + + /* Attributes + ---------------------------------------------------------------------- */ + + // Support: IE<8 + // Verify that getAttribute really returns attributes and not properties (excepting IE8 booleans) + support.attributes = assert(function( div ) { + div.className = "i"; + return !div.getAttribute("className"); + }); + + /* getElement(s)By* + ---------------------------------------------------------------------- */ + + // Check if getElementsByTagName("*") returns only elements + support.getElementsByTagName = assert(function( div ) { + div.appendChild( doc.createComment("") ); + return !div.getElementsByTagName("*").length; + }); + + // Check if getElementsByClassName can be trusted + support.getElementsByClassName = rnative.test( doc.getElementsByClassName ) && assert(function( div ) { + div.innerHTML = "<div class='a'></div><div class='a i'></div>"; + + // Support: Safari<4 + // Catch class over-caching + div.firstChild.className = "i"; + // Support: Opera<10 + // Catch gEBCN failure to find non-leading classes + return div.getElementsByClassName("i").length === 2; + }); + + // Support: IE<10 + // Check if getElementById returns elements by name + // The broken getElementById methods don't pick up programatically-set names, + // so use a roundabout getElementsByName test + support.getById = assert(function( div ) { + docElem.appendChild( div ).id = expando; + return !doc.getElementsByName || !doc.getElementsByName( expando ).length; + }); + + // ID find and filter + if ( support.getById ) { + Expr.find["ID"] = function( id, context ) { + if ( typeof context.getElementById !== strundefined && documentIsHTML ) { + var m = context.getElementById( id ); + // Check parentNode to catch when Blackberry 4.6 returns + // nodes that are no longer in the document #6963 + return m && m.parentNode ? [ m ] : []; + } + }; + Expr.filter["ID"] = function( id ) { + var attrId = id.replace( runescape, funescape ); + return function( elem ) { + return elem.getAttribute("id") === attrId; + }; + }; + } else { + // Support: IE6/7 + // getElementById is not reliable as a find shortcut + delete Expr.find["ID"]; + + Expr.filter["ID"] = function( id ) { + var attrId = id.replace( runescape, funescape ); + return function( elem ) { + var node = typeof elem.getAttributeNode !== strundefined && elem.getAttributeNode("id"); + return node && node.value === attrId; + }; + }; + } + + // Tag + Expr.find["TAG"] = support.getElementsByTagName ? + function( tag, context ) { + if ( typeof context.getElementsByTagName !== strundefined ) { + return context.getElementsByTagName( tag ); + } + } : + function( tag, context ) { + var elem, + tmp = [], + i = 0, + results = context.getElementsByTagName( tag ); + + // Filter out possible comments + if ( tag === "*" ) { + while ( (elem = results[i++]) ) { + if ( elem.nodeType === 1 ) { + tmp.push( elem ); + } + } + + return tmp; + } + return results; + }; + + // Class + Expr.find["CLASS"] = support.getElementsByClassName && function( className, context ) { + if ( typeof context.getElementsByClassName !== strundefined && documentIsHTML ) { + return context.getElementsByClassName( className ); + } + }; + + /* QSA/matchesSelector + ---------------------------------------------------------------------- */ + + // QSA and matchesSelector support + + // matchesSelector(:active) reports false when true (IE9/Opera 11.5) + rbuggyMatches = []; + + // qSa(:focus) reports false when true (Chrome 21) + // We allow this because of a bug in IE8/9 that throws an error + // whenever `document.activeElement` is accessed on an iframe + // So, we allow :focus to pass through QSA all the time to avoid the IE error + // See http://bugs.jquery.com/ticket/13378 + rbuggyQSA = []; + + if ( (support.qsa = rnative.test( doc.querySelectorAll )) ) { + // Build QSA regex + // Regex strategy adopted from Diego Perini + assert(function( div ) { + // Select is set to empty string on purpose + // This is to test IE's treatment of not explicitly + // setting a boolean content attribute, + // since its presence should be enough + // http://bugs.jquery.com/ticket/12359 + div.innerHTML = "<select msallowclip=''><option selected=''></option></select>"; + + // Support: IE8, Opera 11-12.16 + // Nothing should be selected when empty strings follow ^= or $= or *= + // The test attribute must be unknown in Opera but "safe" for WinRT + // http://msdn.microsoft.com/en-us/library/ie/hh465388.aspx#attribute_section + if ( div.querySelectorAll("[msallowclip^='']").length ) { + rbuggyQSA.push( "[*^$]=" + whitespace + "*(?:''|\"\")" ); + } + + // Support: IE8 + // Boolean attributes and "value" are not treated correctly + if ( !div.querySelectorAll("[selected]").length ) { + rbuggyQSA.push( "\\[" + whitespace + "*(?:value|" + booleans + ")" ); + } + + // Webkit/Opera - :checked should return selected option elements + // http://www.w3.org/TR/2011/REC-css3-selectors-20110929/#checked + // IE8 throws error here and will not see later tests + if ( !div.querySelectorAll(":checked").length ) { + rbuggyQSA.push(":checked"); + } + }); + + assert(function( div ) { + // Support: Windows 8 Native Apps + // The type and name attributes are restricted during .innerHTML assignment + var input = doc.createElement("input"); + input.setAttribute( "type", "hidden" ); + div.appendChild( input ).setAttribute( "name", "D" ); + + // Support: IE8 + // Enforce case-sensitivity of name attribute + if ( div.querySelectorAll("[name=d]").length ) { + rbuggyQSA.push( "name" + whitespace + "*[*^$|!~]?=" ); + } + + // FF 3.5 - :enabled/:disabled and hidden elements (hidden elements are still enabled) + // IE8 throws error here and will not see later tests + if ( !div.querySelectorAll(":enabled").length ) { + rbuggyQSA.push( ":enabled", ":disabled" ); + } + + // Opera 10-11 does not throw on post-comma invalid pseudos + div.querySelectorAll("*,:x"); + rbuggyQSA.push(",.*:"); + }); + } + + if ( (support.matchesSelector = rnative.test( (matches = docElem.matches || + docElem.webkitMatchesSelector || + docElem.mozMatchesSelector || + docElem.oMatchesSelector || + docElem.msMatchesSelector) )) ) { + + assert(function( div ) { + // Check to see if it's possible to do matchesSelector + // on a disconnected node (IE 9) + support.disconnectedMatch = matches.call( div, "div" ); + + // This should fail with an exception + // Gecko does not error, returns false instead + matches.call( div, "[s!='']:x" ); + rbuggyMatches.push( "!=", pseudos ); + }); + } + + rbuggyQSA = rbuggyQSA.length && new RegExp( rbuggyQSA.join("|") ); + rbuggyMatches = rbuggyMatches.length && new RegExp( rbuggyMatches.join("|") ); + + /* Contains + ---------------------------------------------------------------------- */ + hasCompare = rnative.test( docElem.compareDocumentPosition ); + + // Element contains another + // Purposefully does not implement inclusive descendent + // As in, an element does not contain itself + contains = hasCompare || rnative.test( docElem.contains ) ? + function( a, b ) { + var adown = a.nodeType === 9 ? a.documentElement : a, + bup = b && b.parentNode; + return a === bup || !!( bup && bup.nodeType === 1 && ( + adown.contains ? + adown.contains( bup ) : + a.compareDocumentPosition && a.compareDocumentPosition( bup ) & 16 + )); + } : + function( a, b ) { + if ( b ) { + while ( (b = b.parentNode) ) { + if ( b === a ) { + return true; + } + } + } + return false; + }; + + /* Sorting + ---------------------------------------------------------------------- */ + + // Document order sorting + sortOrder = hasCompare ? + function( a, b ) { + + // Flag for duplicate removal + if ( a === b ) { + hasDuplicate = true; + return 0; + } + + // Sort on method existence if only one input has compareDocumentPosition + var compare = !a.compareDocumentPosition - !b.compareDocumentPosition; + if ( compare ) { + return compare; + } + + // Calculate position if both inputs belong to the same document + compare = ( a.ownerDocument || a ) === ( b.ownerDocument || b ) ? + a.compareDocumentPosition( b ) : + + // Otherwise we know they are disconnected + 1; + + // Disconnected nodes + if ( compare & 1 || + (!support.sortDetached && b.compareDocumentPosition( a ) === compare) ) { + + // Choose the first element that is related to our preferred document + if ( a === doc || a.ownerDocument === preferredDoc && contains(preferredDoc, a) ) { + return -1; + } + if ( b === doc || b.ownerDocument === preferredDoc && contains(preferredDoc, b) ) { + return 1; + } + + // Maintain original order + return sortInput ? + ( indexOf.call( sortInput, a ) - indexOf.call( sortInput, b ) ) : + 0; + } + + return compare & 4 ? -1 : 1; + } : + function( a, b ) { + // Exit early if the nodes are identical + if ( a === b ) { + hasDuplicate = true; + return 0; + } + + var cur, + i = 0, + aup = a.parentNode, + bup = b.parentNode, + ap = [ a ], + bp = [ b ]; + + // Parentless nodes are either documents or disconnected + if ( !aup || !bup ) { + return a === doc ? -1 : + b === doc ? 1 : + aup ? -1 : + bup ? 1 : + sortInput ? + ( indexOf.call( sortInput, a ) - indexOf.call( sortInput, b ) ) : + 0; + + // If the nodes are siblings, we can do a quick check + } else if ( aup === bup ) { + return siblingCheck( a, b ); + } + + // Otherwise we need full lists of their ancestors for comparison + cur = a; + while ( (cur = cur.parentNode) ) { + ap.unshift( cur ); + } + cur = b; + while ( (cur = cur.parentNode) ) { + bp.unshift( cur ); + } + + // Walk down the tree looking for a discrepancy + while ( ap[i] === bp[i] ) { + i++; + } + + return i ? + // Do a sibling check if the nodes have a common ancestor + siblingCheck( ap[i], bp[i] ) : + + // Otherwise nodes in our document sort first + ap[i] === preferredDoc ? -1 : + bp[i] === preferredDoc ? 1 : + 0; + }; + + return doc; +}; + +Sizzle.matches = function( expr, elements ) { + return Sizzle( expr, null, null, elements ); +}; + +Sizzle.matchesSelector = function( elem, expr ) { + // Set document vars if needed + if ( ( elem.ownerDocument || elem ) !== document ) { + setDocument( elem ); + } + + // Make sure that attribute selectors are quoted + expr = expr.replace( rattributeQuotes, "='$1']" ); + + if ( support.matchesSelector && documentIsHTML && + ( !rbuggyMatches || !rbuggyMatches.test( expr ) ) && + ( !rbuggyQSA || !rbuggyQSA.test( expr ) ) ) { + + try { + var ret = matches.call( elem, expr ); + + // IE 9's matchesSelector returns false on disconnected nodes + if ( ret || support.disconnectedMatch || + // As well, disconnected nodes are said to be in a document + // fragment in IE 9 + elem.document && elem.document.nodeType !== 11 ) { + return ret; + } + } catch(e) {} + } + + return Sizzle( expr, document, null, [ elem ] ).length > 0; +}; + +Sizzle.contains = function( context, elem ) { + // Set document vars if needed + if ( ( context.ownerDocument || context ) !== document ) { + setDocument( context ); + } + return contains( context, elem ); +}; + +Sizzle.attr = function( elem, name ) { + // Set document vars if needed + if ( ( elem.ownerDocument || elem ) !== document ) { + setDocument( elem ); + } + + var fn = Expr.attrHandle[ name.toLowerCase() ], + // Don't get fooled by Object.prototype properties (jQuery #13807) + val = fn && hasOwn.call( Expr.attrHandle, name.toLowerCase() ) ? + fn( elem, name, !documentIsHTML ) : + undefined; + + return val !== undefined ? + val : + support.attributes || !documentIsHTML ? + elem.getAttribute( name ) : + (val = elem.getAttributeNode(name)) && val.specified ? + val.value : + null; +}; + +Sizzle.error = function( msg ) { + throw new Error( "Syntax error, unrecognized expression: " + msg ); +}; + +/** + * Document sorting and removing duplicates + * @param {ArrayLike} results + */ +Sizzle.uniqueSort = function( results ) { + var elem, + duplicates = [], + j = 0, + i = 0; + + // Unless we *know* we can detect duplicates, assume their presence + hasDuplicate = !support.detectDuplicates; + sortInput = !support.sortStable && results.slice( 0 ); + results.sort( sortOrder ); + + if ( hasDuplicate ) { + while ( (elem = results[i++]) ) { + if ( elem === results[ i ] ) { + j = duplicates.push( i ); + } + } + while ( j-- ) { + results.splice( duplicates[ j ], 1 ); + } + } + + // Clear input after sorting to release objects + // See https://github.com/jquery/sizzle/pull/225 + sortInput = null; + + return results; +}; + +/** + * Utility function for retrieving the text value of an array of DOM nodes + * @param {Array|Element} elem + */ +getText = Sizzle.getText = function( elem ) { + var node, + ret = "", + i = 0, + nodeType = elem.nodeType; + + if ( !nodeType ) { + // If no nodeType, this is expected to be an array + while ( (node = elem[i++]) ) { + // Do not traverse comment nodes + ret += getText( node ); + } + } else if ( nodeType === 1 || nodeType === 9 || nodeType === 11 ) { + // Use textContent for elements + // innerText usage removed for consistency of new lines (jQuery #11153) + if ( typeof elem.textContent === "string" ) { + return elem.textContent; + } else { + // Traverse its children + for ( elem = elem.firstChild; elem; elem = elem.nextSibling ) { + ret += getText( elem ); + } + } + } else if ( nodeType === 3 || nodeType === 4 ) { + return elem.nodeValue; + } + // Do not include comment or processing instruction nodes + + return ret; +}; + +Expr = Sizzle.selectors = { + + // Can be adjusted by the user + cacheLength: 50, + + createPseudo: markFunction, + + match: matchExpr, + + attrHandle: {}, + + find: {}, + + relative: { + ">": { dir: "parentNode", first: true }, + " ": { dir: "parentNode" }, + "+": { dir: "previousSibling", first: true }, + "~": { dir: "previousSibling" } + }, + + preFilter: { + "ATTR": function( match ) { + match[1] = match[1].replace( runescape, funescape ); + + // Move the given value to match[3] whether quoted or unquoted + match[3] = ( match[3] || match[4] || match[5] || "" ).replace( runescape, funescape ); + + if ( match[2] === "~=" ) { + match[3] = " " + match[3] + " "; + } + + return match.slice( 0, 4 ); + }, + + "CHILD": function( match ) { + /* matches from matchExpr["CHILD"] + 1 type (only|nth|...) + 2 what (child|of-type) + 3 argument (even|odd|\d*|\d*n([+-]\d+)?|...) + 4 xn-component of xn+y argument ([+-]?\d*n|) + 5 sign of xn-component + 6 x of xn-component + 7 sign of y-component + 8 y of y-component + */ + match[1] = match[1].toLowerCase(); + + if ( match[1].slice( 0, 3 ) === "nth" ) { + // nth-* requires argument + if ( !match[3] ) { + Sizzle.error( match[0] ); + } + + // numeric x and y parameters for Expr.filter.CHILD + // remember that false/true cast respectively to 0/1 + match[4] = +( match[4] ? match[5] + (match[6] || 1) : 2 * ( match[3] === "even" || match[3] === "odd" ) ); + match[5] = +( ( match[7] + match[8] ) || match[3] === "odd" ); + + // other types prohibit arguments + } else if ( match[3] ) { + Sizzle.error( match[0] ); + } + + return match; + }, + + "PSEUDO": function( match ) { + var excess, + unquoted = !match[6] && match[2]; + + if ( matchExpr["CHILD"].test( match[0] ) ) { + return null; + } + + // Accept quoted arguments as-is + if ( match[3] ) { + match[2] = match[4] || match[5] || ""; + + // Strip excess characters from unquoted arguments + } else if ( unquoted && rpseudo.test( unquoted ) && + // Get excess from tokenize (recursively) + (excess = tokenize( unquoted, true )) && + // advance to the next closing parenthesis + (excess = unquoted.indexOf( ")", unquoted.length - excess ) - unquoted.length) ) { + + // excess is a negative index + match[0] = match[0].slice( 0, excess ); + match[2] = unquoted.slice( 0, excess ); + } + + // Return only captures needed by the pseudo filter method (type and argument) + return match.slice( 0, 3 ); + } + }, + + filter: { + + "TAG": function( nodeNameSelector ) { + var nodeName = nodeNameSelector.replace( runescape, funescape ).toLowerCase(); + return nodeNameSelector === "*" ? + function() { return true; } : + function( elem ) { + return elem.nodeName && elem.nodeName.toLowerCase() === nodeName; + }; + }, + + "CLASS": function( className ) { + var pattern = classCache[ className + " " ]; + + return pattern || + (pattern = new RegExp( "(^|" + whitespace + ")" + className + "(" + whitespace + "|$)" )) && + classCache( className, function( elem ) { + return pattern.test( typeof elem.className === "string" && elem.className || typeof elem.getAttribute !== strundefined && elem.getAttribute("class") || "" ); + }); + }, + + "ATTR": function( name, operator, check ) { + return function( elem ) { + var result = Sizzle.attr( elem, name ); + + if ( result == null ) { + return operator === "!="; + } + if ( !operator ) { + return true; + } + + result += ""; + + return operator === "=" ? result === check : + operator === "!=" ? result !== check : + operator === "^=" ? check && result.indexOf( check ) === 0 : + operator === "*=" ? check && result.indexOf( check ) > -1 : + operator === "$=" ? check && result.slice( -check.length ) === check : + operator === "~=" ? ( " " + result + " " ).indexOf( check ) > -1 : + operator === "|=" ? result === check || result.slice( 0, check.length + 1 ) === check + "-" : + false; + }; + }, + + "CHILD": function( type, what, argument, first, last ) { + var simple = type.slice( 0, 3 ) !== "nth", + forward = type.slice( -4 ) !== "last", + ofType = what === "of-type"; + + return first === 1 && last === 0 ? + + // Shortcut for :nth-*(n) + function( elem ) { + return !!elem.parentNode; + } : + + function( elem, context, xml ) { + var cache, outerCache, node, diff, nodeIndex, start, + dir = simple !== forward ? "nextSibling" : "previousSibling", + parent = elem.parentNode, + name = ofType && elem.nodeName.toLowerCase(), + useCache = !xml && !ofType; + + if ( parent ) { + + // :(first|last|only)-(child|of-type) + if ( simple ) { + while ( dir ) { + node = elem; + while ( (node = node[ dir ]) ) { + if ( ofType ? node.nodeName.toLowerCase() === name : node.nodeType === 1 ) { + return false; + } + } + // Reverse direction for :only-* (if we haven't yet done so) + start = dir = type === "only" && !start && "nextSibling"; + } + return true; + } + + start = [ forward ? parent.firstChild : parent.lastChild ]; + + // non-xml :nth-child(...) stores cache data on `parent` + if ( forward && useCache ) { + // Seek `elem` from a previously-cached index + outerCache = parent[ expando ] || (parent[ expando ] = {}); + cache = outerCache[ type ] || []; + nodeIndex = cache[0] === dirruns && cache[1]; + diff = cache[0] === dirruns && cache[2]; + node = nodeIndex && parent.childNodes[ nodeIndex ]; + + while ( (node = ++nodeIndex && node && node[ dir ] || + + // Fallback to seeking `elem` from the start + (diff = nodeIndex = 0) || start.pop()) ) { + + // When found, cache indexes on `parent` and break + if ( node.nodeType === 1 && ++diff && node === elem ) { + outerCache[ type ] = [ dirruns, nodeIndex, diff ]; + break; + } + } + + // Use previously-cached element index if available + } else if ( useCache && (cache = (elem[ expando ] || (elem[ expando ] = {}))[ type ]) && cache[0] === dirruns ) { + diff = cache[1]; + + // xml :nth-child(...) or :nth-last-child(...) or :nth(-last)?-of-type(...) + } else { + // Use the same loop as above to seek `elem` from the start + while ( (node = ++nodeIndex && node && node[ dir ] || + (diff = nodeIndex = 0) || start.pop()) ) { + + if ( ( ofType ? node.nodeName.toLowerCase() === name : node.nodeType === 1 ) && ++diff ) { + // Cache the index of each encountered element + if ( useCache ) { + (node[ expando ] || (node[ expando ] = {}))[ type ] = [ dirruns, diff ]; + } + + if ( node === elem ) { + break; + } + } + } + } + + // Incorporate the offset, then check against cycle size + diff -= last; + return diff === first || ( diff % first === 0 && diff / first >= 0 ); + } + }; + }, + + "PSEUDO": function( pseudo, argument ) { + // pseudo-class names are case-insensitive + // http://www.w3.org/TR/selectors/#pseudo-classes + // Prioritize by case sensitivity in case custom pseudos are added with uppercase letters + // Remember that setFilters inherits from pseudos + var args, + fn = Expr.pseudos[ pseudo ] || Expr.setFilters[ pseudo.toLowerCase() ] || + Sizzle.error( "unsupported pseudo: " + pseudo ); + + // The user may use createPseudo to indicate that + // arguments are needed to create the filter function + // just as Sizzle does + if ( fn[ expando ] ) { + return fn( argument ); + } + + // But maintain support for old signatures + if ( fn.length > 1 ) { + args = [ pseudo, pseudo, "", argument ]; + return Expr.setFilters.hasOwnProperty( pseudo.toLowerCase() ) ? + markFunction(function( seed, matches ) { + var idx, + matched = fn( seed, argument ), + i = matched.length; + while ( i-- ) { + idx = indexOf.call( seed, matched[i] ); + seed[ idx ] = !( matches[ idx ] = matched[i] ); + } + }) : + function( elem ) { + return fn( elem, 0, args ); + }; + } + + return fn; + } + }, + + pseudos: { + // Potentially complex pseudos + "not": markFunction(function( selector ) { + // Trim the selector passed to compile + // to avoid treating leading and trailing + // spaces as combinators + var input = [], + results = [], + matcher = compile( selector.replace( rtrim, "$1" ) ); + + return matcher[ expando ] ? + markFunction(function( seed, matches, context, xml ) { + var elem, + unmatched = matcher( seed, null, xml, [] ), + i = seed.length; + + // Match elements unmatched by `matcher` + while ( i-- ) { + if ( (elem = unmatched[i]) ) { + seed[i] = !(matches[i] = elem); + } + } + }) : + function( elem, context, xml ) { + input[0] = elem; + matcher( input, null, xml, results ); + return !results.pop(); + }; + }), + + "has": markFunction(function( selector ) { + return function( elem ) { + return Sizzle( selector, elem ).length > 0; + }; + }), + + "contains": markFunction(function( text ) { + return function( elem ) { + return ( elem.textContent || elem.innerText || getText( elem ) ).indexOf( text ) > -1; + }; + }), + + // "Whether an element is represented by a :lang() selector + // is based solely on the element's language value + // being equal to the identifier C, + // or beginning with the identifier C immediately followed by "-". + // The matching of C against the element's language value is performed case-insensitively. + // The identifier C does not have to be a valid language name." + // http://www.w3.org/TR/selectors/#lang-pseudo + "lang": markFunction( function( lang ) { + // lang value must be a valid identifier + if ( !ridentifier.test(lang || "") ) { + Sizzle.error( "unsupported lang: " + lang ); + } + lang = lang.replace( runescape, funescape ).toLowerCase(); + return function( elem ) { + var elemLang; + do { + if ( (elemLang = documentIsHTML ? + elem.lang : + elem.getAttribute("xml:lang") || elem.getAttribute("lang")) ) { + + elemLang = elemLang.toLowerCase(); + return elemLang === lang || elemLang.indexOf( lang + "-" ) === 0; + } + } while ( (elem = elem.parentNode) && elem.nodeType === 1 ); + return false; + }; + }), + + // Miscellaneous + "target": function( elem ) { + var hash = window.location && window.location.hash; + return hash && hash.slice( 1 ) === elem.id; + }, + + "root": function( elem ) { + return elem === docElem; + }, + + "focus": function( elem ) { + return elem === document.activeElement && (!document.hasFocus || document.hasFocus()) && !!(elem.type || elem.href || ~elem.tabIndex); + }, + + // Boolean properties + "enabled": function( elem ) { + return elem.disabled === false; + }, + + "disabled": function( elem ) { + return elem.disabled === true; + }, + + "checked": function( elem ) { + // In CSS3, :checked should return both checked and selected elements + // http://www.w3.org/TR/2011/REC-css3-selectors-20110929/#checked + var nodeName = elem.nodeName.toLowerCase(); + return (nodeName === "input" && !!elem.checked) || (nodeName === "option" && !!elem.selected); + }, + + "selected": function( elem ) { + // Accessing this property makes selected-by-default + // options in Safari work properly + if ( elem.parentNode ) { + elem.parentNode.selectedIndex; + } + + return elem.selected === true; + }, + + // Contents + "empty": function( elem ) { + // http://www.w3.org/TR/selectors/#empty-pseudo + // :empty is negated by element (1) or content nodes (text: 3; cdata: 4; entity ref: 5), + // but not by others (comment: 8; processing instruction: 7; etc.) + // nodeType < 6 works because attributes (2) do not appear as children + for ( elem = elem.firstChild; elem; elem = elem.nextSibling ) { + if ( elem.nodeType < 6 ) { + return false; + } + } + return true; + }, + + "parent": function( elem ) { + return !Expr.pseudos["empty"]( elem ); + }, + + // Element/input types + "header": function( elem ) { + return rheader.test( elem.nodeName ); + }, + + "input": function( elem ) { + return rinputs.test( elem.nodeName ); + }, + + "button": function( elem ) { + var name = elem.nodeName.toLowerCase(); + return name === "input" && elem.type === "button" || name === "button"; + }, + + "text": function( elem ) { + var attr; + return elem.nodeName.toLowerCase() === "input" && + elem.type === "text" && + + // Support: IE<8 + // New HTML5 attribute values (e.g., "search") appear with elem.type === "text" + ( (attr = elem.getAttribute("type")) == null || attr.toLowerCase() === "text" ); + }, + + // Position-in-collection + "first": createPositionalPseudo(function() { + return [ 0 ]; + }), + + "last": createPositionalPseudo(function( matchIndexes, length ) { + return [ length - 1 ]; + }), + + "eq": createPositionalPseudo(function( matchIndexes, length, argument ) { + return [ argument < 0 ? argument + length : argument ]; + }), + + "even": createPositionalPseudo(function( matchIndexes, length ) { + var i = 0; + for ( ; i < length; i += 2 ) { + matchIndexes.push( i ); + } + return matchIndexes; + }), + + "odd": createPositionalPseudo(function( matchIndexes, length ) { + var i = 1; + for ( ; i < length; i += 2 ) { + matchIndexes.push( i ); + } + return matchIndexes; + }), + + "lt": createPositionalPseudo(function( matchIndexes, length, argument ) { + var i = argument < 0 ? argument + length : argument; + for ( ; --i >= 0; ) { + matchIndexes.push( i ); + } + return matchIndexes; + }), + + "gt": createPositionalPseudo(function( matchIndexes, length, argument ) { + var i = argument < 0 ? argument + length : argument; + for ( ; ++i < length; ) { + matchIndexes.push( i ); + } + return matchIndexes; + }) + } +}; + +Expr.pseudos["nth"] = Expr.pseudos["eq"]; + +// Add button/input type pseudos +for ( i in { radio: true, checkbox: true, file: true, password: true, image: true } ) { + Expr.pseudos[ i ] = createInputPseudo( i ); +} +for ( i in { submit: true, reset: true } ) { + Expr.pseudos[ i ] = createButtonPseudo( i ); +} + +// Easy API for creating new setFilters +function setFilters() {} +setFilters.prototype = Expr.filters = Expr.pseudos; +Expr.setFilters = new setFilters(); + +tokenize = Sizzle.tokenize = function( selector, parseOnly ) { + var matched, match, tokens, type, + soFar, groups, preFilters, + cached = tokenCache[ selector + " " ]; + + if ( cached ) { + return parseOnly ? 0 : cached.slice( 0 ); + } + + soFar = selector; + groups = []; + preFilters = Expr.preFilter; + + while ( soFar ) { + + // Comma and first run + if ( !matched || (match = rcomma.exec( soFar )) ) { + if ( match ) { + // Don't consume trailing commas as valid + soFar = soFar.slice( match[0].length ) || soFar; + } + groups.push( (tokens = []) ); + } + + matched = false; + + // Combinators + if ( (match = rcombinators.exec( soFar )) ) { + matched = match.shift(); + tokens.push({ + value: matched, + // Cast descendant combinators to space + type: match[0].replace( rtrim, " " ) + }); + soFar = soFar.slice( matched.length ); + } + + // Filters + for ( type in Expr.filter ) { + if ( (match = matchExpr[ type ].exec( soFar )) && (!preFilters[ type ] || + (match = preFilters[ type ]( match ))) ) { + matched = match.shift(); + tokens.push({ + value: matched, + type: type, + matches: match + }); + soFar = soFar.slice( matched.length ); + } + } + + if ( !matched ) { + break; + } + } + + // Return the length of the invalid excess + // if we're just parsing + // Otherwise, throw an error or return tokens + return parseOnly ? + soFar.length : + soFar ? + Sizzle.error( selector ) : + // Cache the tokens + tokenCache( selector, groups ).slice( 0 ); +}; + +function toSelector( tokens ) { + var i = 0, + len = tokens.length, + selector = ""; + for ( ; i < len; i++ ) { + selector += tokens[i].value; + } + return selector; +} + +function addCombinator( matcher, combinator, base ) { + var dir = combinator.dir, + checkNonElements = base && dir === "parentNode", + doneName = done++; + + return combinator.first ? + // Check against closest ancestor/preceding element + function( elem, context, xml ) { + while ( (elem = elem[ dir ]) ) { + if ( elem.nodeType === 1 || checkNonElements ) { + return matcher( elem, context, xml ); + } + } + } : + + // Check against all ancestor/preceding elements + function( elem, context, xml ) { + var oldCache, outerCache, + newCache = [ dirruns, doneName ]; + + // We can't set arbitrary data on XML nodes, so they don't benefit from dir caching + if ( xml ) { + while ( (elem = elem[ dir ]) ) { + if ( elem.nodeType === 1 || checkNonElements ) { + if ( matcher( elem, context, xml ) ) { + return true; + } + } + } + } else { + while ( (elem = elem[ dir ]) ) { + if ( elem.nodeType === 1 || checkNonElements ) { + outerCache = elem[ expando ] || (elem[ expando ] = {}); + if ( (oldCache = outerCache[ dir ]) && + oldCache[ 0 ] === dirruns && oldCache[ 1 ] === doneName ) { + + // Assign to newCache so results back-propagate to previous elements + return (newCache[ 2 ] = oldCache[ 2 ]); + } else { + // Reuse newcache so results back-propagate to previous elements + outerCache[ dir ] = newCache; + + // A match means we're done; a fail means we have to keep checking + if ( (newCache[ 2 ] = matcher( elem, context, xml )) ) { + return true; + } + } + } + } + } + }; +} + +function elementMatcher( matchers ) { + return matchers.length > 1 ? + function( elem, context, xml ) { + var i = matchers.length; + while ( i-- ) { + if ( !matchers[i]( elem, context, xml ) ) { + return false; + } + } + return true; + } : + matchers[0]; +} + +function multipleContexts( selector, contexts, results ) { + var i = 0, + len = contexts.length; + for ( ; i < len; i++ ) { + Sizzle( selector, contexts[i], results ); + } + return results; +} + +function condense( unmatched, map, filter, context, xml ) { + var elem, + newUnmatched = [], + i = 0, + len = unmatched.length, + mapped = map != null; + + for ( ; i < len; i++ ) { + if ( (elem = unmatched[i]) ) { + if ( !filter || filter( elem, context, xml ) ) { + newUnmatched.push( elem ); + if ( mapped ) { + map.push( i ); + } + } + } + } + + return newUnmatched; +} + +function setMatcher( preFilter, selector, matcher, postFilter, postFinder, postSelector ) { + if ( postFilter && !postFilter[ expando ] ) { + postFilter = setMatcher( postFilter ); + } + if ( postFinder && !postFinder[ expando ] ) { + postFinder = setMatcher( postFinder, postSelector ); + } + return markFunction(function( seed, results, context, xml ) { + var temp, i, elem, + preMap = [], + postMap = [], + preexisting = results.length, + + // Get initial elements from seed or context + elems = seed || multipleContexts( selector || "*", context.nodeType ? [ context ] : context, [] ), + + // Prefilter to get matcher input, preserving a map for seed-results synchronization + matcherIn = preFilter && ( seed || !selector ) ? + condense( elems, preMap, preFilter, context, xml ) : + elems, + + matcherOut = matcher ? + // If we have a postFinder, or filtered seed, or non-seed postFilter or preexisting results, + postFinder || ( seed ? preFilter : preexisting || postFilter ) ? + + // ...intermediate processing is necessary + [] : + + // ...otherwise use results directly + results : + matcherIn; + + // Find primary matches + if ( matcher ) { + matcher( matcherIn, matcherOut, context, xml ); + } + + // Apply postFilter + if ( postFilter ) { + temp = condense( matcherOut, postMap ); + postFilter( temp, [], context, xml ); + + // Un-match failing elements by moving them back to matcherIn + i = temp.length; + while ( i-- ) { + if ( (elem = temp[i]) ) { + matcherOut[ postMap[i] ] = !(matcherIn[ postMap[i] ] = elem); + } + } + } + + if ( seed ) { + if ( postFinder || preFilter ) { + if ( postFinder ) { + // Get the final matcherOut by condensing this intermediate into postFinder contexts + temp = []; + i = matcherOut.length; + while ( i-- ) { + if ( (elem = matcherOut[i]) ) { + // Restore matcherIn since elem is not yet a final match + temp.push( (matcherIn[i] = elem) ); + } + } + postFinder( null, (matcherOut = []), temp, xml ); + } + + // Move matched elements from seed to results to keep them synchronized + i = matcherOut.length; + while ( i-- ) { + if ( (elem = matcherOut[i]) && + (temp = postFinder ? indexOf.call( seed, elem ) : preMap[i]) > -1 ) { + + seed[temp] = !(results[temp] = elem); + } + } + } + + // Add elements to results, through postFinder if defined + } else { + matcherOut = condense( + matcherOut === results ? + matcherOut.splice( preexisting, matcherOut.length ) : + matcherOut + ); + if ( postFinder ) { + postFinder( null, results, matcherOut, xml ); + } else { + push.apply( results, matcherOut ); + } + } + }); +} + +function matcherFromTokens( tokens ) { + var checkContext, matcher, j, + len = tokens.length, + leadingRelative = Expr.relative[ tokens[0].type ], + implicitRelative = leadingRelative || Expr.relative[" "], + i = leadingRelative ? 1 : 0, + + // The foundational matcher ensures that elements are reachable from top-level context(s) + matchContext = addCombinator( function( elem ) { + return elem === checkContext; + }, implicitRelative, true ), + matchAnyContext = addCombinator( function( elem ) { + return indexOf.call( checkContext, elem ) > -1; + }, implicitRelative, true ), + matchers = [ function( elem, context, xml ) { + return ( !leadingRelative && ( xml || context !== outermostContext ) ) || ( + (checkContext = context).nodeType ? + matchContext( elem, context, xml ) : + matchAnyContext( elem, context, xml ) ); + } ]; + + for ( ; i < len; i++ ) { + if ( (matcher = Expr.relative[ tokens[i].type ]) ) { + matchers = [ addCombinator(elementMatcher( matchers ), matcher) ]; + } else { + matcher = Expr.filter[ tokens[i].type ].apply( null, tokens[i].matches ); + + // Return special upon seeing a positional matcher + if ( matcher[ expando ] ) { + // Find the next relative operator (if any) for proper handling + j = ++i; + for ( ; j < len; j++ ) { + if ( Expr.relative[ tokens[j].type ] ) { + break; + } + } + return setMatcher( + i > 1 && elementMatcher( matchers ), + i > 1 && toSelector( + // If the preceding token was a descendant combinator, insert an implicit any-element `*` + tokens.slice( 0, i - 1 ).concat({ value: tokens[ i - 2 ].type === " " ? "*" : "" }) + ).replace( rtrim, "$1" ), + matcher, + i < j && matcherFromTokens( tokens.slice( i, j ) ), + j < len && matcherFromTokens( (tokens = tokens.slice( j )) ), + j < len && toSelector( tokens ) + ); + } + matchers.push( matcher ); + } + } + + return elementMatcher( matchers ); +} + +function matcherFromGroupMatchers( elementMatchers, setMatchers ) { + var bySet = setMatchers.length > 0, + byElement = elementMatchers.length > 0, + superMatcher = function( seed, context, xml, results, outermost ) { + var elem, j, matcher, + matchedCount = 0, + i = "0", + unmatched = seed && [], + setMatched = [], + contextBackup = outermostContext, + // We must always have either seed elements or outermost context + elems = seed || byElement && Expr.find["TAG"]( "*", outermost ), + // Use integer dirruns iff this is the outermost matcher + dirrunsUnique = (dirruns += contextBackup == null ? 1 : Math.random() || 0.1), + len = elems.length; + + if ( outermost ) { + outermostContext = context !== document && context; + } + + // Add elements passing elementMatchers directly to results + // Keep `i` a string if there are no elements so `matchedCount` will be "00" below + // Support: IE<9, Safari + // Tolerate NodeList properties (IE: "length"; Safari: <number>) matching elements by id + for ( ; i !== len && (elem = elems[i]) != null; i++ ) { + if ( byElement && elem ) { + j = 0; + while ( (matcher = elementMatchers[j++]) ) { + if ( matcher( elem, context, xml ) ) { + results.push( elem ); + break; + } + } + if ( outermost ) { + dirruns = dirrunsUnique; + } + } + + // Track unmatched elements for set filters + if ( bySet ) { + // They will have gone through all possible matchers + if ( (elem = !matcher && elem) ) { + matchedCount--; + } + + // Lengthen the array for every element, matched or not + if ( seed ) { + unmatched.push( elem ); + } + } + } + + // Apply set filters to unmatched elements + matchedCount += i; + if ( bySet && i !== matchedCount ) { + j = 0; + while ( (matcher = setMatchers[j++]) ) { + matcher( unmatched, setMatched, context, xml ); + } + + if ( seed ) { + // Reintegrate element matches to eliminate the need for sorting + if ( matchedCount > 0 ) { + while ( i-- ) { + if ( !(unmatched[i] || setMatched[i]) ) { + setMatched[i] = pop.call( results ); + } + } + } + + // Discard index placeholder values to get only actual matches + setMatched = condense( setMatched ); + } + + // Add matches to results + push.apply( results, setMatched ); + + // Seedless set matches succeeding multiple successful matchers stipulate sorting + if ( outermost && !seed && setMatched.length > 0 && + ( matchedCount + setMatchers.length ) > 1 ) { + + Sizzle.uniqueSort( results ); + } + } + + // Override manipulation of globals by nested matchers + if ( outermost ) { + dirruns = dirrunsUnique; + outermostContext = contextBackup; + } + + return unmatched; + }; + + return bySet ? + markFunction( superMatcher ) : + superMatcher; +} + +compile = Sizzle.compile = function( selector, match /* Internal Use Only */ ) { + var i, + setMatchers = [], + elementMatchers = [], + cached = compilerCache[ selector + " " ]; + + if ( !cached ) { + // Generate a function of recursive functions that can be used to check each element + if ( !match ) { + match = tokenize( selector ); + } + i = match.length; + while ( i-- ) { + cached = matcherFromTokens( match[i] ); + if ( cached[ expando ] ) { + setMatchers.push( cached ); + } else { + elementMatchers.push( cached ); + } + } + + // Cache the compiled function + cached = compilerCache( selector, matcherFromGroupMatchers( elementMatchers, setMatchers ) ); + + // Save selector and tokenization + cached.selector = selector; + } + return cached; +}; + +/** + * A low-level selection function that works with Sizzle's compiled + * selector functions + * @param {String|Function} selector A selector or a pre-compiled + * selector function built with Sizzle.compile + * @param {Element} context + * @param {Array} [results] + * @param {Array} [seed] A set of elements to match against + */ +select = Sizzle.select = function( selector, context, results, seed ) { + var i, tokens, token, type, find, + compiled = typeof selector === "function" && selector, + match = !seed && tokenize( (selector = compiled.selector || selector) ); + + results = results || []; + + // Try to minimize operations if there is no seed and only one group + if ( match.length === 1 ) { + + // Take a shortcut and set the context if the root selector is an ID + tokens = match[0] = match[0].slice( 0 ); + if ( tokens.length > 2 && (token = tokens[0]).type === "ID" && + support.getById && context.nodeType === 9 && documentIsHTML && + Expr.relative[ tokens[1].type ] ) { + + context = ( Expr.find["ID"]( token.matches[0].replace(runescape, funescape), context ) || [] )[0]; + if ( !context ) { + return results; + + // Precompiled matchers will still verify ancestry, so step up a level + } else if ( compiled ) { + context = context.parentNode; + } + + selector = selector.slice( tokens.shift().value.length ); + } + + // Fetch a seed set for right-to-left matching + i = matchExpr["needsContext"].test( selector ) ? 0 : tokens.length; + while ( i-- ) { + token = tokens[i]; + + // Abort if we hit a combinator + if ( Expr.relative[ (type = token.type) ] ) { + break; + } + if ( (find = Expr.find[ type ]) ) { + // Search, expanding context for leading sibling combinators + if ( (seed = find( + token.matches[0].replace( runescape, funescape ), + rsibling.test( tokens[0].type ) && testContext( context.parentNode ) || context + )) ) { + + // If seed is empty or no tokens remain, we can return early + tokens.splice( i, 1 ); + selector = seed.length && toSelector( tokens ); + if ( !selector ) { + push.apply( results, seed ); + return results; + } + + break; + } + } + } + } + + // Compile and execute a filtering function if one is not provided + // Provide `match` to avoid retokenization if we modified the selector above + ( compiled || compile( selector, match ) )( + seed, + context, + !documentIsHTML, + results, + rsibling.test( selector ) && testContext( context.parentNode ) || context + ); + return results; +}; + +// One-time assignments + +// Sort stability +support.sortStable = expando.split("").sort( sortOrder ).join("") === expando; + +// Support: Chrome<14 +// Always assume duplicates if they aren't passed to the comparison function +support.detectDuplicates = !!hasDuplicate; + +// Initialize against the default document +setDocument(); + +// Support: Webkit<537.32 - Safari 6.0.3/Chrome 25 (fixed in Chrome 27) +// Detached nodes confoundingly follow *each other* +support.sortDetached = assert(function( div1 ) { + // Should return 1, but returns 4 (following) + return div1.compareDocumentPosition( document.createElement("div") ) & 1; +}); + +// Support: IE<8 +// Prevent attribute/property "interpolation" +// http://msdn.microsoft.com/en-us/library/ms536429%28VS.85%29.aspx +if ( !assert(function( div ) { + div.innerHTML = "<a href='#'></a>"; + return div.firstChild.getAttribute("href") === "#" ; +}) ) { + addHandle( "type|href|height|width", function( elem, name, isXML ) { + if ( !isXML ) { + return elem.getAttribute( name, name.toLowerCase() === "type" ? 1 : 2 ); + } + }); +} + +// Support: IE<9 +// Use defaultValue in place of getAttribute("value") +if ( !support.attributes || !assert(function( div ) { + div.innerHTML = "<input/>"; + div.firstChild.setAttribute( "value", "" ); + return div.firstChild.getAttribute( "value" ) === ""; +}) ) { + addHandle( "value", function( elem, name, isXML ) { + if ( !isXML && elem.nodeName.toLowerCase() === "input" ) { + return elem.defaultValue; + } + }); +} + +// Support: IE<9 +// Use getAttributeNode to fetch booleans when getAttribute lies +if ( !assert(function( div ) { + return div.getAttribute("disabled") == null; +}) ) { + addHandle( booleans, function( elem, name, isXML ) { + var val; + if ( !isXML ) { + return elem[ name ] === true ? name.toLowerCase() : + (val = elem.getAttributeNode( name )) && val.specified ? + val.value : + null; + } + }); +} + +return Sizzle; + +})( window ); + + + +jQuery.find = Sizzle; +jQuery.expr = Sizzle.selectors; +jQuery.expr[":"] = jQuery.expr.pseudos; +jQuery.unique = Sizzle.uniqueSort; +jQuery.text = Sizzle.getText; +jQuery.isXMLDoc = Sizzle.isXML; +jQuery.contains = Sizzle.contains; + + + +var rneedsContext = jQuery.expr.match.needsContext; + +var rsingleTag = (/^<(\w+)\s*\/?>(?:<\/\1>|)$/); + + + +var risSimple = /^.[^:#\[\.,]*$/; + +// Implement the identical functionality for filter and not +function winnow( elements, qualifier, not ) { + if ( jQuery.isFunction( qualifier ) ) { + return jQuery.grep( elements, function( elem, i ) { + /* jshint -W018 */ + return !!qualifier.call( elem, i, elem ) !== not; + }); + + } + + if ( qualifier.nodeType ) { + return jQuery.grep( elements, function( elem ) { + return ( elem === qualifier ) !== not; + }); + + } + + if ( typeof qualifier === "string" ) { + if ( risSimple.test( qualifier ) ) { + return jQuery.filter( qualifier, elements, not ); + } + + qualifier = jQuery.filter( qualifier, elements ); + } + + return jQuery.grep( elements, function( elem ) { + return ( jQuery.inArray( elem, qualifier ) >= 0 ) !== not; + }); +} + +jQuery.filter = function( expr, elems, not ) { + var elem = elems[ 0 ]; + + if ( not ) { + expr = ":not(" + expr + ")"; + } + + return elems.length === 1 && elem.nodeType === 1 ? + jQuery.find.matchesSelector( elem, expr ) ? [ elem ] : [] : + jQuery.find.matches( expr, jQuery.grep( elems, function( elem ) { + return elem.nodeType === 1; + })); +}; + +jQuery.fn.extend({ + find: function( selector ) { + var i, + ret = [], + self = this, + len = self.length; + + if ( typeof selector !== "string" ) { + return this.pushStack( jQuery( selector ).filter(function() { + for ( i = 0; i < len; i++ ) { + if ( jQuery.contains( self[ i ], this ) ) { + return true; + } + } + }) ); + } + + for ( i = 0; i < len; i++ ) { + jQuery.find( selector, self[ i ], ret ); + } + + // Needed because $( selector, context ) becomes $( context ).find( selector ) + ret = this.pushStack( len > 1 ? jQuery.unique( ret ) : ret ); + ret.selector = this.selector ? this.selector + " " + selector : selector; + return ret; + }, + filter: function( selector ) { + return this.pushStack( winnow(this, selector || [], false) ); + }, + not: function( selector ) { + return this.pushStack( winnow(this, selector || [], true) ); + }, + is: function( selector ) { + return !!winnow( + this, + + // If this is a positional/relative selector, check membership in the returned set + // so $("p:first").is("p:last") won't return true for a doc with two "p". + typeof selector === "string" && rneedsContext.test( selector ) ? + jQuery( selector ) : + selector || [], + false + ).length; + } +}); + + +// Initialize a jQuery object + + +// A central reference to the root jQuery(document) +var rootjQuery, + + // Use the correct document accordingly with window argument (sandbox) + document = window.document, + + // A simple way to check for HTML strings + // Prioritize #id over <tag> to avoid XSS via location.hash (#9521) + // Strict HTML recognition (#11290: must start with <) + rquickExpr = /^(?:\s*(<[\w\W]+>)[^>]*|#([\w-]*))$/, + + init = jQuery.fn.init = function( selector, context ) { + var match, elem; + + // HANDLE: $(""), $(null), $(undefined), $(false) + if ( !selector ) { + return this; + } + + // Handle HTML strings + if ( typeof selector === "string" ) { + if ( selector.charAt(0) === "<" && selector.charAt( selector.length - 1 ) === ">" && selector.length >= 3 ) { + // Assume that strings that start and end with <> are HTML and skip the regex check + match = [ null, selector, null ]; + + } else { + match = rquickExpr.exec( selector ); + } + + // Match html or make sure no context is specified for #id + if ( match && (match[1] || !context) ) { + + // HANDLE: $(html) -> $(array) + if ( match[1] ) { + context = context instanceof jQuery ? context[0] : context; + + // scripts is true for back-compat + // Intentionally let the error be thrown if parseHTML is not present + jQuery.merge( this, jQuery.parseHTML( + match[1], + context && context.nodeType ? context.ownerDocument || context : document, + true + ) ); + + // HANDLE: $(html, props) + if ( rsingleTag.test( match[1] ) && jQuery.isPlainObject( context ) ) { + for ( match in context ) { + // Properties of context are called as methods if possible + if ( jQuery.isFunction( this[ match ] ) ) { + this[ match ]( context[ match ] ); + + // ...and otherwise set as attributes + } else { + this.attr( match, context[ match ] ); + } + } + } + + return this; + + // HANDLE: $(#id) + } else { + elem = document.getElementById( match[2] ); + + // Check parentNode to catch when Blackberry 4.6 returns + // nodes that are no longer in the document #6963 + if ( elem && elem.parentNode ) { + // Handle the case where IE and Opera return items + // by name instead of ID + if ( elem.id !== match[2] ) { + return rootjQuery.find( selector ); + } + + // Otherwise, we inject the element directly into the jQuery object + this.length = 1; + this[0] = elem; + } + + this.context = document; + this.selector = selector; + return this; + } + + // HANDLE: $(expr, $(...)) + } else if ( !context || context.jquery ) { + return ( context || rootjQuery ).find( selector ); + + // HANDLE: $(expr, context) + // (which is just equivalent to: $(context).find(expr) + } else { + return this.constructor( context ).find( selector ); + } + + // HANDLE: $(DOMElement) + } else if ( selector.nodeType ) { + this.context = this[0] = selector; + this.length = 1; + return this; + + // HANDLE: $(function) + // Shortcut for document ready + } else if ( jQuery.isFunction( selector ) ) { + return typeof rootjQuery.ready !== "undefined" ? + rootjQuery.ready( selector ) : + // Execute immediately if ready is not present + selector( jQuery ); + } + + if ( selector.selector !== undefined ) { + this.selector = selector.selector; + this.context = selector.context; + } + + return jQuery.makeArray( selector, this ); + }; + +// Give the init function the jQuery prototype for later instantiation +init.prototype = jQuery.fn; + +// Initialize central reference +rootjQuery = jQuery( document ); + + +var rparentsprev = /^(?:parents|prev(?:Until|All))/, + // methods guaranteed to produce a unique set when starting from a unique set + guaranteedUnique = { + children: true, + contents: true, + next: true, + prev: true + }; + +jQuery.extend({ + dir: function( elem, dir, until ) { + var matched = [], + cur = elem[ dir ]; + + while ( cur && cur.nodeType !== 9 && (until === undefined || cur.nodeType !== 1 || !jQuery( cur ).is( until )) ) { + if ( cur.nodeType === 1 ) { + matched.push( cur ); + } + cur = cur[dir]; + } + return matched; + }, + + sibling: function( n, elem ) { + var r = []; + + for ( ; n; n = n.nextSibling ) { + if ( n.nodeType === 1 && n !== elem ) { + r.push( n ); + } + } + + return r; + } +}); + +jQuery.fn.extend({ + has: function( target ) { + var i, + targets = jQuery( target, this ), + len = targets.length; + + return this.filter(function() { + for ( i = 0; i < len; i++ ) { + if ( jQuery.contains( this, targets[i] ) ) { + return true; + } + } + }); + }, + + closest: function( selectors, context ) { + var cur, + i = 0, + l = this.length, + matched = [], + pos = rneedsContext.test( selectors ) || typeof selectors !== "string" ? + jQuery( selectors, context || this.context ) : + 0; + + for ( ; i < l; i++ ) { + for ( cur = this[i]; cur && cur !== context; cur = cur.parentNode ) { + // Always skip document fragments + if ( cur.nodeType < 11 && (pos ? + pos.index(cur) > -1 : + + // Don't pass non-elements to Sizzle + cur.nodeType === 1 && + jQuery.find.matchesSelector(cur, selectors)) ) { + + matched.push( cur ); + break; + } + } + } + + return this.pushStack( matched.length > 1 ? jQuery.unique( matched ) : matched ); + }, + + // Determine the position of an element within + // the matched set of elements + index: function( elem ) { + + // No argument, return index in parent + if ( !elem ) { + return ( this[0] && this[0].parentNode ) ? this.first().prevAll().length : -1; + } + + // index in selector + if ( typeof elem === "string" ) { + return jQuery.inArray( this[0], jQuery( elem ) ); + } + + // Locate the position of the desired element + return jQuery.inArray( + // If it receives a jQuery object, the first element is used + elem.jquery ? elem[0] : elem, this ); + }, + + add: function( selector, context ) { + return this.pushStack( + jQuery.unique( + jQuery.merge( this.get(), jQuery( selector, context ) ) + ) + ); + }, + + addBack: function( selector ) { + return this.add( selector == null ? + this.prevObject : this.prevObject.filter(selector) + ); + } +}); + +function sibling( cur, dir ) { + do { + cur = cur[ dir ]; + } while ( cur && cur.nodeType !== 1 ); + + return cur; +} + +jQuery.each({ + parent: function( elem ) { + var parent = elem.parentNode; + return parent && parent.nodeType !== 11 ? parent : null; + }, + parents: function( elem ) { + return jQuery.dir( elem, "parentNode" ); + }, + parentsUntil: function( elem, i, until ) { + return jQuery.dir( elem, "parentNode", until ); + }, + next: function( elem ) { + return sibling( elem, "nextSibling" ); + }, + prev: function( elem ) { + return sibling( elem, "previousSibling" ); + }, + nextAll: function( elem ) { + return jQuery.dir( elem, "nextSibling" ); + }, + prevAll: function( elem ) { + return jQuery.dir( elem, "previousSibling" ); + }, + nextUntil: function( elem, i, until ) { + return jQuery.dir( elem, "nextSibling", until ); + }, + prevUntil: function( elem, i, until ) { + return jQuery.dir( elem, "previousSibling", until ); + }, + siblings: function( elem ) { + return jQuery.sibling( ( elem.parentNode || {} ).firstChild, elem ); + }, + children: function( elem ) { + return jQuery.sibling( elem.firstChild ); + }, + contents: function( elem ) { + return jQuery.nodeName( elem, "iframe" ) ? + elem.contentDocument || elem.contentWindow.document : + jQuery.merge( [], elem.childNodes ); + } +}, function( name, fn ) { + jQuery.fn[ name ] = function( until, selector ) { + var ret = jQuery.map( this, fn, until ); + + if ( name.slice( -5 ) !== "Until" ) { + selector = until; + } + + if ( selector && typeof selector === "string" ) { + ret = jQuery.filter( selector, ret ); + } + + if ( this.length > 1 ) { + // Remove duplicates + if ( !guaranteedUnique[ name ] ) { + ret = jQuery.unique( ret ); + } + + // Reverse order for parents* and prev-derivatives + if ( rparentsprev.test( name ) ) { + ret = ret.reverse(); + } + } + + return this.pushStack( ret ); + }; +}); +var rnotwhite = (/\S+/g); + + + +// String to Object options format cache +var optionsCache = {}; + +// Convert String-formatted options into Object-formatted ones and store in cache +function createOptions( options ) { + var object = optionsCache[ options ] = {}; + jQuery.each( options.match( rnotwhite ) || [], function( _, flag ) { + object[ flag ] = true; + }); + return object; +} + +/* + * Create a callback list using the following parameters: + * + * options: an optional list of space-separated options that will change how + * the callback list behaves or a more traditional option object + * + * By default a callback list will act like an event callback list and can be + * "fired" multiple times. + * + * Possible options: + * + * once: will ensure the callback list can only be fired once (like a Deferred) + * + * memory: will keep track of previous values and will call any callback added + * after the list has been fired right away with the latest "memorized" + * values (like a Deferred) + * + * unique: will ensure a callback can only be added once (no duplicate in the list) + * + * stopOnFalse: interrupt callings when a callback returns false + * + */ +jQuery.Callbacks = function( options ) { + + // Convert options from String-formatted to Object-formatted if needed + // (we check in cache first) + options = typeof options === "string" ? + ( optionsCache[ options ] || createOptions( options ) ) : + jQuery.extend( {}, options ); + + var // Flag to know if list is currently firing + firing, + // Last fire value (for non-forgettable lists) + memory, + // Flag to know if list was already fired + fired, + // End of the loop when firing + firingLength, + // Index of currently firing callback (modified by remove if needed) + firingIndex, + // First callback to fire (used internally by add and fireWith) + firingStart, + // Actual callback list + list = [], + // Stack of fire calls for repeatable lists + stack = !options.once && [], + // Fire callbacks + fire = function( data ) { + memory = options.memory && data; + fired = true; + firingIndex = firingStart || 0; + firingStart = 0; + firingLength = list.length; + firing = true; + for ( ; list && firingIndex < firingLength; firingIndex++ ) { + if ( list[ firingIndex ].apply( data[ 0 ], data[ 1 ] ) === false && options.stopOnFalse ) { + memory = false; // To prevent further calls using add + break; + } + } + firing = false; + if ( list ) { + if ( stack ) { + if ( stack.length ) { + fire( stack.shift() ); + } + } else if ( memory ) { + list = []; + } else { + self.disable(); + } + } + }, + // Actual Callbacks object + self = { + // Add a callback or a collection of callbacks to the list + add: function() { + if ( list ) { + // First, we save the current length + var start = list.length; + (function add( args ) { + jQuery.each( args, function( _, arg ) { + var type = jQuery.type( arg ); + if ( type === "function" ) { + if ( !options.unique || !self.has( arg ) ) { + list.push( arg ); + } + } else if ( arg && arg.length && type !== "string" ) { + // Inspect recursively + add( arg ); + } + }); + })( arguments ); + // Do we need to add the callbacks to the + // current firing batch? + if ( firing ) { + firingLength = list.length; + // With memory, if we're not firing then + // we should call right away + } else if ( memory ) { + firingStart = start; + fire( memory ); + } + } + return this; + }, + // Remove a callback from the list + remove: function() { + if ( list ) { + jQuery.each( arguments, function( _, arg ) { + var index; + while ( ( index = jQuery.inArray( arg, list, index ) ) > -1 ) { + list.splice( index, 1 ); + // Handle firing indexes + if ( firing ) { + if ( index <= firingLength ) { + firingLength--; + } + if ( index <= firingIndex ) { + firingIndex--; + } + } + } + }); + } + return this; + }, + // Check if a given callback is in the list. + // If no argument is given, return whether or not list has callbacks attached. + has: function( fn ) { + return fn ? jQuery.inArray( fn, list ) > -1 : !!( list && list.length ); + }, + // Remove all callbacks from the list + empty: function() { + list = []; + firingLength = 0; + return this; + }, + // Have the list do nothing anymore + disable: function() { + list = stack = memory = undefined; + return this; + }, + // Is it disabled? + disabled: function() { + return !list; + }, + // Lock the list in its current state + lock: function() { + stack = undefined; + if ( !memory ) { + self.disable(); + } + return this; + }, + // Is it locked? + locked: function() { + return !stack; + }, + // Call all callbacks with the given context and arguments + fireWith: function( context, args ) { + if ( list && ( !fired || stack ) ) { + args = args || []; + args = [ context, args.slice ? args.slice() : args ]; + if ( firing ) { + stack.push( args ); + } else { + fire( args ); + } + } + return this; + }, + // Call all the callbacks with the given arguments + fire: function() { + self.fireWith( this, arguments ); + return this; + }, + // To know if the callbacks have already been called at least once + fired: function() { + return !!fired; + } + }; + + return self; +}; + + +jQuery.extend({ + + Deferred: function( func ) { + var tuples = [ + // action, add listener, listener list, final state + [ "resolve", "done", jQuery.Callbacks("once memory"), "resolved" ], + [ "reject", "fail", jQuery.Callbacks("once memory"), "rejected" ], + [ "notify", "progress", jQuery.Callbacks("memory") ] + ], + state = "pending", + promise = { + state: function() { + return state; + }, + always: function() { + deferred.done( arguments ).fail( arguments ); + return this; + }, + then: function( /* fnDone, fnFail, fnProgress */ ) { + var fns = arguments; + return jQuery.Deferred(function( newDefer ) { + jQuery.each( tuples, function( i, tuple ) { + var fn = jQuery.isFunction( fns[ i ] ) && fns[ i ]; + // deferred[ done | fail | progress ] for forwarding actions to newDefer + deferred[ tuple[1] ](function() { + var returned = fn && fn.apply( this, arguments ); + if ( returned && jQuery.isFunction( returned.promise ) ) { + returned.promise() + .done( newDefer.resolve ) + .fail( newDefer.reject ) + .progress( newDefer.notify ); + } else { + newDefer[ tuple[ 0 ] + "With" ]( this === promise ? newDefer.promise() : this, fn ? [ returned ] : arguments ); + } + }); + }); + fns = null; + }).promise(); + }, + // Get a promise for this deferred + // If obj is provided, the promise aspect is added to the object + promise: function( obj ) { + return obj != null ? jQuery.extend( obj, promise ) : promise; + } + }, + deferred = {}; + + // Keep pipe for back-compat + promise.pipe = promise.then; + + // Add list-specific methods + jQuery.each( tuples, function( i, tuple ) { + var list = tuple[ 2 ], + stateString = tuple[ 3 ]; + + // promise[ done | fail | progress ] = list.add + promise[ tuple[1] ] = list.add; + + // Handle state + if ( stateString ) { + list.add(function() { + // state = [ resolved | rejected ] + state = stateString; + + // [ reject_list | resolve_list ].disable; progress_list.lock + }, tuples[ i ^ 1 ][ 2 ].disable, tuples[ 2 ][ 2 ].lock ); + } + + // deferred[ resolve | reject | notify ] + deferred[ tuple[0] ] = function() { + deferred[ tuple[0] + "With" ]( this === deferred ? promise : this, arguments ); + return this; + }; + deferred[ tuple[0] + "With" ] = list.fireWith; + }); + + // Make the deferred a promise + promise.promise( deferred ); + + // Call given func if any + if ( func ) { + func.call( deferred, deferred ); + } + + // All done! + return deferred; + }, + + // Deferred helper + when: function( subordinate /* , ..., subordinateN */ ) { + var i = 0, + resolveValues = slice.call( arguments ), + length = resolveValues.length, + + // the count of uncompleted subordinates + remaining = length !== 1 || ( subordinate && jQuery.isFunction( subordinate.promise ) ) ? length : 0, + + // the master Deferred. If resolveValues consist of only a single Deferred, just use that. + deferred = remaining === 1 ? subordinate : jQuery.Deferred(), + + // Update function for both resolve and progress values + updateFunc = function( i, contexts, values ) { + return function( value ) { + contexts[ i ] = this; + values[ i ] = arguments.length > 1 ? slice.call( arguments ) : value; + if ( values === progressValues ) { + deferred.notifyWith( contexts, values ); + + } else if ( !(--remaining) ) { + deferred.resolveWith( contexts, values ); + } + }; + }, + + progressValues, progressContexts, resolveContexts; + + // add listeners to Deferred subordinates; treat others as resolved + if ( length > 1 ) { + progressValues = new Array( length ); + progressContexts = new Array( length ); + resolveContexts = new Array( length ); + for ( ; i < length; i++ ) { + if ( resolveValues[ i ] && jQuery.isFunction( resolveValues[ i ].promise ) ) { + resolveValues[ i ].promise() + .done( updateFunc( i, resolveContexts, resolveValues ) ) + .fail( deferred.reject ) + .progress( updateFunc( i, progressContexts, progressValues ) ); + } else { + --remaining; + } + } + } + + // if we're not waiting on anything, resolve the master + if ( !remaining ) { + deferred.resolveWith( resolveContexts, resolveValues ); + } + + return deferred.promise(); + } +}); + + +// The deferred used on DOM ready +var readyList; + +jQuery.fn.ready = function( fn ) { + // Add the callback + jQuery.ready.promise().done( fn ); + + return this; +}; + +jQuery.extend({ + // Is the DOM ready to be used? Set to true once it occurs. + isReady: false, + + // A counter to track how many items to wait for before + // the ready event fires. See #6781 + readyWait: 1, + + // Hold (or release) the ready event + holdReady: function( hold ) { + if ( hold ) { + jQuery.readyWait++; + } else { + jQuery.ready( true ); + } + }, + + // Handle when the DOM is ready + ready: function( wait ) { + + // Abort if there are pending holds or we're already ready + if ( wait === true ? --jQuery.readyWait : jQuery.isReady ) { + return; + } + + // Make sure body exists, at least, in case IE gets a little overzealous (ticket #5443). + if ( !document.body ) { + return setTimeout( jQuery.ready ); + } + + // Remember that the DOM is ready + jQuery.isReady = true; + + // If a normal DOM Ready event fired, decrement, and wait if need be + if ( wait !== true && --jQuery.readyWait > 0 ) { + return; + } + + // If there are functions bound, to execute + readyList.resolveWith( document, [ jQuery ] ); + + // Trigger any bound ready events + if ( jQuery.fn.triggerHandler ) { + jQuery( document ).triggerHandler( "ready" ); + jQuery( document ).off( "ready" ); + } + } +}); + +/** + * Clean-up method for dom ready events + */ +function detach() { + if ( document.addEventListener ) { + document.removeEventListener( "DOMContentLoaded", completed, false ); + window.removeEventListener( "load", completed, false ); + + } else { + document.detachEvent( "onreadystatechange", completed ); + window.detachEvent( "onload", completed ); + } +} + +/** + * The ready event handler and self cleanup method + */ +function completed() { + // readyState === "complete" is good enough for us to call the dom ready in oldIE + if ( document.addEventListener || event.type === "load" || document.readyState === "complete" ) { + detach(); + jQuery.ready(); + } +} + +jQuery.ready.promise = function( obj ) { + if ( !readyList ) { + + readyList = jQuery.Deferred(); + + // Catch cases where $(document).ready() is called after the browser event has already occurred. + // we once tried to use readyState "interactive" here, but it caused issues like the one + // discovered by ChrisS here: http://bugs.jquery.com/ticket/12282#comment:15 + if ( document.readyState === "complete" ) { + // Handle it asynchronously to allow scripts the opportunity to delay ready + setTimeout( jQuery.ready ); + + // Standards-based browsers support DOMContentLoaded + } else if ( document.addEventListener ) { + // Use the handy event callback + document.addEventListener( "DOMContentLoaded", completed, false ); + + // A fallback to window.onload, that will always work + window.addEventListener( "load", completed, false ); + + // If IE event model is used + } else { + // Ensure firing before onload, maybe late but safe also for iframes + document.attachEvent( "onreadystatechange", completed ); + + // A fallback to window.onload, that will always work + window.attachEvent( "onload", completed ); + + // If IE and not a frame + // continually check to see if the document is ready + var top = false; + + try { + top = window.frameElement == null && document.documentElement; + } catch(e) {} + + if ( top && top.doScroll ) { + (function doScrollCheck() { + if ( !jQuery.isReady ) { + + try { + // Use the trick by Diego Perini + // http://javascript.nwbox.com/IEContentLoaded/ + top.doScroll("left"); + } catch(e) { + return setTimeout( doScrollCheck, 50 ); + } + + // detach all dom ready events + detach(); + + // and execute any waiting functions + jQuery.ready(); + } + })(); + } + } + } + return readyList.promise( obj ); +}; + + +var strundefined = typeof undefined; + + + +// Support: IE<9 +// Iteration over object's inherited properties before its own +var i; +for ( i in jQuery( support ) ) { + break; +} +support.ownLast = i !== "0"; + +// Note: most support tests are defined in their respective modules. +// false until the test is run +support.inlineBlockNeedsLayout = false; + +// Execute ASAP in case we need to set body.style.zoom +jQuery(function() { + // Minified: var a,b,c,d + var val, div, body, container; + + body = document.getElementsByTagName( "body" )[ 0 ]; + if ( !body || !body.style ) { + // Return for frameset docs that don't have a body + return; + } + + // Setup + div = document.createElement( "div" ); + container = document.createElement( "div" ); + container.style.cssText = "position:absolute;border:0;width:0;height:0;top:0;left:-9999px"; + body.appendChild( container ).appendChild( div ); + + if ( typeof div.style.zoom !== strundefined ) { + // Support: IE<8 + // Check if natively block-level elements act like inline-block + // elements when setting their display to 'inline' and giving + // them layout + div.style.cssText = "display:inline;margin:0;border:0;padding:1px;width:1px;zoom:1"; + + support.inlineBlockNeedsLayout = val = div.offsetWidth === 3; + if ( val ) { + // Prevent IE 6 from affecting layout for positioned elements #11048 + // Prevent IE from shrinking the body in IE 7 mode #12869 + // Support: IE<8 + body.style.zoom = 1; + } + } + + body.removeChild( container ); +}); + + + + +(function() { + var div = document.createElement( "div" ); + + // Execute the test only if not already executed in another module. + if (support.deleteExpando == null) { + // Support: IE<9 + support.deleteExpando = true; + try { + delete div.test; + } catch( e ) { + support.deleteExpando = false; + } + } + + // Null elements to avoid leaks in IE. + div = null; +})(); + + +/** + * Determines whether an object can have data + */ +jQuery.acceptData = function( elem ) { + var noData = jQuery.noData[ (elem.nodeName + " ").toLowerCase() ], + nodeType = +elem.nodeType || 1; + + // Do not set data on non-element DOM nodes because it will not be cleared (#8335). + return nodeType !== 1 && nodeType !== 9 ? + false : + + // Nodes accept data unless otherwise specified; rejection can be conditional + !noData || noData !== true && elem.getAttribute("classid") === noData; +}; + + +var rbrace = /^(?:\{[\w\W]*\}|\[[\w\W]*\])$/, + rmultiDash = /([A-Z])/g; + +function dataAttr( elem, key, data ) { + // If nothing was found internally, try to fetch any + // data from the HTML5 data-* attribute + if ( data === undefined && elem.nodeType === 1 ) { + + var name = "data-" + key.replace( rmultiDash, "-$1" ).toLowerCase(); + + data = elem.getAttribute( name ); + + if ( typeof data === "string" ) { + try { + data = data === "true" ? true : + data === "false" ? false : + data === "null" ? null : + // Only convert to a number if it doesn't change the string + +data + "" === data ? +data : + rbrace.test( data ) ? jQuery.parseJSON( data ) : + data; + } catch( e ) {} + + // Make sure we set the data so it isn't changed later + jQuery.data( elem, key, data ); + + } else { + data = undefined; + } + } + + return data; +} + +// checks a cache object for emptiness +function isEmptyDataObject( obj ) { + var name; + for ( name in obj ) { + + // if the public data object is empty, the private is still empty + if ( name === "data" && jQuery.isEmptyObject( obj[name] ) ) { + continue; + } + if ( name !== "toJSON" ) { + return false; + } + } + + return true; +} + +function internalData( elem, name, data, pvt /* Internal Use Only */ ) { + if ( !jQuery.acceptData( elem ) ) { + return; + } + + var ret, thisCache, + internalKey = jQuery.expando, + + // We have to handle DOM nodes and JS objects differently because IE6-7 + // can't GC object references properly across the DOM-JS boundary + isNode = elem.nodeType, + + // Only DOM nodes need the global jQuery cache; JS object data is + // attached directly to the object so GC can occur automatically + cache = isNode ? jQuery.cache : elem, + + // Only defining an ID for JS objects if its cache already exists allows + // the code to shortcut on the same path as a DOM node with no cache + id = isNode ? elem[ internalKey ] : elem[ internalKey ] && internalKey; + + // Avoid doing any more work than we need to when trying to get data on an + // object that has no data at all + if ( (!id || !cache[id] || (!pvt && !cache[id].data)) && data === undefined && typeof name === "string" ) { + return; + } + + if ( !id ) { + // Only DOM nodes need a new unique ID for each element since their data + // ends up in the global cache + if ( isNode ) { + id = elem[ internalKey ] = deletedIds.pop() || jQuery.guid++; + } else { + id = internalKey; + } + } + + if ( !cache[ id ] ) { + // Avoid exposing jQuery metadata on plain JS objects when the object + // is serialized using JSON.stringify + cache[ id ] = isNode ? {} : { toJSON: jQuery.noop }; + } + + // An object can be passed to jQuery.data instead of a key/value pair; this gets + // shallow copied over onto the existing cache + if ( typeof name === "object" || typeof name === "function" ) { + if ( pvt ) { + cache[ id ] = jQuery.extend( cache[ id ], name ); + } else { + cache[ id ].data = jQuery.extend( cache[ id ].data, name ); + } + } + + thisCache = cache[ id ]; + + // jQuery data() is stored in a separate object inside the object's internal data + // cache in order to avoid key collisions between internal data and user-defined + // data. + if ( !pvt ) { + if ( !thisCache.data ) { + thisCache.data = {}; + } + + thisCache = thisCache.data; + } + + if ( data !== undefined ) { + thisCache[ jQuery.camelCase( name ) ] = data; + } + + // Check for both converted-to-camel and non-converted data property names + // If a data property was specified + if ( typeof name === "string" ) { + + // First Try to find as-is property data + ret = thisCache[ name ]; + + // Test for null|undefined property data + if ( ret == null ) { + + // Try to find the camelCased property + ret = thisCache[ jQuery.camelCase( name ) ]; + } + } else { + ret = thisCache; + } + + return ret; +} + +function internalRemoveData( elem, name, pvt ) { + if ( !jQuery.acceptData( elem ) ) { + return; + } + + var thisCache, i, + isNode = elem.nodeType, + + // See jQuery.data for more information + cache = isNode ? jQuery.cache : elem, + id = isNode ? elem[ jQuery.expando ] : jQuery.expando; + + // If there is already no cache entry for this object, there is no + // purpose in continuing + if ( !cache[ id ] ) { + return; + } + + if ( name ) { + + thisCache = pvt ? cache[ id ] : cache[ id ].data; + + if ( thisCache ) { + + // Support array or space separated string names for data keys + if ( !jQuery.isArray( name ) ) { + + // try the string as a key before any manipulation + if ( name in thisCache ) { + name = [ name ]; + } else { + + // split the camel cased version by spaces unless a key with the spaces exists + name = jQuery.camelCase( name ); + if ( name in thisCache ) { + name = [ name ]; + } else { + name = name.split(" "); + } + } + } else { + // If "name" is an array of keys... + // When data is initially created, via ("key", "val") signature, + // keys will be converted to camelCase. + // Since there is no way to tell _how_ a key was added, remove + // both plain key and camelCase key. #12786 + // This will only penalize the array argument path. + name = name.concat( jQuery.map( name, jQuery.camelCase ) ); + } + + i = name.length; + while ( i-- ) { + delete thisCache[ name[i] ]; + } + + // If there is no data left in the cache, we want to continue + // and let the cache object itself get destroyed + if ( pvt ? !isEmptyDataObject(thisCache) : !jQuery.isEmptyObject(thisCache) ) { + return; + } + } + } + + // See jQuery.data for more information + if ( !pvt ) { + delete cache[ id ].data; + + // Don't destroy the parent cache unless the internal data object + // had been the only thing left in it + if ( !isEmptyDataObject( cache[ id ] ) ) { + return; + } + } + + // Destroy the cache + if ( isNode ) { + jQuery.cleanData( [ elem ], true ); + + // Use delete when supported for expandos or `cache` is not a window per isWindow (#10080) + /* jshint eqeqeq: false */ + } else if ( support.deleteExpando || cache != cache.window ) { + /* jshint eqeqeq: true */ + delete cache[ id ]; + + // When all else fails, null + } else { + cache[ id ] = null; + } +} + +jQuery.extend({ + cache: {}, + + // The following elements (space-suffixed to avoid Object.prototype collisions) + // throw uncatchable exceptions if you attempt to set expando properties + noData: { + "applet ": true, + "embed ": true, + // ...but Flash objects (which have this classid) *can* handle expandos + "object ": "clsid:D27CDB6E-AE6D-11cf-96B8-444553540000" + }, + + hasData: function( elem ) { + elem = elem.nodeType ? jQuery.cache[ elem[jQuery.expando] ] : elem[ jQuery.expando ]; + return !!elem && !isEmptyDataObject( elem ); + }, + + data: function( elem, name, data ) { + return internalData( elem, name, data ); + }, + + removeData: function( elem, name ) { + return internalRemoveData( elem, name ); + }, + + // For internal use only. + _data: function( elem, name, data ) { + return internalData( elem, name, data, true ); + }, + + _removeData: function( elem, name ) { + return internalRemoveData( elem, name, true ); + } +}); + +jQuery.fn.extend({ + data: function( key, value ) { + var i, name, data, + elem = this[0], + attrs = elem && elem.attributes; + + // Special expections of .data basically thwart jQuery.access, + // so implement the relevant behavior ourselves + + // Gets all values + if ( key === undefined ) { + if ( this.length ) { + data = jQuery.data( elem ); + + if ( elem.nodeType === 1 && !jQuery._data( elem, "parsedAttrs" ) ) { + i = attrs.length; + while ( i-- ) { + + // Support: IE11+ + // The attrs elements can be null (#14894) + if ( attrs[ i ] ) { + name = attrs[ i ].name; + if ( name.indexOf( "data-" ) === 0 ) { + name = jQuery.camelCase( name.slice(5) ); + dataAttr( elem, name, data[ name ] ); + } + } + } + jQuery._data( elem, "parsedAttrs", true ); + } + } + + return data; + } + + // Sets multiple values + if ( typeof key === "object" ) { + return this.each(function() { + jQuery.data( this, key ); + }); + } + + return arguments.length > 1 ? + + // Sets one value + this.each(function() { + jQuery.data( this, key, value ); + }) : + + // Gets one value + // Try to fetch any internally stored data first + elem ? dataAttr( elem, key, jQuery.data( elem, key ) ) : undefined; + }, + + removeData: function( key ) { + return this.each(function() { + jQuery.removeData( this, key ); + }); + } +}); + + +jQuery.extend({ + queue: function( elem, type, data ) { + var queue; + + if ( elem ) { + type = ( type || "fx" ) + "queue"; + queue = jQuery._data( elem, type ); + + // Speed up dequeue by getting out quickly if this is just a lookup + if ( data ) { + if ( !queue || jQuery.isArray(data) ) { + queue = jQuery._data( elem, type, jQuery.makeArray(data) ); + } else { + queue.push( data ); + } + } + return queue || []; + } + }, + + dequeue: function( elem, type ) { + type = type || "fx"; + + var queue = jQuery.queue( elem, type ), + startLength = queue.length, + fn = queue.shift(), + hooks = jQuery._queueHooks( elem, type ), + next = function() { + jQuery.dequeue( elem, type ); + }; + + // If the fx queue is dequeued, always remove the progress sentinel + if ( fn === "inprogress" ) { + fn = queue.shift(); + startLength--; + } + + if ( fn ) { + + // Add a progress sentinel to prevent the fx queue from being + // automatically dequeued + if ( type === "fx" ) { + queue.unshift( "inprogress" ); + } + + // clear up the last queue stop function + delete hooks.stop; + fn.call( elem, next, hooks ); + } + + if ( !startLength && hooks ) { + hooks.empty.fire(); + } + }, + + // not intended for public consumption - generates a queueHooks object, or returns the current one + _queueHooks: function( elem, type ) { + var key = type + "queueHooks"; + return jQuery._data( elem, key ) || jQuery._data( elem, key, { + empty: jQuery.Callbacks("once memory").add(function() { + jQuery._removeData( elem, type + "queue" ); + jQuery._removeData( elem, key ); + }) + }); + } +}); + +jQuery.fn.extend({ + queue: function( type, data ) { + var setter = 2; + + if ( typeof type !== "string" ) { + data = type; + type = "fx"; + setter--; + } + + if ( arguments.length < setter ) { + return jQuery.queue( this[0], type ); + } + + return data === undefined ? + this : + this.each(function() { + var queue = jQuery.queue( this, type, data ); + + // ensure a hooks for this queue + jQuery._queueHooks( this, type ); + + if ( type === "fx" && queue[0] !== "inprogress" ) { + jQuery.dequeue( this, type ); + } + }); + }, + dequeue: function( type ) { + return this.each(function() { + jQuery.dequeue( this, type ); + }); + }, + clearQueue: function( type ) { + return this.queue( type || "fx", [] ); + }, + // Get a promise resolved when queues of a certain type + // are emptied (fx is the type by default) + promise: function( type, obj ) { + var tmp, + count = 1, + defer = jQuery.Deferred(), + elements = this, + i = this.length, + resolve = function() { + if ( !( --count ) ) { + defer.resolveWith( elements, [ elements ] ); + } + }; + + if ( typeof type !== "string" ) { + obj = type; + type = undefined; + } + type = type || "fx"; + + while ( i-- ) { + tmp = jQuery._data( elements[ i ], type + "queueHooks" ); + if ( tmp && tmp.empty ) { + count++; + tmp.empty.add( resolve ); + } + } + resolve(); + return defer.promise( obj ); + } +}); +var pnum = (/[+-]?(?:\d*\.|)\d+(?:[eE][+-]?\d+|)/).source; + +var cssExpand = [ "Top", "Right", "Bottom", "Left" ]; + +var isHidden = function( elem, el ) { + // isHidden might be called from jQuery#filter function; + // in that case, element will be second argument + elem = el || elem; + return jQuery.css( elem, "display" ) === "none" || !jQuery.contains( elem.ownerDocument, elem ); + }; + + + +// Multifunctional method to get and set values of a collection +// The value/s can optionally be executed if it's a function +var access = jQuery.access = function( elems, fn, key, value, chainable, emptyGet, raw ) { + var i = 0, + length = elems.length, + bulk = key == null; + + // Sets many values + if ( jQuery.type( key ) === "object" ) { + chainable = true; + for ( i in key ) { + jQuery.access( elems, fn, i, key[i], true, emptyGet, raw ); + } + + // Sets one value + } else if ( value !== undefined ) { + chainable = true; + + if ( !jQuery.isFunction( value ) ) { + raw = true; + } + + if ( bulk ) { + // Bulk operations run against the entire set + if ( raw ) { + fn.call( elems, value ); + fn = null; + + // ...except when executing function values + } else { + bulk = fn; + fn = function( elem, key, value ) { + return bulk.call( jQuery( elem ), value ); + }; + } + } + + if ( fn ) { + for ( ; i < length; i++ ) { + fn( elems[i], key, raw ? value : value.call( elems[i], i, fn( elems[i], key ) ) ); + } + } + } + + return chainable ? + elems : + + // Gets + bulk ? + fn.call( elems ) : + length ? fn( elems[0], key ) : emptyGet; +}; +var rcheckableType = (/^(?:checkbox|radio)$/i); + + + +(function() { + // Minified: var a,b,c + var input = document.createElement( "input" ), + div = document.createElement( "div" ), + fragment = document.createDocumentFragment(); + + // Setup + div.innerHTML = " <link/><table></table><a href='/a'>a</a><input type='checkbox'/>"; + + // IE strips leading whitespace when .innerHTML is used + support.leadingWhitespace = div.firstChild.nodeType === 3; + + // Make sure that tbody elements aren't automatically inserted + // IE will insert them into empty tables + support.tbody = !div.getElementsByTagName( "tbody" ).length; + + // Make sure that link elements get serialized correctly by innerHTML + // This requires a wrapper element in IE + support.htmlSerialize = !!div.getElementsByTagName( "link" ).length; + + // Makes sure cloning an html5 element does not cause problems + // Where outerHTML is undefined, this still works + support.html5Clone = + document.createElement( "nav" ).cloneNode( true ).outerHTML !== "<:nav></:nav>"; + + // Check if a disconnected checkbox will retain its checked + // value of true after appended to the DOM (IE6/7) + input.type = "checkbox"; + input.checked = true; + fragment.appendChild( input ); + support.appendChecked = input.checked; + + // Make sure textarea (and checkbox) defaultValue is properly cloned + // Support: IE6-IE11+ + div.innerHTML = "<textarea>x</textarea>"; + support.noCloneChecked = !!div.cloneNode( true ).lastChild.defaultValue; + + // #11217 - WebKit loses check when the name is after the checked attribute + fragment.appendChild( div ); + div.innerHTML = "<input type='radio' checked='checked' name='t'/>"; + + // Support: Safari 5.1, iOS 5.1, Android 4.x, Android 2.3 + // old WebKit doesn't clone checked state correctly in fragments + support.checkClone = div.cloneNode( true ).cloneNode( true ).lastChild.checked; + + // Support: IE<9 + // Opera does not clone events (and typeof div.attachEvent === undefined). + // IE9-10 clones events bound via attachEvent, but they don't trigger with .click() + support.noCloneEvent = true; + if ( div.attachEvent ) { + div.attachEvent( "onclick", function() { + support.noCloneEvent = false; + }); + + div.cloneNode( true ).click(); + } + + // Execute the test only if not already executed in another module. + if (support.deleteExpando == null) { + // Support: IE<9 + support.deleteExpando = true; + try { + delete div.test; + } catch( e ) { + support.deleteExpando = false; + } + } +})(); + + +(function() { + var i, eventName, + div = document.createElement( "div" ); + + // Support: IE<9 (lack submit/change bubble), Firefox 23+ (lack focusin event) + for ( i in { submit: true, change: true, focusin: true }) { + eventName = "on" + i; + + if ( !(support[ i + "Bubbles" ] = eventName in window) ) { + // Beware of CSP restrictions (https://developer.mozilla.org/en/Security/CSP) + div.setAttribute( eventName, "t" ); + support[ i + "Bubbles" ] = div.attributes[ eventName ].expando === false; + } + } + + // Null elements to avoid leaks in IE. + div = null; +})(); + + +var rformElems = /^(?:input|select|textarea)$/i, + rkeyEvent = /^key/, + rmouseEvent = /^(?:mouse|pointer|contextmenu)|click/, + rfocusMorph = /^(?:focusinfocus|focusoutblur)$/, + rtypenamespace = /^([^.]*)(?:\.(.+)|)$/; + +function returnTrue() { + return true; +} + +function returnFalse() { + return false; +} + +function safeActiveElement() { + try { + return document.activeElement; + } catch ( err ) { } +} + +/* + * Helper functions for managing events -- not part of the public interface. + * Props to Dean Edwards' addEvent library for many of the ideas. + */ +jQuery.event = { + + global: {}, + + add: function( elem, types, handler, data, selector ) { + var tmp, events, t, handleObjIn, + special, eventHandle, handleObj, + handlers, type, namespaces, origType, + elemData = jQuery._data( elem ); + + // Don't attach events to noData or text/comment nodes (but allow plain objects) + if ( !elemData ) { + return; + } + + // Caller can pass in an object of custom data in lieu of the handler + if ( handler.handler ) { + handleObjIn = handler; + handler = handleObjIn.handler; + selector = handleObjIn.selector; + } + + // Make sure that the handler has a unique ID, used to find/remove it later + if ( !handler.guid ) { + handler.guid = jQuery.guid++; + } + + // Init the element's event structure and main handler, if this is the first + if ( !(events = elemData.events) ) { + events = elemData.events = {}; + } + if ( !(eventHandle = elemData.handle) ) { + eventHandle = elemData.handle = function( e ) { + // Discard the second event of a jQuery.event.trigger() and + // when an event is called after a page has unloaded + return typeof jQuery !== strundefined && (!e || jQuery.event.triggered !== e.type) ? + jQuery.event.dispatch.apply( eventHandle.elem, arguments ) : + undefined; + }; + // Add elem as a property of the handle fn to prevent a memory leak with IE non-native events + eventHandle.elem = elem; + } + + // Handle multiple events separated by a space + types = ( types || "" ).match( rnotwhite ) || [ "" ]; + t = types.length; + while ( t-- ) { + tmp = rtypenamespace.exec( types[t] ) || []; + type = origType = tmp[1]; + namespaces = ( tmp[2] || "" ).split( "." ).sort(); + + // There *must* be a type, no attaching namespace-only handlers + if ( !type ) { + continue; + } + + // If event changes its type, use the special event handlers for the changed type + special = jQuery.event.special[ type ] || {}; + + // If selector defined, determine special event api type, otherwise given type + type = ( selector ? special.delegateType : special.bindType ) || type; + + // Update special based on newly reset type + special = jQuery.event.special[ type ] || {}; + + // handleObj is passed to all event handlers + handleObj = jQuery.extend({ + type: type, + origType: origType, + data: data, + handler: handler, + guid: handler.guid, + selector: selector, + needsContext: selector && jQuery.expr.match.needsContext.test( selector ), + namespace: namespaces.join(".") + }, handleObjIn ); + + // Init the event handler queue if we're the first + if ( !(handlers = events[ type ]) ) { + handlers = events[ type ] = []; + handlers.delegateCount = 0; + + // Only use addEventListener/attachEvent if the special events handler returns false + if ( !special.setup || special.setup.call( elem, data, namespaces, eventHandle ) === false ) { + // Bind the global event handler to the element + if ( elem.addEventListener ) { + elem.addEventListener( type, eventHandle, false ); + + } else if ( elem.attachEvent ) { + elem.attachEvent( "on" + type, eventHandle ); + } + } + } + + if ( special.add ) { + special.add.call( elem, handleObj ); + + if ( !handleObj.handler.guid ) { + handleObj.handler.guid = handler.guid; + } + } + + // Add to the element's handler list, delegates in front + if ( selector ) { + handlers.splice( handlers.delegateCount++, 0, handleObj ); + } else { + handlers.push( handleObj ); + } + + // Keep track of which events have ever been used, for event optimization + jQuery.event.global[ type ] = true; + } + + // Nullify elem to prevent memory leaks in IE + elem = null; + }, + + // Detach an event or set of events from an element + remove: function( elem, types, handler, selector, mappedTypes ) { + var j, handleObj, tmp, + origCount, t, events, + special, handlers, type, + namespaces, origType, + elemData = jQuery.hasData( elem ) && jQuery._data( elem ); + + if ( !elemData || !(events = elemData.events) ) { + return; + } + + // Once for each type.namespace in types; type may be omitted + types = ( types || "" ).match( rnotwhite ) || [ "" ]; + t = types.length; + while ( t-- ) { + tmp = rtypenamespace.exec( types[t] ) || []; + type = origType = tmp[1]; + namespaces = ( tmp[2] || "" ).split( "." ).sort(); + + // Unbind all events (on this namespace, if provided) for the element + if ( !type ) { + for ( type in events ) { + jQuery.event.remove( elem, type + types[ t ], handler, selector, true ); + } + continue; + } + + special = jQuery.event.special[ type ] || {}; + type = ( selector ? special.delegateType : special.bindType ) || type; + handlers = events[ type ] || []; + tmp = tmp[2] && new RegExp( "(^|\\.)" + namespaces.join("\\.(?:.*\\.|)") + "(\\.|$)" ); + + // Remove matching events + origCount = j = handlers.length; + while ( j-- ) { + handleObj = handlers[ j ]; + + if ( ( mappedTypes || origType === handleObj.origType ) && + ( !handler || handler.guid === handleObj.guid ) && + ( !tmp || tmp.test( handleObj.namespace ) ) && + ( !selector || selector === handleObj.selector || selector === "**" && handleObj.selector ) ) { + handlers.splice( j, 1 ); + + if ( handleObj.selector ) { + handlers.delegateCount--; + } + if ( special.remove ) { + special.remove.call( elem, handleObj ); + } + } + } + + // Remove generic event handler if we removed something and no more handlers exist + // (avoids potential for endless recursion during removal of special event handlers) + if ( origCount && !handlers.length ) { + if ( !special.teardown || special.teardown.call( elem, namespaces, elemData.handle ) === false ) { + jQuery.removeEvent( elem, type, elemData.handle ); + } + + delete events[ type ]; + } + } + + // Remove the expando if it's no longer used + if ( jQuery.isEmptyObject( events ) ) { + delete elemData.handle; + + // removeData also checks for emptiness and clears the expando if empty + // so use it instead of delete + jQuery._removeData( elem, "events" ); + } + }, + + trigger: function( event, data, elem, onlyHandlers ) { + var handle, ontype, cur, + bubbleType, special, tmp, i, + eventPath = [ elem || document ], + type = hasOwn.call( event, "type" ) ? event.type : event, + namespaces = hasOwn.call( event, "namespace" ) ? event.namespace.split(".") : []; + + cur = tmp = elem = elem || document; + + // Don't do events on text and comment nodes + if ( elem.nodeType === 3 || elem.nodeType === 8 ) { + return; + } + + // focus/blur morphs to focusin/out; ensure we're not firing them right now + if ( rfocusMorph.test( type + jQuery.event.triggered ) ) { + return; + } + + if ( type.indexOf(".") >= 0 ) { + // Namespaced trigger; create a regexp to match event type in handle() + namespaces = type.split("."); + type = namespaces.shift(); + namespaces.sort(); + } + ontype = type.indexOf(":") < 0 && "on" + type; + + // Caller can pass in a jQuery.Event object, Object, or just an event type string + event = event[ jQuery.expando ] ? + event : + new jQuery.Event( type, typeof event === "object" && event ); + + // Trigger bitmask: & 1 for native handlers; & 2 for jQuery (always true) + event.isTrigger = onlyHandlers ? 2 : 3; + event.namespace = namespaces.join("."); + event.namespace_re = event.namespace ? + new RegExp( "(^|\\.)" + namespaces.join("\\.(?:.*\\.|)") + "(\\.|$)" ) : + null; + + // Clean up the event in case it is being reused + event.result = undefined; + if ( !event.target ) { + event.target = elem; + } + + // Clone any incoming data and prepend the event, creating the handler arg list + data = data == null ? + [ event ] : + jQuery.makeArray( data, [ event ] ); + + // Allow special events to draw outside the lines + special = jQuery.event.special[ type ] || {}; + if ( !onlyHandlers && special.trigger && special.trigger.apply( elem, data ) === false ) { + return; + } + + // Determine event propagation path in advance, per W3C events spec (#9951) + // Bubble up to document, then to window; watch for a global ownerDocument var (#9724) + if ( !onlyHandlers && !special.noBubble && !jQuery.isWindow( elem ) ) { + + bubbleType = special.delegateType || type; + if ( !rfocusMorph.test( bubbleType + type ) ) { + cur = cur.parentNode; + } + for ( ; cur; cur = cur.parentNode ) { + eventPath.push( cur ); + tmp = cur; + } + + // Only add window if we got to document (e.g., not plain obj or detached DOM) + if ( tmp === (elem.ownerDocument || document) ) { + eventPath.push( tmp.defaultView || tmp.parentWindow || window ); + } + } + + // Fire handlers on the event path + i = 0; + while ( (cur = eventPath[i++]) && !event.isPropagationStopped() ) { + + event.type = i > 1 ? + bubbleType : + special.bindType || type; + + // jQuery handler + handle = ( jQuery._data( cur, "events" ) || {} )[ event.type ] && jQuery._data( cur, "handle" ); + if ( handle ) { + handle.apply( cur, data ); + } + + // Native handler + handle = ontype && cur[ ontype ]; + if ( handle && handle.apply && jQuery.acceptData( cur ) ) { + event.result = handle.apply( cur, data ); + if ( event.result === false ) { + event.preventDefault(); + } + } + } + event.type = type; + + // If nobody prevented the default action, do it now + if ( !onlyHandlers && !event.isDefaultPrevented() ) { + + if ( (!special._default || special._default.apply( eventPath.pop(), data ) === false) && + jQuery.acceptData( elem ) ) { + + // Call a native DOM method on the target with the same name name as the event. + // Can't use an .isFunction() check here because IE6/7 fails that test. + // Don't do default actions on window, that's where global variables be (#6170) + if ( ontype && elem[ type ] && !jQuery.isWindow( elem ) ) { + + // Don't re-trigger an onFOO event when we call its FOO() method + tmp = elem[ ontype ]; + + if ( tmp ) { + elem[ ontype ] = null; + } + + // Prevent re-triggering of the same event, since we already bubbled it above + jQuery.event.triggered = type; + try { + elem[ type ](); + } catch ( e ) { + // IE<9 dies on focus/blur to hidden element (#1486,#12518) + // only reproducible on winXP IE8 native, not IE9 in IE8 mode + } + jQuery.event.triggered = undefined; + + if ( tmp ) { + elem[ ontype ] = tmp; + } + } + } + } + + return event.result; + }, + + dispatch: function( event ) { + + // Make a writable jQuery.Event from the native event object + event = jQuery.event.fix( event ); + + var i, ret, handleObj, matched, j, + handlerQueue = [], + args = slice.call( arguments ), + handlers = ( jQuery._data( this, "events" ) || {} )[ event.type ] || [], + special = jQuery.event.special[ event.type ] || {}; + + // Use the fix-ed jQuery.Event rather than the (read-only) native event + args[0] = event; + event.delegateTarget = this; + + // Call the preDispatch hook for the mapped type, and let it bail if desired + if ( special.preDispatch && special.preDispatch.call( this, event ) === false ) { + return; + } + + // Determine handlers + handlerQueue = jQuery.event.handlers.call( this, event, handlers ); + + // Run delegates first; they may want to stop propagation beneath us + i = 0; + while ( (matched = handlerQueue[ i++ ]) && !event.isPropagationStopped() ) { + event.currentTarget = matched.elem; + + j = 0; + while ( (handleObj = matched.handlers[ j++ ]) && !event.isImmediatePropagationStopped() ) { + + // Triggered event must either 1) have no namespace, or + // 2) have namespace(s) a subset or equal to those in the bound event (both can have no namespace). + if ( !event.namespace_re || event.namespace_re.test( handleObj.namespace ) ) { + + event.handleObj = handleObj; + event.data = handleObj.data; + + ret = ( (jQuery.event.special[ handleObj.origType ] || {}).handle || handleObj.handler ) + .apply( matched.elem, args ); + + if ( ret !== undefined ) { + if ( (event.result = ret) === false ) { + event.preventDefault(); + event.stopPropagation(); + } + } + } + } + } + + // Call the postDispatch hook for the mapped type + if ( special.postDispatch ) { + special.postDispatch.call( this, event ); + } + + return event.result; + }, + + handlers: function( event, handlers ) { + var sel, handleObj, matches, i, + handlerQueue = [], + delegateCount = handlers.delegateCount, + cur = event.target; + + // Find delegate handlers + // Black-hole SVG <use> instance trees (#13180) + // Avoid non-left-click bubbling in Firefox (#3861) + if ( delegateCount && cur.nodeType && (!event.button || event.type !== "click") ) { + + /* jshint eqeqeq: false */ + for ( ; cur != this; cur = cur.parentNode || this ) { + /* jshint eqeqeq: true */ + + // Don't check non-elements (#13208) + // Don't process clicks on disabled elements (#6911, #8165, #11382, #11764) + if ( cur.nodeType === 1 && (cur.disabled !== true || event.type !== "click") ) { + matches = []; + for ( i = 0; i < delegateCount; i++ ) { + handleObj = handlers[ i ]; + + // Don't conflict with Object.prototype properties (#13203) + sel = handleObj.selector + " "; + + if ( matches[ sel ] === undefined ) { + matches[ sel ] = handleObj.needsContext ? + jQuery( sel, this ).index( cur ) >= 0 : + jQuery.find( sel, this, null, [ cur ] ).length; + } + if ( matches[ sel ] ) { + matches.push( handleObj ); + } + } + if ( matches.length ) { + handlerQueue.push({ elem: cur, handlers: matches }); + } + } + } + } + + // Add the remaining (directly-bound) handlers + if ( delegateCount < handlers.length ) { + handlerQueue.push({ elem: this, handlers: handlers.slice( delegateCount ) }); + } + + return handlerQueue; + }, + + fix: function( event ) { + if ( event[ jQuery.expando ] ) { + return event; + } + + // Create a writable copy of the event object and normalize some properties + var i, prop, copy, + type = event.type, + originalEvent = event, + fixHook = this.fixHooks[ type ]; + + if ( !fixHook ) { + this.fixHooks[ type ] = fixHook = + rmouseEvent.test( type ) ? this.mouseHooks : + rkeyEvent.test( type ) ? this.keyHooks : + {}; + } + copy = fixHook.props ? this.props.concat( fixHook.props ) : this.props; + + event = new jQuery.Event( originalEvent ); + + i = copy.length; + while ( i-- ) { + prop = copy[ i ]; + event[ prop ] = originalEvent[ prop ]; + } + + // Support: IE<9 + // Fix target property (#1925) + if ( !event.target ) { + event.target = originalEvent.srcElement || document; + } + + // Support: Chrome 23+, Safari? + // Target should not be a text node (#504, #13143) + if ( event.target.nodeType === 3 ) { + event.target = event.target.parentNode; + } + + // Support: IE<9 + // For mouse/key events, metaKey==false if it's undefined (#3368, #11328) + event.metaKey = !!event.metaKey; + + return fixHook.filter ? fixHook.filter( event, originalEvent ) : event; + }, + + // Includes some event props shared by KeyEvent and MouseEvent + props: "altKey bubbles cancelable ctrlKey currentTarget eventPhase metaKey relatedTarget shiftKey target timeStamp view which".split(" "), + + fixHooks: {}, + + keyHooks: { + props: "char charCode key keyCode".split(" "), + filter: function( event, original ) { + + // Add which for key events + if ( event.which == null ) { + event.which = original.charCode != null ? original.charCode : original.keyCode; + } + + return event; + } + }, + + mouseHooks: { + props: "button buttons clientX clientY fromElement offsetX offsetY pageX pageY screenX screenY toElement".split(" "), + filter: function( event, original ) { + var body, eventDoc, doc, + button = original.button, + fromElement = original.fromElement; + + // Calculate pageX/Y if missing and clientX/Y available + if ( event.pageX == null && original.clientX != null ) { + eventDoc = event.target.ownerDocument || document; + doc = eventDoc.documentElement; + body = eventDoc.body; + + event.pageX = original.clientX + ( doc && doc.scrollLeft || body && body.scrollLeft || 0 ) - ( doc && doc.clientLeft || body && body.clientLeft || 0 ); + event.pageY = original.clientY + ( doc && doc.scrollTop || body && body.scrollTop || 0 ) - ( doc && doc.clientTop || body && body.clientTop || 0 ); + } + + // Add relatedTarget, if necessary + if ( !event.relatedTarget && fromElement ) { + event.relatedTarget = fromElement === event.target ? original.toElement : fromElement; + } + + // Add which for click: 1 === left; 2 === middle; 3 === right + // Note: button is not normalized, so don't use it + if ( !event.which && button !== undefined ) { + event.which = ( button & 1 ? 1 : ( button & 2 ? 3 : ( button & 4 ? 2 : 0 ) ) ); + } + + return event; + } + }, + + special: { + load: { + // Prevent triggered image.load events from bubbling to window.load + noBubble: true + }, + focus: { + // Fire native event if possible so blur/focus sequence is correct + trigger: function() { + if ( this !== safeActiveElement() && this.focus ) { + try { + this.focus(); + return false; + } catch ( e ) { + // Support: IE<9 + // If we error on focus to hidden element (#1486, #12518), + // let .trigger() run the handlers + } + } + }, + delegateType: "focusin" + }, + blur: { + trigger: function() { + if ( this === safeActiveElement() && this.blur ) { + this.blur(); + return false; + } + }, + delegateType: "focusout" + }, + click: { + // For checkbox, fire native event so checked state will be right + trigger: function() { + if ( jQuery.nodeName( this, "input" ) && this.type === "checkbox" && this.click ) { + this.click(); + return false; + } + }, + + // For cross-browser consistency, don't fire native .click() on links + _default: function( event ) { + return jQuery.nodeName( event.target, "a" ); + } + }, + + beforeunload: { + postDispatch: function( event ) { + + // Support: Firefox 20+ + // Firefox doesn't alert if the returnValue field is not set. + if ( event.result !== undefined && event.originalEvent ) { + event.originalEvent.returnValue = event.result; + } + } + } + }, + + simulate: function( type, elem, event, bubble ) { + // Piggyback on a donor event to simulate a different one. + // Fake originalEvent to avoid donor's stopPropagation, but if the + // simulated event prevents default then we do the same on the donor. + var e = jQuery.extend( + new jQuery.Event(), + event, + { + type: type, + isSimulated: true, + originalEvent: {} + } + ); + if ( bubble ) { + jQuery.event.trigger( e, null, elem ); + } else { + jQuery.event.dispatch.call( elem, e ); + } + if ( e.isDefaultPrevented() ) { + event.preventDefault(); + } + } +}; + +jQuery.removeEvent = document.removeEventListener ? + function( elem, type, handle ) { + if ( elem.removeEventListener ) { + elem.removeEventListener( type, handle, false ); + } + } : + function( elem, type, handle ) { + var name = "on" + type; + + if ( elem.detachEvent ) { + + // #8545, #7054, preventing memory leaks for custom events in IE6-8 + // detachEvent needed property on element, by name of that event, to properly expose it to GC + if ( typeof elem[ name ] === strundefined ) { + elem[ name ] = null; + } + + elem.detachEvent( name, handle ); + } + }; + +jQuery.Event = function( src, props ) { + // Allow instantiation without the 'new' keyword + if ( !(this instanceof jQuery.Event) ) { + return new jQuery.Event( src, props ); + } + + // Event object + if ( src && src.type ) { + this.originalEvent = src; + this.type = src.type; + + // Events bubbling up the document may have been marked as prevented + // by a handler lower down the tree; reflect the correct value. + this.isDefaultPrevented = src.defaultPrevented || + src.defaultPrevented === undefined && + // Support: IE < 9, Android < 4.0 + src.returnValue === false ? + returnTrue : + returnFalse; + + // Event type + } else { + this.type = src; + } + + // Put explicitly provided properties onto the event object + if ( props ) { + jQuery.extend( this, props ); + } + + // Create a timestamp if incoming event doesn't have one + this.timeStamp = src && src.timeStamp || jQuery.now(); + + // Mark it as fixed + this[ jQuery.expando ] = true; +}; + +// jQuery.Event is based on DOM3 Events as specified by the ECMAScript Language Binding +// http://www.w3.org/TR/2003/WD-DOM-Level-3-Events-20030331/ecma-script-binding.html +jQuery.Event.prototype = { + isDefaultPrevented: returnFalse, + isPropagationStopped: returnFalse, + isImmediatePropagationStopped: returnFalse, + + preventDefault: function() { + var e = this.originalEvent; + + this.isDefaultPrevented = returnTrue; + if ( !e ) { + return; + } + + // If preventDefault exists, run it on the original event + if ( e.preventDefault ) { + e.preventDefault(); + + // Support: IE + // Otherwise set the returnValue property of the original event to false + } else { + e.returnValue = false; + } + }, + stopPropagation: function() { + var e = this.originalEvent; + + this.isPropagationStopped = returnTrue; + if ( !e ) { + return; + } + // If stopPropagation exists, run it on the original event + if ( e.stopPropagation ) { + e.stopPropagation(); + } + + // Support: IE + // Set the cancelBubble property of the original event to true + e.cancelBubble = true; + }, + stopImmediatePropagation: function() { + var e = this.originalEvent; + + this.isImmediatePropagationStopped = returnTrue; + + if ( e && e.stopImmediatePropagation ) { + e.stopImmediatePropagation(); + } + + this.stopPropagation(); + } +}; + +// Create mouseenter/leave events using mouseover/out and event-time checks +jQuery.each({ + mouseenter: "mouseover", + mouseleave: "mouseout", + pointerenter: "pointerover", + pointerleave: "pointerout" +}, function( orig, fix ) { + jQuery.event.special[ orig ] = { + delegateType: fix, + bindType: fix, + + handle: function( event ) { + var ret, + target = this, + related = event.relatedTarget, + handleObj = event.handleObj; + + // For mousenter/leave call the handler if related is outside the target. + // NB: No relatedTarget if the mouse left/entered the browser window + if ( !related || (related !== target && !jQuery.contains( target, related )) ) { + event.type = handleObj.origType; + ret = handleObj.handler.apply( this, arguments ); + event.type = fix; + } + return ret; + } + }; +}); + +// IE submit delegation +if ( !support.submitBubbles ) { + + jQuery.event.special.submit = { + setup: function() { + // Only need this for delegated form submit events + if ( jQuery.nodeName( this, "form" ) ) { + return false; + } + + // Lazy-add a submit handler when a descendant form may potentially be submitted + jQuery.event.add( this, "click._submit keypress._submit", function( e ) { + // Node name check avoids a VML-related crash in IE (#9807) + var elem = e.target, + form = jQuery.nodeName( elem, "input" ) || jQuery.nodeName( elem, "button" ) ? elem.form : undefined; + if ( form && !jQuery._data( form, "submitBubbles" ) ) { + jQuery.event.add( form, "submit._submit", function( event ) { + event._submit_bubble = true; + }); + jQuery._data( form, "submitBubbles", true ); + } + }); + // return undefined since we don't need an event listener + }, + + postDispatch: function( event ) { + // If form was submitted by the user, bubble the event up the tree + if ( event._submit_bubble ) { + delete event._submit_bubble; + if ( this.parentNode && !event.isTrigger ) { + jQuery.event.simulate( "submit", this.parentNode, event, true ); + } + } + }, + + teardown: function() { + // Only need this for delegated form submit events + if ( jQuery.nodeName( this, "form" ) ) { + return false; + } + + // Remove delegated handlers; cleanData eventually reaps submit handlers attached above + jQuery.event.remove( this, "._submit" ); + } + }; +} + +// IE change delegation and checkbox/radio fix +if ( !support.changeBubbles ) { + + jQuery.event.special.change = { + + setup: function() { + + if ( rformElems.test( this.nodeName ) ) { + // IE doesn't fire change on a check/radio until blur; trigger it on click + // after a propertychange. Eat the blur-change in special.change.handle. + // This still fires onchange a second time for check/radio after blur. + if ( this.type === "checkbox" || this.type === "radio" ) { + jQuery.event.add( this, "propertychange._change", function( event ) { + if ( event.originalEvent.propertyName === "checked" ) { + this._just_changed = true; + } + }); + jQuery.event.add( this, "click._change", function( event ) { + if ( this._just_changed && !event.isTrigger ) { + this._just_changed = false; + } + // Allow triggered, simulated change events (#11500) + jQuery.event.simulate( "change", this, event, true ); + }); + } + return false; + } + // Delegated event; lazy-add a change handler on descendant inputs + jQuery.event.add( this, "beforeactivate._change", function( e ) { + var elem = e.target; + + if ( rformElems.test( elem.nodeName ) && !jQuery._data( elem, "changeBubbles" ) ) { + jQuery.event.add( elem, "change._change", function( event ) { + if ( this.parentNode && !event.isSimulated && !event.isTrigger ) { + jQuery.event.simulate( "change", this.parentNode, event, true ); + } + }); + jQuery._data( elem, "changeBubbles", true ); + } + }); + }, + + handle: function( event ) { + var elem = event.target; + + // Swallow native change events from checkbox/radio, we already triggered them above + if ( this !== elem || event.isSimulated || event.isTrigger || (elem.type !== "radio" && elem.type !== "checkbox") ) { + return event.handleObj.handler.apply( this, arguments ); + } + }, + + teardown: function() { + jQuery.event.remove( this, "._change" ); + + return !rformElems.test( this.nodeName ); + } + }; +} + +// Create "bubbling" focus and blur events +if ( !support.focusinBubbles ) { + jQuery.each({ focus: "focusin", blur: "focusout" }, function( orig, fix ) { + + // Attach a single capturing handler on the document while someone wants focusin/focusout + var handler = function( event ) { + jQuery.event.simulate( fix, event.target, jQuery.event.fix( event ), true ); + }; + + jQuery.event.special[ fix ] = { + setup: function() { + var doc = this.ownerDocument || this, + attaches = jQuery._data( doc, fix ); + + if ( !attaches ) { + doc.addEventListener( orig, handler, true ); + } + jQuery._data( doc, fix, ( attaches || 0 ) + 1 ); + }, + teardown: function() { + var doc = this.ownerDocument || this, + attaches = jQuery._data( doc, fix ) - 1; + + if ( !attaches ) { + doc.removeEventListener( orig, handler, true ); + jQuery._removeData( doc, fix ); + } else { + jQuery._data( doc, fix, attaches ); + } + } + }; + }); +} + +jQuery.fn.extend({ + + on: function( types, selector, data, fn, /*INTERNAL*/ one ) { + var type, origFn; + + // Types can be a map of types/handlers + if ( typeof types === "object" ) { + // ( types-Object, selector, data ) + if ( typeof selector !== "string" ) { + // ( types-Object, data ) + data = data || selector; + selector = undefined; + } + for ( type in types ) { + this.on( type, selector, data, types[ type ], one ); + } + return this; + } + + if ( data == null && fn == null ) { + // ( types, fn ) + fn = selector; + data = selector = undefined; + } else if ( fn == null ) { + if ( typeof selector === "string" ) { + // ( types, selector, fn ) + fn = data; + data = undefined; + } else { + // ( types, data, fn ) + fn = data; + data = selector; + selector = undefined; + } + } + if ( fn === false ) { + fn = returnFalse; + } else if ( !fn ) { + return this; + } + + if ( one === 1 ) { + origFn = fn; + fn = function( event ) { + // Can use an empty set, since event contains the info + jQuery().off( event ); + return origFn.apply( this, arguments ); + }; + // Use same guid so caller can remove using origFn + fn.guid = origFn.guid || ( origFn.guid = jQuery.guid++ ); + } + return this.each( function() { + jQuery.event.add( this, types, fn, data, selector ); + }); + }, + one: function( types, selector, data, fn ) { + return this.on( types, selector, data, fn, 1 ); + }, + off: function( types, selector, fn ) { + var handleObj, type; + if ( types && types.preventDefault && types.handleObj ) { + // ( event ) dispatched jQuery.Event + handleObj = types.handleObj; + jQuery( types.delegateTarget ).off( + handleObj.namespace ? handleObj.origType + "." + handleObj.namespace : handleObj.origType, + handleObj.selector, + handleObj.handler + ); + return this; + } + if ( typeof types === "object" ) { + // ( types-object [, selector] ) + for ( type in types ) { + this.off( type, selector, types[ type ] ); + } + return this; + } + if ( selector === false || typeof selector === "function" ) { + // ( types [, fn] ) + fn = selector; + selector = undefined; + } + if ( fn === false ) { + fn = returnFalse; + } + return this.each(function() { + jQuery.event.remove( this, types, fn, selector ); + }); + }, + + trigger: function( type, data ) { + return this.each(function() { + jQuery.event.trigger( type, data, this ); + }); + }, + triggerHandler: function( type, data ) { + var elem = this[0]; + if ( elem ) { + return jQuery.event.trigger( type, data, elem, true ); + } + } +}); + + +function createSafeFragment( document ) { + var list = nodeNames.split( "|" ), + safeFrag = document.createDocumentFragment(); + + if ( safeFrag.createElement ) { + while ( list.length ) { + safeFrag.createElement( + list.pop() + ); + } + } + return safeFrag; +} + +var nodeNames = "abbr|article|aside|audio|bdi|canvas|data|datalist|details|figcaption|figure|footer|" + + "header|hgroup|mark|meter|nav|output|progress|section|summary|time|video", + rinlinejQuery = / jQuery\d+="(?:null|\d+)"/g, + rnoshimcache = new RegExp("<(?:" + nodeNames + ")[\\s/>]", "i"), + rleadingWhitespace = /^\s+/, + rxhtmlTag = /<(?!area|br|col|embed|hr|img|input|link|meta|param)(([\w:]+)[^>]*)\/>/gi, + rtagName = /<([\w:]+)/, + rtbody = /<tbody/i, + rhtml = /<|&#?\w+;/, + rnoInnerhtml = /<(?:script|style|link)/i, + // checked="checked" or checked + rchecked = /checked\s*(?:[^=]|=\s*.checked.)/i, + rscriptType = /^$|\/(?:java|ecma)script/i, + rscriptTypeMasked = /^true\/(.*)/, + rcleanScript = /^\s*<!(?:\[CDATA\[|--)|(?:\]\]|--)>\s*$/g, + + // We have to close these tags to support XHTML (#13200) + wrapMap = { + option: [ 1, "<select multiple='multiple'>", "</select>" ], + legend: [ 1, "<fieldset>", "</fieldset>" ], + area: [ 1, "<map>", "</map>" ], + param: [ 1, "<object>", "</object>" ], + thead: [ 1, "<table>", "</table>" ], + tr: [ 2, "<table><tbody>", "</tbody></table>" ], + col: [ 2, "<table><tbody></tbody><colgroup>", "</colgroup></table>" ], + td: [ 3, "<table><tbody><tr>", "</tr></tbody></table>" ], + + // IE6-8 can't serialize link, script, style, or any html5 (NoScope) tags, + // unless wrapped in a div with non-breaking characters in front of it. + _default: support.htmlSerialize ? [ 0, "", "" ] : [ 1, "X<div>", "</div>" ] + }, + safeFragment = createSafeFragment( document ), + fragmentDiv = safeFragment.appendChild( document.createElement("div") ); + +wrapMap.optgroup = wrapMap.option; +wrapMap.tbody = wrapMap.tfoot = wrapMap.colgroup = wrapMap.caption = wrapMap.thead; +wrapMap.th = wrapMap.td; + +function getAll( context, tag ) { + var elems, elem, + i = 0, + found = typeof context.getElementsByTagName !== strundefined ? context.getElementsByTagName( tag || "*" ) : + typeof context.querySelectorAll !== strundefined ? context.querySelectorAll( tag || "*" ) : + undefined; + + if ( !found ) { + for ( found = [], elems = context.childNodes || context; (elem = elems[i]) != null; i++ ) { + if ( !tag || jQuery.nodeName( elem, tag ) ) { + found.push( elem ); + } else { + jQuery.merge( found, getAll( elem, tag ) ); + } + } + } + + return tag === undefined || tag && jQuery.nodeName( context, tag ) ? + jQuery.merge( [ context ], found ) : + found; +} + +// Used in buildFragment, fixes the defaultChecked property +function fixDefaultChecked( elem ) { + if ( rcheckableType.test( elem.type ) ) { + elem.defaultChecked = elem.checked; + } +} + +// Support: IE<8 +// Manipulating tables requires a tbody +function manipulationTarget( elem, content ) { + return jQuery.nodeName( elem, "table" ) && + jQuery.nodeName( content.nodeType !== 11 ? content : content.firstChild, "tr" ) ? + + elem.getElementsByTagName("tbody")[0] || + elem.appendChild( elem.ownerDocument.createElement("tbody") ) : + elem; +} + +// Replace/restore the type attribute of script elements for safe DOM manipulation +function disableScript( elem ) { + elem.type = (jQuery.find.attr( elem, "type" ) !== null) + "/" + elem.type; + return elem; +} +function restoreScript( elem ) { + var match = rscriptTypeMasked.exec( elem.type ); + if ( match ) { + elem.type = match[1]; + } else { + elem.removeAttribute("type"); + } + return elem; +} + +// Mark scripts as having already been evaluated +function setGlobalEval( elems, refElements ) { + var elem, + i = 0; + for ( ; (elem = elems[i]) != null; i++ ) { + jQuery._data( elem, "globalEval", !refElements || jQuery._data( refElements[i], "globalEval" ) ); + } +} + +function cloneCopyEvent( src, dest ) { + + if ( dest.nodeType !== 1 || !jQuery.hasData( src ) ) { + return; + } + + var type, i, l, + oldData = jQuery._data( src ), + curData = jQuery._data( dest, oldData ), + events = oldData.events; + + if ( events ) { + delete curData.handle; + curData.events = {}; + + for ( type in events ) { + for ( i = 0, l = events[ type ].length; i < l; i++ ) { + jQuery.event.add( dest, type, events[ type ][ i ] ); + } + } + } + + // make the cloned public data object a copy from the original + if ( curData.data ) { + curData.data = jQuery.extend( {}, curData.data ); + } +} + +function fixCloneNodeIssues( src, dest ) { + var nodeName, e, data; + + // We do not need to do anything for non-Elements + if ( dest.nodeType !== 1 ) { + return; + } + + nodeName = dest.nodeName.toLowerCase(); + + // IE6-8 copies events bound via attachEvent when using cloneNode. + if ( !support.noCloneEvent && dest[ jQuery.expando ] ) { + data = jQuery._data( dest ); + + for ( e in data.events ) { + jQuery.removeEvent( dest, e, data.handle ); + } + + // Event data gets referenced instead of copied if the expando gets copied too + dest.removeAttribute( jQuery.expando ); + } + + // IE blanks contents when cloning scripts, and tries to evaluate newly-set text + if ( nodeName === "script" && dest.text !== src.text ) { + disableScript( dest ).text = src.text; + restoreScript( dest ); + + // IE6-10 improperly clones children of object elements using classid. + // IE10 throws NoModificationAllowedError if parent is null, #12132. + } else if ( nodeName === "object" ) { + if ( dest.parentNode ) { + dest.outerHTML = src.outerHTML; + } + + // This path appears unavoidable for IE9. When cloning an object + // element in IE9, the outerHTML strategy above is not sufficient. + // If the src has innerHTML and the destination does not, + // copy the src.innerHTML into the dest.innerHTML. #10324 + if ( support.html5Clone && ( src.innerHTML && !jQuery.trim(dest.innerHTML) ) ) { + dest.innerHTML = src.innerHTML; + } + + } else if ( nodeName === "input" && rcheckableType.test( src.type ) ) { + // IE6-8 fails to persist the checked state of a cloned checkbox + // or radio button. Worse, IE6-7 fail to give the cloned element + // a checked appearance if the defaultChecked value isn't also set + + dest.defaultChecked = dest.checked = src.checked; + + // IE6-7 get confused and end up setting the value of a cloned + // checkbox/radio button to an empty string instead of "on" + if ( dest.value !== src.value ) { + dest.value = src.value; + } + + // IE6-8 fails to return the selected option to the default selected + // state when cloning options + } else if ( nodeName === "option" ) { + dest.defaultSelected = dest.selected = src.defaultSelected; + + // IE6-8 fails to set the defaultValue to the correct value when + // cloning other types of input fields + } else if ( nodeName === "input" || nodeName === "textarea" ) { + dest.defaultValue = src.defaultValue; + } +} + +jQuery.extend({ + clone: function( elem, dataAndEvents, deepDataAndEvents ) { + var destElements, node, clone, i, srcElements, + inPage = jQuery.contains( elem.ownerDocument, elem ); + + if ( support.html5Clone || jQuery.isXMLDoc(elem) || !rnoshimcache.test( "<" + elem.nodeName + ">" ) ) { + clone = elem.cloneNode( true ); + + // IE<=8 does not properly clone detached, unknown element nodes + } else { + fragmentDiv.innerHTML = elem.outerHTML; + fragmentDiv.removeChild( clone = fragmentDiv.firstChild ); + } + + if ( (!support.noCloneEvent || !support.noCloneChecked) && + (elem.nodeType === 1 || elem.nodeType === 11) && !jQuery.isXMLDoc(elem) ) { + + // We eschew Sizzle here for performance reasons: http://jsperf.com/getall-vs-sizzle/2 + destElements = getAll( clone ); + srcElements = getAll( elem ); + + // Fix all IE cloning issues + for ( i = 0; (node = srcElements[i]) != null; ++i ) { + // Ensure that the destination node is not null; Fixes #9587 + if ( destElements[i] ) { + fixCloneNodeIssues( node, destElements[i] ); + } + } + } + + // Copy the events from the original to the clone + if ( dataAndEvents ) { + if ( deepDataAndEvents ) { + srcElements = srcElements || getAll( elem ); + destElements = destElements || getAll( clone ); + + for ( i = 0; (node = srcElements[i]) != null; i++ ) { + cloneCopyEvent( node, destElements[i] ); + } + } else { + cloneCopyEvent( elem, clone ); + } + } + + // Preserve script evaluation history + destElements = getAll( clone, "script" ); + if ( destElements.length > 0 ) { + setGlobalEval( destElements, !inPage && getAll( elem, "script" ) ); + } + + destElements = srcElements = node = null; + + // Return the cloned set + return clone; + }, + + buildFragment: function( elems, context, scripts, selection ) { + var j, elem, contains, + tmp, tag, tbody, wrap, + l = elems.length, + + // Ensure a safe fragment + safe = createSafeFragment( context ), + + nodes = [], + i = 0; + + for ( ; i < l; i++ ) { + elem = elems[ i ]; + + if ( elem || elem === 0 ) { + + // Add nodes directly + if ( jQuery.type( elem ) === "object" ) { + jQuery.merge( nodes, elem.nodeType ? [ elem ] : elem ); + + // Convert non-html into a text node + } else if ( !rhtml.test( elem ) ) { + nodes.push( context.createTextNode( elem ) ); + + // Convert html into DOM nodes + } else { + tmp = tmp || safe.appendChild( context.createElement("div") ); + + // Deserialize a standard representation + tag = (rtagName.exec( elem ) || [ "", "" ])[ 1 ].toLowerCase(); + wrap = wrapMap[ tag ] || wrapMap._default; + + tmp.innerHTML = wrap[1] + elem.replace( rxhtmlTag, "<$1></$2>" ) + wrap[2]; + + // Descend through wrappers to the right content + j = wrap[0]; + while ( j-- ) { + tmp = tmp.lastChild; + } + + // Manually add leading whitespace removed by IE + if ( !support.leadingWhitespace && rleadingWhitespace.test( elem ) ) { + nodes.push( context.createTextNode( rleadingWhitespace.exec( elem )[0] ) ); + } + + // Remove IE's autoinserted <tbody> from table fragments + if ( !support.tbody ) { + + // String was a <table>, *may* have spurious <tbody> + elem = tag === "table" && !rtbody.test( elem ) ? + tmp.firstChild : + + // String was a bare <thead> or <tfoot> + wrap[1] === "<table>" && !rtbody.test( elem ) ? + tmp : + 0; + + j = elem && elem.childNodes.length; + while ( j-- ) { + if ( jQuery.nodeName( (tbody = elem.childNodes[j]), "tbody" ) && !tbody.childNodes.length ) { + elem.removeChild( tbody ); + } + } + } + + jQuery.merge( nodes, tmp.childNodes ); + + // Fix #12392 for WebKit and IE > 9 + tmp.textContent = ""; + + // Fix #12392 for oldIE + while ( tmp.firstChild ) { + tmp.removeChild( tmp.firstChild ); + } + + // Remember the top-level container for proper cleanup + tmp = safe.lastChild; + } + } + } + + // Fix #11356: Clear elements from fragment + if ( tmp ) { + safe.removeChild( tmp ); + } + + // Reset defaultChecked for any radios and checkboxes + // about to be appended to the DOM in IE 6/7 (#8060) + if ( !support.appendChecked ) { + jQuery.grep( getAll( nodes, "input" ), fixDefaultChecked ); + } + + i = 0; + while ( (elem = nodes[ i++ ]) ) { + + // #4087 - If origin and destination elements are the same, and this is + // that element, do not do anything + if ( selection && jQuery.inArray( elem, selection ) !== -1 ) { + continue; + } + + contains = jQuery.contains( elem.ownerDocument, elem ); + + // Append to fragment + tmp = getAll( safe.appendChild( elem ), "script" ); + + // Preserve script evaluation history + if ( contains ) { + setGlobalEval( tmp ); + } + + // Capture executables + if ( scripts ) { + j = 0; + while ( (elem = tmp[ j++ ]) ) { + if ( rscriptType.test( elem.type || "" ) ) { + scripts.push( elem ); + } + } + } + } + + tmp = null; + + return safe; + }, + + cleanData: function( elems, /* internal */ acceptData ) { + var elem, type, id, data, + i = 0, + internalKey = jQuery.expando, + cache = jQuery.cache, + deleteExpando = support.deleteExpando, + special = jQuery.event.special; + + for ( ; (elem = elems[i]) != null; i++ ) { + if ( acceptData || jQuery.acceptData( elem ) ) { + + id = elem[ internalKey ]; + data = id && cache[ id ]; + + if ( data ) { + if ( data.events ) { + for ( type in data.events ) { + if ( special[ type ] ) { + jQuery.event.remove( elem, type ); + + // This is a shortcut to avoid jQuery.event.remove's overhead + } else { + jQuery.removeEvent( elem, type, data.handle ); + } + } + } + + // Remove cache only if it was not already removed by jQuery.event.remove + if ( cache[ id ] ) { + + delete cache[ id ]; + + // IE does not allow us to delete expando properties from nodes, + // nor does it have a removeAttribute function on Document nodes; + // we must handle all of these cases + if ( deleteExpando ) { + delete elem[ internalKey ]; + + } else if ( typeof elem.removeAttribute !== strundefined ) { + elem.removeAttribute( internalKey ); + + } else { + elem[ internalKey ] = null; + } + + deletedIds.push( id ); + } + } + } + } + } +}); + +jQuery.fn.extend({ + text: function( value ) { + return access( this, function( value ) { + return value === undefined ? + jQuery.text( this ) : + this.empty().append( ( this[0] && this[0].ownerDocument || document ).createTextNode( value ) ); + }, null, value, arguments.length ); + }, + + append: function() { + return this.domManip( arguments, function( elem ) { + if ( this.nodeType === 1 || this.nodeType === 11 || this.nodeType === 9 ) { + var target = manipulationTarget( this, elem ); + target.appendChild( elem ); + } + }); + }, + + prepend: function() { + return this.domManip( arguments, function( elem ) { + if ( this.nodeType === 1 || this.nodeType === 11 || this.nodeType === 9 ) { + var target = manipulationTarget( this, elem ); + target.insertBefore( elem, target.firstChild ); + } + }); + }, + + before: function() { + return this.domManip( arguments, function( elem ) { + if ( this.parentNode ) { + this.parentNode.insertBefore( elem, this ); + } + }); + }, + + after: function() { + return this.domManip( arguments, function( elem ) { + if ( this.parentNode ) { + this.parentNode.insertBefore( elem, this.nextSibling ); + } + }); + }, + + remove: function( selector, keepData /* Internal Use Only */ ) { + var elem, + elems = selector ? jQuery.filter( selector, this ) : this, + i = 0; + + for ( ; (elem = elems[i]) != null; i++ ) { + + if ( !keepData && elem.nodeType === 1 ) { + jQuery.cleanData( getAll( elem ) ); + } + + if ( elem.parentNode ) { + if ( keepData && jQuery.contains( elem.ownerDocument, elem ) ) { + setGlobalEval( getAll( elem, "script" ) ); + } + elem.parentNode.removeChild( elem ); + } + } + + return this; + }, + + empty: function() { + var elem, + i = 0; + + for ( ; (elem = this[i]) != null; i++ ) { + // Remove element nodes and prevent memory leaks + if ( elem.nodeType === 1 ) { + jQuery.cleanData( getAll( elem, false ) ); + } + + // Remove any remaining nodes + while ( elem.firstChild ) { + elem.removeChild( elem.firstChild ); + } + + // If this is a select, ensure that it displays empty (#12336) + // Support: IE<9 + if ( elem.options && jQuery.nodeName( elem, "select" ) ) { + elem.options.length = 0; + } + } + + return this; + }, + + clone: function( dataAndEvents, deepDataAndEvents ) { + dataAndEvents = dataAndEvents == null ? false : dataAndEvents; + deepDataAndEvents = deepDataAndEvents == null ? dataAndEvents : deepDataAndEvents; + + return this.map(function() { + return jQuery.clone( this, dataAndEvents, deepDataAndEvents ); + }); + }, + + html: function( value ) { + return access( this, function( value ) { + var elem = this[ 0 ] || {}, + i = 0, + l = this.length; + + if ( value === undefined ) { + return elem.nodeType === 1 ? + elem.innerHTML.replace( rinlinejQuery, "" ) : + undefined; + } + + // See if we can take a shortcut and just use innerHTML + if ( typeof value === "string" && !rnoInnerhtml.test( value ) && + ( support.htmlSerialize || !rnoshimcache.test( value ) ) && + ( support.leadingWhitespace || !rleadingWhitespace.test( value ) ) && + !wrapMap[ (rtagName.exec( value ) || [ "", "" ])[ 1 ].toLowerCase() ] ) { + + value = value.replace( rxhtmlTag, "<$1></$2>" ); + + try { + for (; i < l; i++ ) { + // Remove element nodes and prevent memory leaks + elem = this[i] || {}; + if ( elem.nodeType === 1 ) { + jQuery.cleanData( getAll( elem, false ) ); + elem.innerHTML = value; + } + } + + elem = 0; + + // If using innerHTML throws an exception, use the fallback method + } catch(e) {} + } + + if ( elem ) { + this.empty().append( value ); + } + }, null, value, arguments.length ); + }, + + replaceWith: function() { + var arg = arguments[ 0 ]; + + // Make the changes, replacing each context element with the new content + this.domManip( arguments, function( elem ) { + arg = this.parentNode; + + jQuery.cleanData( getAll( this ) ); + + if ( arg ) { + arg.replaceChild( elem, this ); + } + }); + + // Force removal if there was no new content (e.g., from empty arguments) + return arg && (arg.length || arg.nodeType) ? this : this.remove(); + }, + + detach: function( selector ) { + return this.remove( selector, true ); + }, + + domManip: function( args, callback ) { + + // Flatten any nested arrays + args = concat.apply( [], args ); + + var first, node, hasScripts, + scripts, doc, fragment, + i = 0, + l = this.length, + set = this, + iNoClone = l - 1, + value = args[0], + isFunction = jQuery.isFunction( value ); + + // We can't cloneNode fragments that contain checked, in WebKit + if ( isFunction || + ( l > 1 && typeof value === "string" && + !support.checkClone && rchecked.test( value ) ) ) { + return this.each(function( index ) { + var self = set.eq( index ); + if ( isFunction ) { + args[0] = value.call( this, index, self.html() ); + } + self.domManip( args, callback ); + }); + } + + if ( l ) { + fragment = jQuery.buildFragment( args, this[ 0 ].ownerDocument, false, this ); + first = fragment.firstChild; + + if ( fragment.childNodes.length === 1 ) { + fragment = first; + } + + if ( first ) { + scripts = jQuery.map( getAll( fragment, "script" ), disableScript ); + hasScripts = scripts.length; + + // Use the original fragment for the last item instead of the first because it can end up + // being emptied incorrectly in certain situations (#8070). + for ( ; i < l; i++ ) { + node = fragment; + + if ( i !== iNoClone ) { + node = jQuery.clone( node, true, true ); + + // Keep references to cloned scripts for later restoration + if ( hasScripts ) { + jQuery.merge( scripts, getAll( node, "script" ) ); + } + } + + callback.call( this[i], node, i ); + } + + if ( hasScripts ) { + doc = scripts[ scripts.length - 1 ].ownerDocument; + + // Reenable scripts + jQuery.map( scripts, restoreScript ); + + // Evaluate executable scripts on first document insertion + for ( i = 0; i < hasScripts; i++ ) { + node = scripts[ i ]; + if ( rscriptType.test( node.type || "" ) && + !jQuery._data( node, "globalEval" ) && jQuery.contains( doc, node ) ) { + + if ( node.src ) { + // Optional AJAX dependency, but won't run scripts if not present + if ( jQuery._evalUrl ) { + jQuery._evalUrl( node.src ); + } + } else { + jQuery.globalEval( ( node.text || node.textContent || node.innerHTML || "" ).replace( rcleanScript, "" ) ); + } + } + } + } + + // Fix #11809: Avoid leaking memory + fragment = first = null; + } + } + + return this; + } +}); + +jQuery.each({ + appendTo: "append", + prependTo: "prepend", + insertBefore: "before", + insertAfter: "after", + replaceAll: "replaceWith" +}, function( name, original ) { + jQuery.fn[ name ] = function( selector ) { + var elems, + i = 0, + ret = [], + insert = jQuery( selector ), + last = insert.length - 1; + + for ( ; i <= last; i++ ) { + elems = i === last ? this : this.clone(true); + jQuery( insert[i] )[ original ]( elems ); + + // Modern browsers can apply jQuery collections as arrays, but oldIE needs a .get() + push.apply( ret, elems.get() ); + } + + return this.pushStack( ret ); + }; +}); + + +var iframe, + elemdisplay = {}; + +/** + * Retrieve the actual display of a element + * @param {String} name nodeName of the element + * @param {Object} doc Document object + */ +// Called only from within defaultDisplay +function actualDisplay( name, doc ) { + var style, + elem = jQuery( doc.createElement( name ) ).appendTo( doc.body ), + + // getDefaultComputedStyle might be reliably used only on attached element + display = window.getDefaultComputedStyle && ( style = window.getDefaultComputedStyle( elem[ 0 ] ) ) ? + + // Use of this method is a temporary fix (more like optmization) until something better comes along, + // since it was removed from specification and supported only in FF + style.display : jQuery.css( elem[ 0 ], "display" ); + + // We don't have any data stored on the element, + // so use "detach" method as fast way to get rid of the element + elem.detach(); + + return display; +} + +/** + * Try to determine the default display value of an element + * @param {String} nodeName + */ +function defaultDisplay( nodeName ) { + var doc = document, + display = elemdisplay[ nodeName ]; + + if ( !display ) { + display = actualDisplay( nodeName, doc ); + + // If the simple way fails, read from inside an iframe + if ( display === "none" || !display ) { + + // Use the already-created iframe if possible + iframe = (iframe || jQuery( "<iframe frameborder='0' width='0' height='0'/>" )).appendTo( doc.documentElement ); + + // Always write a new HTML skeleton so Webkit and Firefox don't choke on reuse + doc = ( iframe[ 0 ].contentWindow || iframe[ 0 ].contentDocument ).document; + + // Support: IE + doc.write(); + doc.close(); + + display = actualDisplay( nodeName, doc ); + iframe.detach(); + } + + // Store the correct default display + elemdisplay[ nodeName ] = display; + } + + return display; +} + + +(function() { + var shrinkWrapBlocksVal; + + support.shrinkWrapBlocks = function() { + if ( shrinkWrapBlocksVal != null ) { + return shrinkWrapBlocksVal; + } + + // Will be changed later if needed. + shrinkWrapBlocksVal = false; + + // Minified: var b,c,d + var div, body, container; + + body = document.getElementsByTagName( "body" )[ 0 ]; + if ( !body || !body.style ) { + // Test fired too early or in an unsupported environment, exit. + return; + } + + // Setup + div = document.createElement( "div" ); + container = document.createElement( "div" ); + container.style.cssText = "position:absolute;border:0;width:0;height:0;top:0;left:-9999px"; + body.appendChild( container ).appendChild( div ); + + // Support: IE6 + // Check if elements with layout shrink-wrap their children + if ( typeof div.style.zoom !== strundefined ) { + // Reset CSS: box-sizing; display; margin; border + div.style.cssText = + // Support: Firefox<29, Android 2.3 + // Vendor-prefix box-sizing + "-webkit-box-sizing:content-box;-moz-box-sizing:content-box;" + + "box-sizing:content-box;display:block;margin:0;border:0;" + + "padding:1px;width:1px;zoom:1"; + div.appendChild( document.createElement( "div" ) ).style.width = "5px"; + shrinkWrapBlocksVal = div.offsetWidth !== 3; + } + + body.removeChild( container ); + + return shrinkWrapBlocksVal; + }; + +})(); +var rmargin = (/^margin/); + +var rnumnonpx = new RegExp( "^(" + pnum + ")(?!px)[a-z%]+$", "i" ); + + + +var getStyles, curCSS, + rposition = /^(top|right|bottom|left)$/; + +if ( window.getComputedStyle ) { + getStyles = function( elem ) { + return elem.ownerDocument.defaultView.getComputedStyle( elem, null ); + }; + + curCSS = function( elem, name, computed ) { + var width, minWidth, maxWidth, ret, + style = elem.style; + + computed = computed || getStyles( elem ); + + // getPropertyValue is only needed for .css('filter') in IE9, see #12537 + ret = computed ? computed.getPropertyValue( name ) || computed[ name ] : undefined; + + if ( computed ) { + + if ( ret === "" && !jQuery.contains( elem.ownerDocument, elem ) ) { + ret = jQuery.style( elem, name ); + } + + // A tribute to the "awesome hack by Dean Edwards" + // Chrome < 17 and Safari 5.0 uses "computed value" instead of "used value" for margin-right + // Safari 5.1.7 (at least) returns percentage for a larger set of values, but width seems to be reliably pixels + // this is against the CSSOM draft spec: http://dev.w3.org/csswg/cssom/#resolved-values + if ( rnumnonpx.test( ret ) && rmargin.test( name ) ) { + + // Remember the original values + width = style.width; + minWidth = style.minWidth; + maxWidth = style.maxWidth; + + // Put in the new values to get a computed value out + style.minWidth = style.maxWidth = style.width = ret; + ret = computed.width; + + // Revert the changed values + style.width = width; + style.minWidth = minWidth; + style.maxWidth = maxWidth; + } + } + + // Support: IE + // IE returns zIndex value as an integer. + return ret === undefined ? + ret : + ret + ""; + }; +} else if ( document.documentElement.currentStyle ) { + getStyles = function( elem ) { + return elem.currentStyle; + }; + + curCSS = function( elem, name, computed ) { + var left, rs, rsLeft, ret, + style = elem.style; + + computed = computed || getStyles( elem ); + ret = computed ? computed[ name ] : undefined; + + // Avoid setting ret to empty string here + // so we don't default to auto + if ( ret == null && style && style[ name ] ) { + ret = style[ name ]; + } + + // From the awesome hack by Dean Edwards + // http://erik.eae.net/archives/2007/07/27/18.54.15/#comment-102291 + + // If we're not dealing with a regular pixel number + // but a number that has a weird ending, we need to convert it to pixels + // but not position css attributes, as those are proportional to the parent element instead + // and we can't measure the parent instead because it might trigger a "stacking dolls" problem + if ( rnumnonpx.test( ret ) && !rposition.test( name ) ) { + + // Remember the original values + left = style.left; + rs = elem.runtimeStyle; + rsLeft = rs && rs.left; + + // Put in the new values to get a computed value out + if ( rsLeft ) { + rs.left = elem.currentStyle.left; + } + style.left = name === "fontSize" ? "1em" : ret; + ret = style.pixelLeft + "px"; + + // Revert the changed values + style.left = left; + if ( rsLeft ) { + rs.left = rsLeft; + } + } + + // Support: IE + // IE returns zIndex value as an integer. + return ret === undefined ? + ret : + ret + "" || "auto"; + }; +} + + + + +function addGetHookIf( conditionFn, hookFn ) { + // Define the hook, we'll check on the first run if it's really needed. + return { + get: function() { + var condition = conditionFn(); + + if ( condition == null ) { + // The test was not ready at this point; screw the hook this time + // but check again when needed next time. + return; + } + + if ( condition ) { + // Hook not needed (or it's not possible to use it due to missing dependency), + // remove it. + // Since there are no other hooks for marginRight, remove the whole object. + delete this.get; + return; + } + + // Hook needed; redefine it so that the support test is not executed again. + + return (this.get = hookFn).apply( this, arguments ); + } + }; +} + + +(function() { + // Minified: var b,c,d,e,f,g, h,i + var div, style, a, pixelPositionVal, boxSizingReliableVal, + reliableHiddenOffsetsVal, reliableMarginRightVal; + + // Setup + div = document.createElement( "div" ); + div.innerHTML = " <link/><table></table><a href='/a'>a</a><input type='checkbox'/>"; + a = div.getElementsByTagName( "a" )[ 0 ]; + style = a && a.style; + + // Finish early in limited (non-browser) environments + if ( !style ) { + return; + } + + style.cssText = "float:left;opacity:.5"; + + // Support: IE<9 + // Make sure that element opacity exists (as opposed to filter) + support.opacity = style.opacity === "0.5"; + + // Verify style float existence + // (IE uses styleFloat instead of cssFloat) + support.cssFloat = !!style.cssFloat; + + div.style.backgroundClip = "content-box"; + div.cloneNode( true ).style.backgroundClip = ""; + support.clearCloneStyle = div.style.backgroundClip === "content-box"; + + // Support: Firefox<29, Android 2.3 + // Vendor-prefix box-sizing + support.boxSizing = style.boxSizing === "" || style.MozBoxSizing === "" || + style.WebkitBoxSizing === ""; + + jQuery.extend(support, { + reliableHiddenOffsets: function() { + if ( reliableHiddenOffsetsVal == null ) { + computeStyleTests(); + } + return reliableHiddenOffsetsVal; + }, + + boxSizingReliable: function() { + if ( boxSizingReliableVal == null ) { + computeStyleTests(); + } + return boxSizingReliableVal; + }, + + pixelPosition: function() { + if ( pixelPositionVal == null ) { + computeStyleTests(); + } + return pixelPositionVal; + }, + + // Support: Android 2.3 + reliableMarginRight: function() { + if ( reliableMarginRightVal == null ) { + computeStyleTests(); + } + return reliableMarginRightVal; + } + }); + + function computeStyleTests() { + // Minified: var b,c,d,j + var div, body, container, contents; + + body = document.getElementsByTagName( "body" )[ 0 ]; + if ( !body || !body.style ) { + // Test fired too early or in an unsupported environment, exit. + return; + } + + // Setup + div = document.createElement( "div" ); + container = document.createElement( "div" ); + container.style.cssText = "position:absolute;border:0;width:0;height:0;top:0;left:-9999px"; + body.appendChild( container ).appendChild( div ); + + div.style.cssText = + // Support: Firefox<29, Android 2.3 + // Vendor-prefix box-sizing + "-webkit-box-sizing:border-box;-moz-box-sizing:border-box;" + + "box-sizing:border-box;display:block;margin-top:1%;top:1%;" + + "border:1px;padding:1px;width:4px;position:absolute"; + + // Support: IE<9 + // Assume reasonable values in the absence of getComputedStyle + pixelPositionVal = boxSizingReliableVal = false; + reliableMarginRightVal = true; + + // Check for getComputedStyle so that this code is not run in IE<9. + if ( window.getComputedStyle ) { + pixelPositionVal = ( window.getComputedStyle( div, null ) || {} ).top !== "1%"; + boxSizingReliableVal = + ( window.getComputedStyle( div, null ) || { width: "4px" } ).width === "4px"; + + // Support: Android 2.3 + // Div with explicit width and no margin-right incorrectly + // gets computed margin-right based on width of container (#3333) + // WebKit Bug 13343 - getComputedStyle returns wrong value for margin-right + contents = div.appendChild( document.createElement( "div" ) ); + + // Reset CSS: box-sizing; display; margin; border; padding + contents.style.cssText = div.style.cssText = + // Support: Firefox<29, Android 2.3 + // Vendor-prefix box-sizing + "-webkit-box-sizing:content-box;-moz-box-sizing:content-box;" + + "box-sizing:content-box;display:block;margin:0;border:0;padding:0"; + contents.style.marginRight = contents.style.width = "0"; + div.style.width = "1px"; + + reliableMarginRightVal = + !parseFloat( ( window.getComputedStyle( contents, null ) || {} ).marginRight ); + } + + // Support: IE8 + // Check if table cells still have offsetWidth/Height when they are set + // to display:none and there are still other visible table cells in a + // table row; if so, offsetWidth/Height are not reliable for use when + // determining if an element has been hidden directly using + // display:none (it is still safe to use offsets if a parent element is + // hidden; don safety goggles and see bug #4512 for more information). + div.innerHTML = "<table><tr><td></td><td>t</td></tr></table>"; + contents = div.getElementsByTagName( "td" ); + contents[ 0 ].style.cssText = "margin:0;border:0;padding:0;display:none"; + reliableHiddenOffsetsVal = contents[ 0 ].offsetHeight === 0; + if ( reliableHiddenOffsetsVal ) { + contents[ 0 ].style.display = ""; + contents[ 1 ].style.display = "none"; + reliableHiddenOffsetsVal = contents[ 0 ].offsetHeight === 0; + } + + body.removeChild( container ); + } + +})(); + + +// A method for quickly swapping in/out CSS properties to get correct calculations. +jQuery.swap = function( elem, options, callback, args ) { + var ret, name, + old = {}; + + // Remember the old values, and insert the new ones + for ( name in options ) { + old[ name ] = elem.style[ name ]; + elem.style[ name ] = options[ name ]; + } + + ret = callback.apply( elem, args || [] ); + + // Revert the old values + for ( name in options ) { + elem.style[ name ] = old[ name ]; + } + + return ret; +}; + + +var + ralpha = /alpha\([^)]*\)/i, + ropacity = /opacity\s*=\s*([^)]*)/, + + // swappable if display is none or starts with table except "table", "table-cell", or "table-caption" + // see here for display values: https://developer.mozilla.org/en-US/docs/CSS/display + rdisplayswap = /^(none|table(?!-c[ea]).+)/, + rnumsplit = new RegExp( "^(" + pnum + ")(.*)$", "i" ), + rrelNum = new RegExp( "^([+-])=(" + pnum + ")", "i" ), + + cssShow = { position: "absolute", visibility: "hidden", display: "block" }, + cssNormalTransform = { + letterSpacing: "0", + fontWeight: "400" + }, + + cssPrefixes = [ "Webkit", "O", "Moz", "ms" ]; + + +// return a css property mapped to a potentially vendor prefixed property +function vendorPropName( style, name ) { + + // shortcut for names that are not vendor prefixed + if ( name in style ) { + return name; + } + + // check for vendor prefixed names + var capName = name.charAt(0).toUpperCase() + name.slice(1), + origName = name, + i = cssPrefixes.length; + + while ( i-- ) { + name = cssPrefixes[ i ] + capName; + if ( name in style ) { + return name; + } + } + + return origName; +} + +function showHide( elements, show ) { + var display, elem, hidden, + values = [], + index = 0, + length = elements.length; + + for ( ; index < length; index++ ) { + elem = elements[ index ]; + if ( !elem.style ) { + continue; + } + + values[ index ] = jQuery._data( elem, "olddisplay" ); + display = elem.style.display; + if ( show ) { + // Reset the inline display of this element to learn if it is + // being hidden by cascaded rules or not + if ( !values[ index ] && display === "none" ) { + elem.style.display = ""; + } + + // Set elements which have been overridden with display: none + // in a stylesheet to whatever the default browser style is + // for such an element + if ( elem.style.display === "" && isHidden( elem ) ) { + values[ index ] = jQuery._data( elem, "olddisplay", defaultDisplay(elem.nodeName) ); + } + } else { + hidden = isHidden( elem ); + + if ( display && display !== "none" || !hidden ) { + jQuery._data( elem, "olddisplay", hidden ? display : jQuery.css( elem, "display" ) ); + } + } + } + + // Set the display of most of the elements in a second loop + // to avoid the constant reflow + for ( index = 0; index < length; index++ ) { + elem = elements[ index ]; + if ( !elem.style ) { + continue; + } + if ( !show || elem.style.display === "none" || elem.style.display === "" ) { + elem.style.display = show ? values[ index ] || "" : "none"; + } + } + + return elements; +} + +function setPositiveNumber( elem, value, subtract ) { + var matches = rnumsplit.exec( value ); + return matches ? + // Guard against undefined "subtract", e.g., when used as in cssHooks + Math.max( 0, matches[ 1 ] - ( subtract || 0 ) ) + ( matches[ 2 ] || "px" ) : + value; +} + +function augmentWidthOrHeight( elem, name, extra, isBorderBox, styles ) { + var i = extra === ( isBorderBox ? "border" : "content" ) ? + // If we already have the right measurement, avoid augmentation + 4 : + // Otherwise initialize for horizontal or vertical properties + name === "width" ? 1 : 0, + + val = 0; + + for ( ; i < 4; i += 2 ) { + // both box models exclude margin, so add it if we want it + if ( extra === "margin" ) { + val += jQuery.css( elem, extra + cssExpand[ i ], true, styles ); + } + + if ( isBorderBox ) { + // border-box includes padding, so remove it if we want content + if ( extra === "content" ) { + val -= jQuery.css( elem, "padding" + cssExpand[ i ], true, styles ); + } + + // at this point, extra isn't border nor margin, so remove border + if ( extra !== "margin" ) { + val -= jQuery.css( elem, "border" + cssExpand[ i ] + "Width", true, styles ); + } + } else { + // at this point, extra isn't content, so add padding + val += jQuery.css( elem, "padding" + cssExpand[ i ], true, styles ); + + // at this point, extra isn't content nor padding, so add border + if ( extra !== "padding" ) { + val += jQuery.css( elem, "border" + cssExpand[ i ] + "Width", true, styles ); + } + } + } + + return val; +} + +function getWidthOrHeight( elem, name, extra ) { + + // Start with offset property, which is equivalent to the border-box value + var valueIsBorderBox = true, + val = name === "width" ? elem.offsetWidth : elem.offsetHeight, + styles = getStyles( elem ), + isBorderBox = support.boxSizing && jQuery.css( elem, "boxSizing", false, styles ) === "border-box"; + + // some non-html elements return undefined for offsetWidth, so check for null/undefined + // svg - https://bugzilla.mozilla.org/show_bug.cgi?id=649285 + // MathML - https://bugzilla.mozilla.org/show_bug.cgi?id=491668 + if ( val <= 0 || val == null ) { + // Fall back to computed then uncomputed css if necessary + val = curCSS( elem, name, styles ); + if ( val < 0 || val == null ) { + val = elem.style[ name ]; + } + + // Computed unit is not pixels. Stop here and return. + if ( rnumnonpx.test(val) ) { + return val; + } + + // we need the check for style in case a browser which returns unreliable values + // for getComputedStyle silently falls back to the reliable elem.style + valueIsBorderBox = isBorderBox && ( support.boxSizingReliable() || val === elem.style[ name ] ); + + // Normalize "", auto, and prepare for extra + val = parseFloat( val ) || 0; + } + + // use the active box-sizing model to add/subtract irrelevant styles + return ( val + + augmentWidthOrHeight( + elem, + name, + extra || ( isBorderBox ? "border" : "content" ), + valueIsBorderBox, + styles + ) + ) + "px"; +} + +jQuery.extend({ + // Add in style property hooks for overriding the default + // behavior of getting and setting a style property + cssHooks: { + opacity: { + get: function( elem, computed ) { + if ( computed ) { + // We should always get a number back from opacity + var ret = curCSS( elem, "opacity" ); + return ret === "" ? "1" : ret; + } + } + } + }, + + // Don't automatically add "px" to these possibly-unitless properties + cssNumber: { + "columnCount": true, + "fillOpacity": true, + "flexGrow": true, + "flexShrink": true, + "fontWeight": true, + "lineHeight": true, + "opacity": true, + "order": true, + "orphans": true, + "widows": true, + "zIndex": true, + "zoom": true + }, + + // Add in properties whose names you wish to fix before + // setting or getting the value + cssProps: { + // normalize float css property + "float": support.cssFloat ? "cssFloat" : "styleFloat" + }, + + // Get and set the style property on a DOM Node + style: function( elem, name, value, extra ) { + // Don't set styles on text and comment nodes + if ( !elem || elem.nodeType === 3 || elem.nodeType === 8 || !elem.style ) { + return; + } + + // Make sure that we're working with the right name + var ret, type, hooks, + origName = jQuery.camelCase( name ), + style = elem.style; + + name = jQuery.cssProps[ origName ] || ( jQuery.cssProps[ origName ] = vendorPropName( style, origName ) ); + + // gets hook for the prefixed version + // followed by the unprefixed version + hooks = jQuery.cssHooks[ name ] || jQuery.cssHooks[ origName ]; + + // Check if we're setting a value + if ( value !== undefined ) { + type = typeof value; + + // convert relative number strings (+= or -=) to relative numbers. #7345 + if ( type === "string" && (ret = rrelNum.exec( value )) ) { + value = ( ret[1] + 1 ) * ret[2] + parseFloat( jQuery.css( elem, name ) ); + // Fixes bug #9237 + type = "number"; + } + + // Make sure that null and NaN values aren't set. See: #7116 + if ( value == null || value !== value ) { + return; + } + + // If a number was passed in, add 'px' to the (except for certain CSS properties) + if ( type === "number" && !jQuery.cssNumber[ origName ] ) { + value += "px"; + } + + // Fixes #8908, it can be done more correctly by specifing setters in cssHooks, + // but it would mean to define eight (for every problematic property) identical functions + if ( !support.clearCloneStyle && value === "" && name.indexOf("background") === 0 ) { + style[ name ] = "inherit"; + } + + // If a hook was provided, use that value, otherwise just set the specified value + if ( !hooks || !("set" in hooks) || (value = hooks.set( elem, value, extra )) !== undefined ) { + + // Support: IE + // Swallow errors from 'invalid' CSS values (#5509) + try { + style[ name ] = value; + } catch(e) {} + } + + } else { + // If a hook was provided get the non-computed value from there + if ( hooks && "get" in hooks && (ret = hooks.get( elem, false, extra )) !== undefined ) { + return ret; + } + + // Otherwise just get the value from the style object + return style[ name ]; + } + }, + + css: function( elem, name, extra, styles ) { + var num, val, hooks, + origName = jQuery.camelCase( name ); + + // Make sure that we're working with the right name + name = jQuery.cssProps[ origName ] || ( jQuery.cssProps[ origName ] = vendorPropName( elem.style, origName ) ); + + // gets hook for the prefixed version + // followed by the unprefixed version + hooks = jQuery.cssHooks[ name ] || jQuery.cssHooks[ origName ]; + + // If a hook was provided get the computed value from there + if ( hooks && "get" in hooks ) { + val = hooks.get( elem, true, extra ); + } + + // Otherwise, if a way to get the computed value exists, use that + if ( val === undefined ) { + val = curCSS( elem, name, styles ); + } + + //convert "normal" to computed value + if ( val === "normal" && name in cssNormalTransform ) { + val = cssNormalTransform[ name ]; + } + + // Return, converting to number if forced or a qualifier was provided and val looks numeric + if ( extra === "" || extra ) { + num = parseFloat( val ); + return extra === true || jQuery.isNumeric( num ) ? num || 0 : val; + } + return val; + } +}); + +jQuery.each([ "height", "width" ], function( i, name ) { + jQuery.cssHooks[ name ] = { + get: function( elem, computed, extra ) { + if ( computed ) { + // certain elements can have dimension info if we invisibly show them + // however, it must have a current display style that would benefit from this + return rdisplayswap.test( jQuery.css( elem, "display" ) ) && elem.offsetWidth === 0 ? + jQuery.swap( elem, cssShow, function() { + return getWidthOrHeight( elem, name, extra ); + }) : + getWidthOrHeight( elem, name, extra ); + } + }, + + set: function( elem, value, extra ) { + var styles = extra && getStyles( elem ); + return setPositiveNumber( elem, value, extra ? + augmentWidthOrHeight( + elem, + name, + extra, + support.boxSizing && jQuery.css( elem, "boxSizing", false, styles ) === "border-box", + styles + ) : 0 + ); + } + }; +}); + +if ( !support.opacity ) { + jQuery.cssHooks.opacity = { + get: function( elem, computed ) { + // IE uses filters for opacity + return ropacity.test( (computed && elem.currentStyle ? elem.currentStyle.filter : elem.style.filter) || "" ) ? + ( 0.01 * parseFloat( RegExp.$1 ) ) + "" : + computed ? "1" : ""; + }, + + set: function( elem, value ) { + var style = elem.style, + currentStyle = elem.currentStyle, + opacity = jQuery.isNumeric( value ) ? "alpha(opacity=" + value * 100 + ")" : "", + filter = currentStyle && currentStyle.filter || style.filter || ""; + + // IE has trouble with opacity if it does not have layout + // Force it by setting the zoom level + style.zoom = 1; + + // if setting opacity to 1, and no other filters exist - attempt to remove filter attribute #6652 + // if value === "", then remove inline opacity #12685 + if ( ( value >= 1 || value === "" ) && + jQuery.trim( filter.replace( ralpha, "" ) ) === "" && + style.removeAttribute ) { + + // Setting style.filter to null, "" & " " still leave "filter:" in the cssText + // if "filter:" is present at all, clearType is disabled, we want to avoid this + // style.removeAttribute is IE Only, but so apparently is this code path... + style.removeAttribute( "filter" ); + + // if there is no filter style applied in a css rule or unset inline opacity, we are done + if ( value === "" || currentStyle && !currentStyle.filter ) { + return; + } + } + + // otherwise, set new filter values + style.filter = ralpha.test( filter ) ? + filter.replace( ralpha, opacity ) : + filter + " " + opacity; + } + }; +} + +jQuery.cssHooks.marginRight = addGetHookIf( support.reliableMarginRight, + function( elem, computed ) { + if ( computed ) { + // WebKit Bug 13343 - getComputedStyle returns wrong value for margin-right + // Work around by temporarily setting element display to inline-block + return jQuery.swap( elem, { "display": "inline-block" }, + curCSS, [ elem, "marginRight" ] ); + } + } +); + +// These hooks are used by animate to expand properties +jQuery.each({ + margin: "", + padding: "", + border: "Width" +}, function( prefix, suffix ) { + jQuery.cssHooks[ prefix + suffix ] = { + expand: function( value ) { + var i = 0, + expanded = {}, + + // assumes a single number if not a string + parts = typeof value === "string" ? value.split(" ") : [ value ]; + + for ( ; i < 4; i++ ) { + expanded[ prefix + cssExpand[ i ] + suffix ] = + parts[ i ] || parts[ i - 2 ] || parts[ 0 ]; + } + + return expanded; + } + }; + + if ( !rmargin.test( prefix ) ) { + jQuery.cssHooks[ prefix + suffix ].set = setPositiveNumber; + } +}); + +jQuery.fn.extend({ + css: function( name, value ) { + return access( this, function( elem, name, value ) { + var styles, len, + map = {}, + i = 0; + + if ( jQuery.isArray( name ) ) { + styles = getStyles( elem ); + len = name.length; + + for ( ; i < len; i++ ) { + map[ name[ i ] ] = jQuery.css( elem, name[ i ], false, styles ); + } + + return map; + } + + return value !== undefined ? + jQuery.style( elem, name, value ) : + jQuery.css( elem, name ); + }, name, value, arguments.length > 1 ); + }, + show: function() { + return showHide( this, true ); + }, + hide: function() { + return showHide( this ); + }, + toggle: function( state ) { + if ( typeof state === "boolean" ) { + return state ? this.show() : this.hide(); + } + + return this.each(function() { + if ( isHidden( this ) ) { + jQuery( this ).show(); + } else { + jQuery( this ).hide(); + } + }); + } +}); + + +function Tween( elem, options, prop, end, easing ) { + return new Tween.prototype.init( elem, options, prop, end, easing ); +} +jQuery.Tween = Tween; + +Tween.prototype = { + constructor: Tween, + init: function( elem, options, prop, end, easing, unit ) { + this.elem = elem; + this.prop = prop; + this.easing = easing || "swing"; + this.options = options; + this.start = this.now = this.cur(); + this.end = end; + this.unit = unit || ( jQuery.cssNumber[ prop ] ? "" : "px" ); + }, + cur: function() { + var hooks = Tween.propHooks[ this.prop ]; + + return hooks && hooks.get ? + hooks.get( this ) : + Tween.propHooks._default.get( this ); + }, + run: function( percent ) { + var eased, + hooks = Tween.propHooks[ this.prop ]; + + if ( this.options.duration ) { + this.pos = eased = jQuery.easing[ this.easing ]( + percent, this.options.duration * percent, 0, 1, this.options.duration + ); + } else { + this.pos = eased = percent; + } + this.now = ( this.end - this.start ) * eased + this.start; + + if ( this.options.step ) { + this.options.step.call( this.elem, this.now, this ); + } + + if ( hooks && hooks.set ) { + hooks.set( this ); + } else { + Tween.propHooks._default.set( this ); + } + return this; + } +}; + +Tween.prototype.init.prototype = Tween.prototype; + +Tween.propHooks = { + _default: { + get: function( tween ) { + var result; + + if ( tween.elem[ tween.prop ] != null && + (!tween.elem.style || tween.elem.style[ tween.prop ] == null) ) { + return tween.elem[ tween.prop ]; + } + + // passing an empty string as a 3rd parameter to .css will automatically + // attempt a parseFloat and fallback to a string if the parse fails + // so, simple values such as "10px" are parsed to Float. + // complex values such as "rotate(1rad)" are returned as is. + result = jQuery.css( tween.elem, tween.prop, "" ); + // Empty strings, null, undefined and "auto" are converted to 0. + return !result || result === "auto" ? 0 : result; + }, + set: function( tween ) { + // use step hook for back compat - use cssHook if its there - use .style if its + // available and use plain properties where available + if ( jQuery.fx.step[ tween.prop ] ) { + jQuery.fx.step[ tween.prop ]( tween ); + } else if ( tween.elem.style && ( tween.elem.style[ jQuery.cssProps[ tween.prop ] ] != null || jQuery.cssHooks[ tween.prop ] ) ) { + jQuery.style( tween.elem, tween.prop, tween.now + tween.unit ); + } else { + tween.elem[ tween.prop ] = tween.now; + } + } + } +}; + +// Support: IE <=9 +// Panic based approach to setting things on disconnected nodes + +Tween.propHooks.scrollTop = Tween.propHooks.scrollLeft = { + set: function( tween ) { + if ( tween.elem.nodeType && tween.elem.parentNode ) { + tween.elem[ tween.prop ] = tween.now; + } + } +}; + +jQuery.easing = { + linear: function( p ) { + return p; + }, + swing: function( p ) { + return 0.5 - Math.cos( p * Math.PI ) / 2; + } +}; + +jQuery.fx = Tween.prototype.init; + +// Back Compat <1.8 extension point +jQuery.fx.step = {}; + + + + +var + fxNow, timerId, + rfxtypes = /^(?:toggle|show|hide)$/, + rfxnum = new RegExp( "^(?:([+-])=|)(" + pnum + ")([a-z%]*)$", "i" ), + rrun = /queueHooks$/, + animationPrefilters = [ defaultPrefilter ], + tweeners = { + "*": [ function( prop, value ) { + var tween = this.createTween( prop, value ), + target = tween.cur(), + parts = rfxnum.exec( value ), + unit = parts && parts[ 3 ] || ( jQuery.cssNumber[ prop ] ? "" : "px" ), + + // Starting value computation is required for potential unit mismatches + start = ( jQuery.cssNumber[ prop ] || unit !== "px" && +target ) && + rfxnum.exec( jQuery.css( tween.elem, prop ) ), + scale = 1, + maxIterations = 20; + + if ( start && start[ 3 ] !== unit ) { + // Trust units reported by jQuery.css + unit = unit || start[ 3 ]; + + // Make sure we update the tween properties later on + parts = parts || []; + + // Iteratively approximate from a nonzero starting point + start = +target || 1; + + do { + // If previous iteration zeroed out, double until we get *something* + // Use a string for doubling factor so we don't accidentally see scale as unchanged below + scale = scale || ".5"; + + // Adjust and apply + start = start / scale; + jQuery.style( tween.elem, prop, start + unit ); + + // Update scale, tolerating zero or NaN from tween.cur() + // And breaking the loop if scale is unchanged or perfect, or if we've just had enough + } while ( scale !== (scale = tween.cur() / target) && scale !== 1 && --maxIterations ); + } + + // Update tween properties + if ( parts ) { + start = tween.start = +start || +target || 0; + tween.unit = unit; + // If a +=/-= token was provided, we're doing a relative animation + tween.end = parts[ 1 ] ? + start + ( parts[ 1 ] + 1 ) * parts[ 2 ] : + +parts[ 2 ]; + } + + return tween; + } ] + }; + +// Animations created synchronously will run synchronously +function createFxNow() { + setTimeout(function() { + fxNow = undefined; + }); + return ( fxNow = jQuery.now() ); +} + +// Generate parameters to create a standard animation +function genFx( type, includeWidth ) { + var which, + attrs = { height: type }, + i = 0; + + // if we include width, step value is 1 to do all cssExpand values, + // if we don't include width, step value is 2 to skip over Left and Right + includeWidth = includeWidth ? 1 : 0; + for ( ; i < 4 ; i += 2 - includeWidth ) { + which = cssExpand[ i ]; + attrs[ "margin" + which ] = attrs[ "padding" + which ] = type; + } + + if ( includeWidth ) { + attrs.opacity = attrs.width = type; + } + + return attrs; +} + +function createTween( value, prop, animation ) { + var tween, + collection = ( tweeners[ prop ] || [] ).concat( tweeners[ "*" ] ), + index = 0, + length = collection.length; + for ( ; index < length; index++ ) { + if ( (tween = collection[ index ].call( animation, prop, value )) ) { + + // we're done with this property + return tween; + } + } +} + +function defaultPrefilter( elem, props, opts ) { + /* jshint validthis: true */ + var prop, value, toggle, tween, hooks, oldfire, display, checkDisplay, + anim = this, + orig = {}, + style = elem.style, + hidden = elem.nodeType && isHidden( elem ), + dataShow = jQuery._data( elem, "fxshow" ); + + // handle queue: false promises + if ( !opts.queue ) { + hooks = jQuery._queueHooks( elem, "fx" ); + if ( hooks.unqueued == null ) { + hooks.unqueued = 0; + oldfire = hooks.empty.fire; + hooks.empty.fire = function() { + if ( !hooks.unqueued ) { + oldfire(); + } + }; + } + hooks.unqueued++; + + anim.always(function() { + // doing this makes sure that the complete handler will be called + // before this completes + anim.always(function() { + hooks.unqueued--; + if ( !jQuery.queue( elem, "fx" ).length ) { + hooks.empty.fire(); + } + }); + }); + } + + // height/width overflow pass + if ( elem.nodeType === 1 && ( "height" in props || "width" in props ) ) { + // Make sure that nothing sneaks out + // Record all 3 overflow attributes because IE does not + // change the overflow attribute when overflowX and + // overflowY are set to the same value + opts.overflow = [ style.overflow, style.overflowX, style.overflowY ]; + + // Set display property to inline-block for height/width + // animations on inline elements that are having width/height animated + display = jQuery.css( elem, "display" ); + + // Test default display if display is currently "none" + checkDisplay = display === "none" ? + jQuery._data( elem, "olddisplay" ) || defaultDisplay( elem.nodeName ) : display; + + if ( checkDisplay === "inline" && jQuery.css( elem, "float" ) === "none" ) { + + // inline-level elements accept inline-block; + // block-level elements need to be inline with layout + if ( !support.inlineBlockNeedsLayout || defaultDisplay( elem.nodeName ) === "inline" ) { + style.display = "inline-block"; + } else { + style.zoom = 1; + } + } + } + + if ( opts.overflow ) { + style.overflow = "hidden"; + if ( !support.shrinkWrapBlocks() ) { + anim.always(function() { + style.overflow = opts.overflow[ 0 ]; + style.overflowX = opts.overflow[ 1 ]; + style.overflowY = opts.overflow[ 2 ]; + }); + } + } + + // show/hide pass + for ( prop in props ) { + value = props[ prop ]; + if ( rfxtypes.exec( value ) ) { + delete props[ prop ]; + toggle = toggle || value === "toggle"; + if ( value === ( hidden ? "hide" : "show" ) ) { + + // If there is dataShow left over from a stopped hide or show and we are going to proceed with show, we should pretend to be hidden + if ( value === "show" && dataShow && dataShow[ prop ] !== undefined ) { + hidden = true; + } else { + continue; + } + } + orig[ prop ] = dataShow && dataShow[ prop ] || jQuery.style( elem, prop ); + + // Any non-fx value stops us from restoring the original display value + } else { + display = undefined; + } + } + + if ( !jQuery.isEmptyObject( orig ) ) { + if ( dataShow ) { + if ( "hidden" in dataShow ) { + hidden = dataShow.hidden; + } + } else { + dataShow = jQuery._data( elem, "fxshow", {} ); + } + + // store state if its toggle - enables .stop().toggle() to "reverse" + if ( toggle ) { + dataShow.hidden = !hidden; + } + if ( hidden ) { + jQuery( elem ).show(); + } else { + anim.done(function() { + jQuery( elem ).hide(); + }); + } + anim.done(function() { + var prop; + jQuery._removeData( elem, "fxshow" ); + for ( prop in orig ) { + jQuery.style( elem, prop, orig[ prop ] ); + } + }); + for ( prop in orig ) { + tween = createTween( hidden ? dataShow[ prop ] : 0, prop, anim ); + + if ( !( prop in dataShow ) ) { + dataShow[ prop ] = tween.start; + if ( hidden ) { + tween.end = tween.start; + tween.start = prop === "width" || prop === "height" ? 1 : 0; + } + } + } + + // If this is a noop like .hide().hide(), restore an overwritten display value + } else if ( (display === "none" ? defaultDisplay( elem.nodeName ) : display) === "inline" ) { + style.display = display; + } +} + +function propFilter( props, specialEasing ) { + var index, name, easing, value, hooks; + + // camelCase, specialEasing and expand cssHook pass + for ( index in props ) { + name = jQuery.camelCase( index ); + easing = specialEasing[ name ]; + value = props[ index ]; + if ( jQuery.isArray( value ) ) { + easing = value[ 1 ]; + value = props[ index ] = value[ 0 ]; + } + + if ( index !== name ) { + props[ name ] = value; + delete props[ index ]; + } + + hooks = jQuery.cssHooks[ name ]; + if ( hooks && "expand" in hooks ) { + value = hooks.expand( value ); + delete props[ name ]; + + // not quite $.extend, this wont overwrite keys already present. + // also - reusing 'index' from above because we have the correct "name" + for ( index in value ) { + if ( !( index in props ) ) { + props[ index ] = value[ index ]; + specialEasing[ index ] = easing; + } + } + } else { + specialEasing[ name ] = easing; + } + } +} + +function Animation( elem, properties, options ) { + var result, + stopped, + index = 0, + length = animationPrefilters.length, + deferred = jQuery.Deferred().always( function() { + // don't match elem in the :animated selector + delete tick.elem; + }), + tick = function() { + if ( stopped ) { + return false; + } + var currentTime = fxNow || createFxNow(), + remaining = Math.max( 0, animation.startTime + animation.duration - currentTime ), + // archaic crash bug won't allow us to use 1 - ( 0.5 || 0 ) (#12497) + temp = remaining / animation.duration || 0, + percent = 1 - temp, + index = 0, + length = animation.tweens.length; + + for ( ; index < length ; index++ ) { + animation.tweens[ index ].run( percent ); + } + + deferred.notifyWith( elem, [ animation, percent, remaining ]); + + if ( percent < 1 && length ) { + return remaining; + } else { + deferred.resolveWith( elem, [ animation ] ); + return false; + } + }, + animation = deferred.promise({ + elem: elem, + props: jQuery.extend( {}, properties ), + opts: jQuery.extend( true, { specialEasing: {} }, options ), + originalProperties: properties, + originalOptions: options, + startTime: fxNow || createFxNow(), + duration: options.duration, + tweens: [], + createTween: function( prop, end ) { + var tween = jQuery.Tween( elem, animation.opts, prop, end, + animation.opts.specialEasing[ prop ] || animation.opts.easing ); + animation.tweens.push( tween ); + return tween; + }, + stop: function( gotoEnd ) { + var index = 0, + // if we are going to the end, we want to run all the tweens + // otherwise we skip this part + length = gotoEnd ? animation.tweens.length : 0; + if ( stopped ) { + return this; + } + stopped = true; + for ( ; index < length ; index++ ) { + animation.tweens[ index ].run( 1 ); + } + + // resolve when we played the last frame + // otherwise, reject + if ( gotoEnd ) { + deferred.resolveWith( elem, [ animation, gotoEnd ] ); + } else { + deferred.rejectWith( elem, [ animation, gotoEnd ] ); + } + return this; + } + }), + props = animation.props; + + propFilter( props, animation.opts.specialEasing ); + + for ( ; index < length ; index++ ) { + result = animationPrefilters[ index ].call( animation, elem, props, animation.opts ); + if ( result ) { + return result; + } + } + + jQuery.map( props, createTween, animation ); + + if ( jQuery.isFunction( animation.opts.start ) ) { + animation.opts.start.call( elem, animation ); + } + + jQuery.fx.timer( + jQuery.extend( tick, { + elem: elem, + anim: animation, + queue: animation.opts.queue + }) + ); + + // attach callbacks from options + return animation.progress( animation.opts.progress ) + .done( animation.opts.done, animation.opts.complete ) + .fail( animation.opts.fail ) + .always( animation.opts.always ); +} + +jQuery.Animation = jQuery.extend( Animation, { + tweener: function( props, callback ) { + if ( jQuery.isFunction( props ) ) { + callback = props; + props = [ "*" ]; + } else { + props = props.split(" "); + } + + var prop, + index = 0, + length = props.length; + + for ( ; index < length ; index++ ) { + prop = props[ index ]; + tweeners[ prop ] = tweeners[ prop ] || []; + tweeners[ prop ].unshift( callback ); + } + }, + + prefilter: function( callback, prepend ) { + if ( prepend ) { + animationPrefilters.unshift( callback ); + } else { + animationPrefilters.push( callback ); + } + } +}); + +jQuery.speed = function( speed, easing, fn ) { + var opt = speed && typeof speed === "object" ? jQuery.extend( {}, speed ) : { + complete: fn || !fn && easing || + jQuery.isFunction( speed ) && speed, + duration: speed, + easing: fn && easing || easing && !jQuery.isFunction( easing ) && easing + }; + + opt.duration = jQuery.fx.off ? 0 : typeof opt.duration === "number" ? opt.duration : + opt.duration in jQuery.fx.speeds ? jQuery.fx.speeds[ opt.duration ] : jQuery.fx.speeds._default; + + // normalize opt.queue - true/undefined/null -> "fx" + if ( opt.queue == null || opt.queue === true ) { + opt.queue = "fx"; + } + + // Queueing + opt.old = opt.complete; + + opt.complete = function() { + if ( jQuery.isFunction( opt.old ) ) { + opt.old.call( this ); + } + + if ( opt.queue ) { + jQuery.dequeue( this, opt.queue ); + } + }; + + return opt; +}; + +jQuery.fn.extend({ + fadeTo: function( speed, to, easing, callback ) { + + // show any hidden elements after setting opacity to 0 + return this.filter( isHidden ).css( "opacity", 0 ).show() + + // animate to the value specified + .end().animate({ opacity: to }, speed, easing, callback ); + }, + animate: function( prop, speed, easing, callback ) { + var empty = jQuery.isEmptyObject( prop ), + optall = jQuery.speed( speed, easing, callback ), + doAnimation = function() { + // Operate on a copy of prop so per-property easing won't be lost + var anim = Animation( this, jQuery.extend( {}, prop ), optall ); + + // Empty animations, or finishing resolves immediately + if ( empty || jQuery._data( this, "finish" ) ) { + anim.stop( true ); + } + }; + doAnimation.finish = doAnimation; + + return empty || optall.queue === false ? + this.each( doAnimation ) : + this.queue( optall.queue, doAnimation ); + }, + stop: function( type, clearQueue, gotoEnd ) { + var stopQueue = function( hooks ) { + var stop = hooks.stop; + delete hooks.stop; + stop( gotoEnd ); + }; + + if ( typeof type !== "string" ) { + gotoEnd = clearQueue; + clearQueue = type; + type = undefined; + } + if ( clearQueue && type !== false ) { + this.queue( type || "fx", [] ); + } + + return this.each(function() { + var dequeue = true, + index = type != null && type + "queueHooks", + timers = jQuery.timers, + data = jQuery._data( this ); + + if ( index ) { + if ( data[ index ] && data[ index ].stop ) { + stopQueue( data[ index ] ); + } + } else { + for ( index in data ) { + if ( data[ index ] && data[ index ].stop && rrun.test( index ) ) { + stopQueue( data[ index ] ); + } + } + } + + for ( index = timers.length; index--; ) { + if ( timers[ index ].elem === this && (type == null || timers[ index ].queue === type) ) { + timers[ index ].anim.stop( gotoEnd ); + dequeue = false; + timers.splice( index, 1 ); + } + } + + // start the next in the queue if the last step wasn't forced + // timers currently will call their complete callbacks, which will dequeue + // but only if they were gotoEnd + if ( dequeue || !gotoEnd ) { + jQuery.dequeue( this, type ); + } + }); + }, + finish: function( type ) { + if ( type !== false ) { + type = type || "fx"; + } + return this.each(function() { + var index, + data = jQuery._data( this ), + queue = data[ type + "queue" ], + hooks = data[ type + "queueHooks" ], + timers = jQuery.timers, + length = queue ? queue.length : 0; + + // enable finishing flag on private data + data.finish = true; + + // empty the queue first + jQuery.queue( this, type, [] ); + + if ( hooks && hooks.stop ) { + hooks.stop.call( this, true ); + } + + // look for any active animations, and finish them + for ( index = timers.length; index--; ) { + if ( timers[ index ].elem === this && timers[ index ].queue === type ) { + timers[ index ].anim.stop( true ); + timers.splice( index, 1 ); + } + } + + // look for any animations in the old queue and finish them + for ( index = 0; index < length; index++ ) { + if ( queue[ index ] && queue[ index ].finish ) { + queue[ index ].finish.call( this ); + } + } + + // turn off finishing flag + delete data.finish; + }); + } +}); + +jQuery.each([ "toggle", "show", "hide" ], function( i, name ) { + var cssFn = jQuery.fn[ name ]; + jQuery.fn[ name ] = function( speed, easing, callback ) { + return speed == null || typeof speed === "boolean" ? + cssFn.apply( this, arguments ) : + this.animate( genFx( name, true ), speed, easing, callback ); + }; +}); + +// Generate shortcuts for custom animations +jQuery.each({ + slideDown: genFx("show"), + slideUp: genFx("hide"), + slideToggle: genFx("toggle"), + fadeIn: { opacity: "show" }, + fadeOut: { opacity: "hide" }, + fadeToggle: { opacity: "toggle" } +}, function( name, props ) { + jQuery.fn[ name ] = function( speed, easing, callback ) { + return this.animate( props, speed, easing, callback ); + }; +}); + +jQuery.timers = []; +jQuery.fx.tick = function() { + var timer, + timers = jQuery.timers, + i = 0; + + fxNow = jQuery.now(); + + for ( ; i < timers.length; i++ ) { + timer = timers[ i ]; + // Checks the timer has not already been removed + if ( !timer() && timers[ i ] === timer ) { + timers.splice( i--, 1 ); + } + } + + if ( !timers.length ) { + jQuery.fx.stop(); + } + fxNow = undefined; +}; + +jQuery.fx.timer = function( timer ) { + jQuery.timers.push( timer ); + if ( timer() ) { + jQuery.fx.start(); + } else { + jQuery.timers.pop(); + } +}; + +jQuery.fx.interval = 13; + +jQuery.fx.start = function() { + if ( !timerId ) { + timerId = setInterval( jQuery.fx.tick, jQuery.fx.interval ); + } +}; + +jQuery.fx.stop = function() { + clearInterval( timerId ); + timerId = null; +}; + +jQuery.fx.speeds = { + slow: 600, + fast: 200, + // Default speed + _default: 400 +}; + + +// Based off of the plugin by Clint Helfers, with permission. +// http://blindsignals.com/index.php/2009/07/jquery-delay/ +jQuery.fn.delay = function( time, type ) { + time = jQuery.fx ? jQuery.fx.speeds[ time ] || time : time; + type = type || "fx"; + + return this.queue( type, function( next, hooks ) { + var timeout = setTimeout( next, time ); + hooks.stop = function() { + clearTimeout( timeout ); + }; + }); +}; + + +(function() { + // Minified: var a,b,c,d,e + var input, div, select, a, opt; + + // Setup + div = document.createElement( "div" ); + div.setAttribute( "className", "t" ); + div.innerHTML = " <link/><table></table><a href='/a'>a</a><input type='checkbox'/>"; + a = div.getElementsByTagName("a")[ 0 ]; + + // First batch of tests. + select = document.createElement("select"); + opt = select.appendChild( document.createElement("option") ); + input = div.getElementsByTagName("input")[ 0 ]; + + a.style.cssText = "top:1px"; + + // Test setAttribute on camelCase class. If it works, we need attrFixes when doing get/setAttribute (ie6/7) + support.getSetAttribute = div.className !== "t"; + + // Get the style information from getAttribute + // (IE uses .cssText instead) + support.style = /top/.test( a.getAttribute("style") ); + + // Make sure that URLs aren't manipulated + // (IE normalizes it by default) + support.hrefNormalized = a.getAttribute("href") === "/a"; + + // Check the default checkbox/radio value ("" on WebKit; "on" elsewhere) + support.checkOn = !!input.value; + + // Make sure that a selected-by-default option has a working selected property. + // (WebKit defaults to false instead of true, IE too, if it's in an optgroup) + support.optSelected = opt.selected; + + // Tests for enctype support on a form (#6743) + support.enctype = !!document.createElement("form").enctype; + + // Make sure that the options inside disabled selects aren't marked as disabled + // (WebKit marks them as disabled) + select.disabled = true; + support.optDisabled = !opt.disabled; + + // Support: IE8 only + // Check if we can trust getAttribute("value") + input = document.createElement( "input" ); + input.setAttribute( "value", "" ); + support.input = input.getAttribute( "value" ) === ""; + + // Check if an input maintains its value after becoming a radio + input.value = "t"; + input.setAttribute( "type", "radio" ); + support.radioValue = input.value === "t"; +})(); + + +var rreturn = /\r/g; + +jQuery.fn.extend({ + val: function( value ) { + var hooks, ret, isFunction, + elem = this[0]; + + if ( !arguments.length ) { + if ( elem ) { + hooks = jQuery.valHooks[ elem.type ] || jQuery.valHooks[ elem.nodeName.toLowerCase() ]; + + if ( hooks && "get" in hooks && (ret = hooks.get( elem, "value" )) !== undefined ) { + return ret; + } + + ret = elem.value; + + return typeof ret === "string" ? + // handle most common string cases + ret.replace(rreturn, "") : + // handle cases where value is null/undef or number + ret == null ? "" : ret; + } + + return; + } + + isFunction = jQuery.isFunction( value ); + + return this.each(function( i ) { + var val; + + if ( this.nodeType !== 1 ) { + return; + } + + if ( isFunction ) { + val = value.call( this, i, jQuery( this ).val() ); + } else { + val = value; + } + + // Treat null/undefined as ""; convert numbers to string + if ( val == null ) { + val = ""; + } else if ( typeof val === "number" ) { + val += ""; + } else if ( jQuery.isArray( val ) ) { + val = jQuery.map( val, function( value ) { + return value == null ? "" : value + ""; + }); + } + + hooks = jQuery.valHooks[ this.type ] || jQuery.valHooks[ this.nodeName.toLowerCase() ]; + + // If set returns undefined, fall back to normal setting + if ( !hooks || !("set" in hooks) || hooks.set( this, val, "value" ) === undefined ) { + this.value = val; + } + }); + } +}); + +jQuery.extend({ + valHooks: { + option: { + get: function( elem ) { + var val = jQuery.find.attr( elem, "value" ); + return val != null ? + val : + // Support: IE10-11+ + // option.text throws exceptions (#14686, #14858) + jQuery.trim( jQuery.text( elem ) ); + } + }, + select: { + get: function( elem ) { + var value, option, + options = elem.options, + index = elem.selectedIndex, + one = elem.type === "select-one" || index < 0, + values = one ? null : [], + max = one ? index + 1 : options.length, + i = index < 0 ? + max : + one ? index : 0; + + // Loop through all the selected options + for ( ; i < max; i++ ) { + option = options[ i ]; + + // oldIE doesn't update selected after form reset (#2551) + if ( ( option.selected || i === index ) && + // Don't return options that are disabled or in a disabled optgroup + ( support.optDisabled ? !option.disabled : option.getAttribute("disabled") === null ) && + ( !option.parentNode.disabled || !jQuery.nodeName( option.parentNode, "optgroup" ) ) ) { + + // Get the specific value for the option + value = jQuery( option ).val(); + + // We don't need an array for one selects + if ( one ) { + return value; + } + + // Multi-Selects return an array + values.push( value ); + } + } + + return values; + }, + + set: function( elem, value ) { + var optionSet, option, + options = elem.options, + values = jQuery.makeArray( value ), + i = options.length; + + while ( i-- ) { + option = options[ i ]; + + if ( jQuery.inArray( jQuery.valHooks.option.get( option ), values ) >= 0 ) { + + // Support: IE6 + // When new option element is added to select box we need to + // force reflow of newly added node in order to workaround delay + // of initialization properties + try { + option.selected = optionSet = true; + + } catch ( _ ) { + + // Will be executed only in IE6 + option.scrollHeight; + } + + } else { + option.selected = false; + } + } + + // Force browsers to behave consistently when non-matching value is set + if ( !optionSet ) { + elem.selectedIndex = -1; + } + + return options; + } + } + } +}); + +// Radios and checkboxes getter/setter +jQuery.each([ "radio", "checkbox" ], function() { + jQuery.valHooks[ this ] = { + set: function( elem, value ) { + if ( jQuery.isArray( value ) ) { + return ( elem.checked = jQuery.inArray( jQuery(elem).val(), value ) >= 0 ); + } + } + }; + if ( !support.checkOn ) { + jQuery.valHooks[ this ].get = function( elem ) { + // Support: Webkit + // "" is returned instead of "on" if a value isn't specified + return elem.getAttribute("value") === null ? "on" : elem.value; + }; + } +}); + + + + +var nodeHook, boolHook, + attrHandle = jQuery.expr.attrHandle, + ruseDefault = /^(?:checked|selected)$/i, + getSetAttribute = support.getSetAttribute, + getSetInput = support.input; + +jQuery.fn.extend({ + attr: function( name, value ) { + return access( this, jQuery.attr, name, value, arguments.length > 1 ); + }, + + removeAttr: function( name ) { + return this.each(function() { + jQuery.removeAttr( this, name ); + }); + } +}); + +jQuery.extend({ + attr: function( elem, name, value ) { + var hooks, ret, + nType = elem.nodeType; + + // don't get/set attributes on text, comment and attribute nodes + if ( !elem || nType === 3 || nType === 8 || nType === 2 ) { + return; + } + + // Fallback to prop when attributes are not supported + if ( typeof elem.getAttribute === strundefined ) { + return jQuery.prop( elem, name, value ); + } + + // All attributes are lowercase + // Grab necessary hook if one is defined + if ( nType !== 1 || !jQuery.isXMLDoc( elem ) ) { + name = name.toLowerCase(); + hooks = jQuery.attrHooks[ name ] || + ( jQuery.expr.match.bool.test( name ) ? boolHook : nodeHook ); + } + + if ( value !== undefined ) { + + if ( value === null ) { + jQuery.removeAttr( elem, name ); + + } else if ( hooks && "set" in hooks && (ret = hooks.set( elem, value, name )) !== undefined ) { + return ret; + + } else { + elem.setAttribute( name, value + "" ); + return value; + } + + } else if ( hooks && "get" in hooks && (ret = hooks.get( elem, name )) !== null ) { + return ret; + + } else { + ret = jQuery.find.attr( elem, name ); + + // Non-existent attributes return null, we normalize to undefined + return ret == null ? + undefined : + ret; + } + }, + + removeAttr: function( elem, value ) { + var name, propName, + i = 0, + attrNames = value && value.match( rnotwhite ); + + if ( attrNames && elem.nodeType === 1 ) { + while ( (name = attrNames[i++]) ) { + propName = jQuery.propFix[ name ] || name; + + // Boolean attributes get special treatment (#10870) + if ( jQuery.expr.match.bool.test( name ) ) { + // Set corresponding property to false + if ( getSetInput && getSetAttribute || !ruseDefault.test( name ) ) { + elem[ propName ] = false; + // Support: IE<9 + // Also clear defaultChecked/defaultSelected (if appropriate) + } else { + elem[ jQuery.camelCase( "default-" + name ) ] = + elem[ propName ] = false; + } + + // See #9699 for explanation of this approach (setting first, then removal) + } else { + jQuery.attr( elem, name, "" ); + } + + elem.removeAttribute( getSetAttribute ? name : propName ); + } + } + }, + + attrHooks: { + type: { + set: function( elem, value ) { + if ( !support.radioValue && value === "radio" && jQuery.nodeName(elem, "input") ) { + // Setting the type on a radio button after the value resets the value in IE6-9 + // Reset value to default in case type is set after value during creation + var val = elem.value; + elem.setAttribute( "type", value ); + if ( val ) { + elem.value = val; + } + return value; + } + } + } + } +}); + +// Hook for boolean attributes +boolHook = { + set: function( elem, value, name ) { + if ( value === false ) { + // Remove boolean attributes when set to false + jQuery.removeAttr( elem, name ); + } else if ( getSetInput && getSetAttribute || !ruseDefault.test( name ) ) { + // IE<8 needs the *property* name + elem.setAttribute( !getSetAttribute && jQuery.propFix[ name ] || name, name ); + + // Use defaultChecked and defaultSelected for oldIE + } else { + elem[ jQuery.camelCase( "default-" + name ) ] = elem[ name ] = true; + } + + return name; + } +}; + +// Retrieve booleans specially +jQuery.each( jQuery.expr.match.bool.source.match( /\w+/g ), function( i, name ) { + + var getter = attrHandle[ name ] || jQuery.find.attr; + + attrHandle[ name ] = getSetInput && getSetAttribute || !ruseDefault.test( name ) ? + function( elem, name, isXML ) { + var ret, handle; + if ( !isXML ) { + // Avoid an infinite loop by temporarily removing this function from the getter + handle = attrHandle[ name ]; + attrHandle[ name ] = ret; + ret = getter( elem, name, isXML ) != null ? + name.toLowerCase() : + null; + attrHandle[ name ] = handle; + } + return ret; + } : + function( elem, name, isXML ) { + if ( !isXML ) { + return elem[ jQuery.camelCase( "default-" + name ) ] ? + name.toLowerCase() : + null; + } + }; +}); + +// fix oldIE attroperties +if ( !getSetInput || !getSetAttribute ) { + jQuery.attrHooks.value = { + set: function( elem, value, name ) { + if ( jQuery.nodeName( elem, "input" ) ) { + // Does not return so that setAttribute is also used + elem.defaultValue = value; + } else { + // Use nodeHook if defined (#1954); otherwise setAttribute is fine + return nodeHook && nodeHook.set( elem, value, name ); + } + } + }; +} + +// IE6/7 do not support getting/setting some attributes with get/setAttribute +if ( !getSetAttribute ) { + + // Use this for any attribute in IE6/7 + // This fixes almost every IE6/7 issue + nodeHook = { + set: function( elem, value, name ) { + // Set the existing or create a new attribute node + var ret = elem.getAttributeNode( name ); + if ( !ret ) { + elem.setAttributeNode( + (ret = elem.ownerDocument.createAttribute( name )) + ); + } + + ret.value = value += ""; + + // Break association with cloned elements by also using setAttribute (#9646) + if ( name === "value" || value === elem.getAttribute( name ) ) { + return value; + } + } + }; + + // Some attributes are constructed with empty-string values when not defined + attrHandle.id = attrHandle.name = attrHandle.coords = + function( elem, name, isXML ) { + var ret; + if ( !isXML ) { + return (ret = elem.getAttributeNode( name )) && ret.value !== "" ? + ret.value : + null; + } + }; + + // Fixing value retrieval on a button requires this module + jQuery.valHooks.button = { + get: function( elem, name ) { + var ret = elem.getAttributeNode( name ); + if ( ret && ret.specified ) { + return ret.value; + } + }, + set: nodeHook.set + }; + + // Set contenteditable to false on removals(#10429) + // Setting to empty string throws an error as an invalid value + jQuery.attrHooks.contenteditable = { + set: function( elem, value, name ) { + nodeHook.set( elem, value === "" ? false : value, name ); + } + }; + + // Set width and height to auto instead of 0 on empty string( Bug #8150 ) + // This is for removals + jQuery.each([ "width", "height" ], function( i, name ) { + jQuery.attrHooks[ name ] = { + set: function( elem, value ) { + if ( value === "" ) { + elem.setAttribute( name, "auto" ); + return value; + } + } + }; + }); +} + +if ( !support.style ) { + jQuery.attrHooks.style = { + get: function( elem ) { + // Return undefined in the case of empty string + // Note: IE uppercases css property names, but if we were to .toLowerCase() + // .cssText, that would destroy case senstitivity in URL's, like in "background" + return elem.style.cssText || undefined; + }, + set: function( elem, value ) { + return ( elem.style.cssText = value + "" ); + } + }; +} + + + + +var rfocusable = /^(?:input|select|textarea|button|object)$/i, + rclickable = /^(?:a|area)$/i; + +jQuery.fn.extend({ + prop: function( name, value ) { + return access( this, jQuery.prop, name, value, arguments.length > 1 ); + }, + + removeProp: function( name ) { + name = jQuery.propFix[ name ] || name; + return this.each(function() { + // try/catch handles cases where IE balks (such as removing a property on window) + try { + this[ name ] = undefined; + delete this[ name ]; + } catch( e ) {} + }); + } +}); + +jQuery.extend({ + propFix: { + "for": "htmlFor", + "class": "className" + }, + + prop: function( elem, name, value ) { + var ret, hooks, notxml, + nType = elem.nodeType; + + // don't get/set properties on text, comment and attribute nodes + if ( !elem || nType === 3 || nType === 8 || nType === 2 ) { + return; + } + + notxml = nType !== 1 || !jQuery.isXMLDoc( elem ); + + if ( notxml ) { + // Fix name and attach hooks + name = jQuery.propFix[ name ] || name; + hooks = jQuery.propHooks[ name ]; + } + + if ( value !== undefined ) { + return hooks && "set" in hooks && (ret = hooks.set( elem, value, name )) !== undefined ? + ret : + ( elem[ name ] = value ); + + } else { + return hooks && "get" in hooks && (ret = hooks.get( elem, name )) !== null ? + ret : + elem[ name ]; + } + }, + + propHooks: { + tabIndex: { + get: function( elem ) { + // elem.tabIndex doesn't always return the correct value when it hasn't been explicitly set + // http://fluidproject.org/blog/2008/01/09/getting-setting-and-removing-tabindex-values-with-javascript/ + // Use proper attribute retrieval(#12072) + var tabindex = jQuery.find.attr( elem, "tabindex" ); + + return tabindex ? + parseInt( tabindex, 10 ) : + rfocusable.test( elem.nodeName ) || rclickable.test( elem.nodeName ) && elem.href ? + 0 : + -1; + } + } + } +}); + +// Some attributes require a special call on IE +// http://msdn.microsoft.com/en-us/library/ms536429%28VS.85%29.aspx +if ( !support.hrefNormalized ) { + // href/src property should get the full normalized URL (#10299/#12915) + jQuery.each([ "href", "src" ], function( i, name ) { + jQuery.propHooks[ name ] = { + get: function( elem ) { + return elem.getAttribute( name, 4 ); + } + }; + }); +} + +// Support: Safari, IE9+ +// mis-reports the default selected property of an option +// Accessing the parent's selectedIndex property fixes it +if ( !support.optSelected ) { + jQuery.propHooks.selected = { + get: function( elem ) { + var parent = elem.parentNode; + + if ( parent ) { + parent.selectedIndex; + + // Make sure that it also works with optgroups, see #5701 + if ( parent.parentNode ) { + parent.parentNode.selectedIndex; + } + } + return null; + } + }; +} + +jQuery.each([ + "tabIndex", + "readOnly", + "maxLength", + "cellSpacing", + "cellPadding", + "rowSpan", + "colSpan", + "useMap", + "frameBorder", + "contentEditable" +], function() { + jQuery.propFix[ this.toLowerCase() ] = this; +}); + +// IE6/7 call enctype encoding +if ( !support.enctype ) { + jQuery.propFix.enctype = "encoding"; +} + + + + +var rclass = /[\t\r\n\f]/g; + +jQuery.fn.extend({ + addClass: function( value ) { + var classes, elem, cur, clazz, j, finalValue, + i = 0, + len = this.length, + proceed = typeof value === "string" && value; + + if ( jQuery.isFunction( value ) ) { + return this.each(function( j ) { + jQuery( this ).addClass( value.call( this, j, this.className ) ); + }); + } + + if ( proceed ) { + // The disjunction here is for better compressibility (see removeClass) + classes = ( value || "" ).match( rnotwhite ) || []; + + for ( ; i < len; i++ ) { + elem = this[ i ]; + cur = elem.nodeType === 1 && ( elem.className ? + ( " " + elem.className + " " ).replace( rclass, " " ) : + " " + ); + + if ( cur ) { + j = 0; + while ( (clazz = classes[j++]) ) { + if ( cur.indexOf( " " + clazz + " " ) < 0 ) { + cur += clazz + " "; + } + } + + // only assign if different to avoid unneeded rendering. + finalValue = jQuery.trim( cur ); + if ( elem.className !== finalValue ) { + elem.className = finalValue; + } + } + } + } + + return this; + }, + + removeClass: function( value ) { + var classes, elem, cur, clazz, j, finalValue, + i = 0, + len = this.length, + proceed = arguments.length === 0 || typeof value === "string" && value; + + if ( jQuery.isFunction( value ) ) { + return this.each(function( j ) { + jQuery( this ).removeClass( value.call( this, j, this.className ) ); + }); + } + if ( proceed ) { + classes = ( value || "" ).match( rnotwhite ) || []; + + for ( ; i < len; i++ ) { + elem = this[ i ]; + // This expression is here for better compressibility (see addClass) + cur = elem.nodeType === 1 && ( elem.className ? + ( " " + elem.className + " " ).replace( rclass, " " ) : + "" + ); + + if ( cur ) { + j = 0; + while ( (clazz = classes[j++]) ) { + // Remove *all* instances + while ( cur.indexOf( " " + clazz + " " ) >= 0 ) { + cur = cur.replace( " " + clazz + " ", " " ); + } + } + + // only assign if different to avoid unneeded rendering. + finalValue = value ? jQuery.trim( cur ) : ""; + if ( elem.className !== finalValue ) { + elem.className = finalValue; + } + } + } + } + + return this; + }, + + toggleClass: function( value, stateVal ) { + var type = typeof value; + + if ( typeof stateVal === "boolean" && type === "string" ) { + return stateVal ? this.addClass( value ) : this.removeClass( value ); + } + + if ( jQuery.isFunction( value ) ) { + return this.each(function( i ) { + jQuery( this ).toggleClass( value.call(this, i, this.className, stateVal), stateVal ); + }); + } + + return this.each(function() { + if ( type === "string" ) { + // toggle individual class names + var className, + i = 0, + self = jQuery( this ), + classNames = value.match( rnotwhite ) || []; + + while ( (className = classNames[ i++ ]) ) { + // check each className given, space separated list + if ( self.hasClass( className ) ) { + self.removeClass( className ); + } else { + self.addClass( className ); + } + } + + // Toggle whole class name + } else if ( type === strundefined || type === "boolean" ) { + if ( this.className ) { + // store className if set + jQuery._data( this, "__className__", this.className ); + } + + // If the element has a class name or if we're passed "false", + // then remove the whole classname (if there was one, the above saved it). + // Otherwise bring back whatever was previously saved (if anything), + // falling back to the empty string if nothing was stored. + this.className = this.className || value === false ? "" : jQuery._data( this, "__className__" ) || ""; + } + }); + }, + + hasClass: function( selector ) { + var className = " " + selector + " ", + i = 0, + l = this.length; + for ( ; i < l; i++ ) { + if ( this[i].nodeType === 1 && (" " + this[i].className + " ").replace(rclass, " ").indexOf( className ) >= 0 ) { + return true; + } + } + + return false; + } +}); + + + + +// Return jQuery for attributes-only inclusion + + +jQuery.each( ("blur focus focusin focusout load resize scroll unload click dblclick " + + "mousedown mouseup mousemove mouseover mouseout mouseenter mouseleave " + + "change select submit keydown keypress keyup error contextmenu").split(" "), function( i, name ) { + + // Handle event binding + jQuery.fn[ name ] = function( data, fn ) { + return arguments.length > 0 ? + this.on( name, null, data, fn ) : + this.trigger( name ); + }; +}); + +jQuery.fn.extend({ + hover: function( fnOver, fnOut ) { + return this.mouseenter( fnOver ).mouseleave( fnOut || fnOver ); + }, + + bind: function( types, data, fn ) { + return this.on( types, null, data, fn ); + }, + unbind: function( types, fn ) { + return this.off( types, null, fn ); + }, + + delegate: function( selector, types, data, fn ) { + return this.on( types, selector, data, fn ); + }, + undelegate: function( selector, types, fn ) { + // ( namespace ) or ( selector, types [, fn] ) + return arguments.length === 1 ? this.off( selector, "**" ) : this.off( types, selector || "**", fn ); + } +}); + + +var nonce = jQuery.now(); + +var rquery = (/\?/); + + + +var rvalidtokens = /(,)|(\[|{)|(}|])|"(?:[^"\\\r\n]|\\["\\\/bfnrt]|\\u[\da-fA-F]{4})*"\s*:?|true|false|null|-?(?!0\d)\d+(?:\.\d+|)(?:[eE][+-]?\d+|)/g; + +jQuery.parseJSON = function( data ) { + // Attempt to parse using the native JSON parser first + if ( window.JSON && window.JSON.parse ) { + // Support: Android 2.3 + // Workaround failure to string-cast null input + return window.JSON.parse( data + "" ); + } + + var requireNonComma, + depth = null, + str = jQuery.trim( data + "" ); + + // Guard against invalid (and possibly dangerous) input by ensuring that nothing remains + // after removing valid tokens + return str && !jQuery.trim( str.replace( rvalidtokens, function( token, comma, open, close ) { + + // Force termination if we see a misplaced comma + if ( requireNonComma && comma ) { + depth = 0; + } + + // Perform no more replacements after returning to outermost depth + if ( depth === 0 ) { + return token; + } + + // Commas must not follow "[", "{", or "," + requireNonComma = open || comma; + + // Determine new depth + // array/object open ("[" or "{"): depth += true - false (increment) + // array/object close ("]" or "}"): depth += false - true (decrement) + // other cases ("," or primitive): depth += true - true (numeric cast) + depth += !close - !open; + + // Remove this token + return ""; + }) ) ? + ( Function( "return " + str ) )() : + jQuery.error( "Invalid JSON: " + data ); +}; + + +// Cross-browser xml parsing +jQuery.parseXML = function( data ) { + var xml, tmp; + if ( !data || typeof data !== "string" ) { + return null; + } + try { + if ( window.DOMParser ) { // Standard + tmp = new DOMParser(); + xml = tmp.parseFromString( data, "text/xml" ); + } else { // IE + xml = new ActiveXObject( "Microsoft.XMLDOM" ); + xml.async = "false"; + xml.loadXML( data ); + } + } catch( e ) { + xml = undefined; + } + if ( !xml || !xml.documentElement || xml.getElementsByTagName( "parsererror" ).length ) { + jQuery.error( "Invalid XML: " + data ); + } + return xml; +}; + + +var + // Document location + ajaxLocParts, + ajaxLocation, + + rhash = /#.*$/, + rts = /([?&])_=[^&]*/, + rheaders = /^(.*?):[ \t]*([^\r\n]*)\r?$/mg, // IE leaves an \r character at EOL + // #7653, #8125, #8152: local protocol detection + rlocalProtocol = /^(?:about|app|app-storage|.+-extension|file|res|widget):$/, + rnoContent = /^(?:GET|HEAD)$/, + rprotocol = /^\/\//, + rurl = /^([\w.+-]+:)(?:\/\/(?:[^\/?#]*@|)([^\/?#:]*)(?::(\d+)|)|)/, + + /* Prefilters + * 1) They are useful to introduce custom dataTypes (see ajax/jsonp.js for an example) + * 2) These are called: + * - BEFORE asking for a transport + * - AFTER param serialization (s.data is a string if s.processData is true) + * 3) key is the dataType + * 4) the catchall symbol "*" can be used + * 5) execution will start with transport dataType and THEN continue down to "*" if needed + */ + prefilters = {}, + + /* Transports bindings + * 1) key is the dataType + * 2) the catchall symbol "*" can be used + * 3) selection will start with transport dataType and THEN go to "*" if needed + */ + transports = {}, + + // Avoid comment-prolog char sequence (#10098); must appease lint and evade compression + allTypes = "*/".concat("*"); + +// #8138, IE may throw an exception when accessing +// a field from window.location if document.domain has been set +try { + ajaxLocation = location.href; +} catch( e ) { + // Use the href attribute of an A element + // since IE will modify it given document.location + ajaxLocation = document.createElement( "a" ); + ajaxLocation.href = ""; + ajaxLocation = ajaxLocation.href; +} + +// Segment location into parts +ajaxLocParts = rurl.exec( ajaxLocation.toLowerCase() ) || []; + +// Base "constructor" for jQuery.ajaxPrefilter and jQuery.ajaxTransport +function addToPrefiltersOrTransports( structure ) { + + // dataTypeExpression is optional and defaults to "*" + return function( dataTypeExpression, func ) { + + if ( typeof dataTypeExpression !== "string" ) { + func = dataTypeExpression; + dataTypeExpression = "*"; + } + + var dataType, + i = 0, + dataTypes = dataTypeExpression.toLowerCase().match( rnotwhite ) || []; + + if ( jQuery.isFunction( func ) ) { + // For each dataType in the dataTypeExpression + while ( (dataType = dataTypes[i++]) ) { + // Prepend if requested + if ( dataType.charAt( 0 ) === "+" ) { + dataType = dataType.slice( 1 ) || "*"; + (structure[ dataType ] = structure[ dataType ] || []).unshift( func ); + + // Otherwise append + } else { + (structure[ dataType ] = structure[ dataType ] || []).push( func ); + } + } + } + }; +} + +// Base inspection function for prefilters and transports +function inspectPrefiltersOrTransports( structure, options, originalOptions, jqXHR ) { + + var inspected = {}, + seekingTransport = ( structure === transports ); + + function inspect( dataType ) { + var selected; + inspected[ dataType ] = true; + jQuery.each( structure[ dataType ] || [], function( _, prefilterOrFactory ) { + var dataTypeOrTransport = prefilterOrFactory( options, originalOptions, jqXHR ); + if ( typeof dataTypeOrTransport === "string" && !seekingTransport && !inspected[ dataTypeOrTransport ] ) { + options.dataTypes.unshift( dataTypeOrTransport ); + inspect( dataTypeOrTransport ); + return false; + } else if ( seekingTransport ) { + return !( selected = dataTypeOrTransport ); + } + }); + return selected; + } + + return inspect( options.dataTypes[ 0 ] ) || !inspected[ "*" ] && inspect( "*" ); +} + +// A special extend for ajax options +// that takes "flat" options (not to be deep extended) +// Fixes #9887 +function ajaxExtend( target, src ) { + var deep, key, + flatOptions = jQuery.ajaxSettings.flatOptions || {}; + + for ( key in src ) { + if ( src[ key ] !== undefined ) { + ( flatOptions[ key ] ? target : ( deep || (deep = {}) ) )[ key ] = src[ key ]; + } + } + if ( deep ) { + jQuery.extend( true, target, deep ); + } + + return target; +} + +/* Handles responses to an ajax request: + * - finds the right dataType (mediates between content-type and expected dataType) + * - returns the corresponding response + */ +function ajaxHandleResponses( s, jqXHR, responses ) { + var firstDataType, ct, finalDataType, type, + contents = s.contents, + dataTypes = s.dataTypes; + + // Remove auto dataType and get content-type in the process + while ( dataTypes[ 0 ] === "*" ) { + dataTypes.shift(); + if ( ct === undefined ) { + ct = s.mimeType || jqXHR.getResponseHeader("Content-Type"); + } + } + + // Check if we're dealing with a known content-type + if ( ct ) { + for ( type in contents ) { + if ( contents[ type ] && contents[ type ].test( ct ) ) { + dataTypes.unshift( type ); + break; + } + } + } + + // Check to see if we have a response for the expected dataType + if ( dataTypes[ 0 ] in responses ) { + finalDataType = dataTypes[ 0 ]; + } else { + // Try convertible dataTypes + for ( type in responses ) { + if ( !dataTypes[ 0 ] || s.converters[ type + " " + dataTypes[0] ] ) { + finalDataType = type; + break; + } + if ( !firstDataType ) { + firstDataType = type; + } + } + // Or just use first one + finalDataType = finalDataType || firstDataType; + } + + // If we found a dataType + // We add the dataType to the list if needed + // and return the corresponding response + if ( finalDataType ) { + if ( finalDataType !== dataTypes[ 0 ] ) { + dataTypes.unshift( finalDataType ); + } + return responses[ finalDataType ]; + } +} + +/* Chain conversions given the request and the original response + * Also sets the responseXXX fields on the jqXHR instance + */ +function ajaxConvert( s, response, jqXHR, isSuccess ) { + var conv2, current, conv, tmp, prev, + converters = {}, + // Work with a copy of dataTypes in case we need to modify it for conversion + dataTypes = s.dataTypes.slice(); + + // Create converters map with lowercased keys + if ( dataTypes[ 1 ] ) { + for ( conv in s.converters ) { + converters[ conv.toLowerCase() ] = s.converters[ conv ]; + } + } + + current = dataTypes.shift(); + + // Convert to each sequential dataType + while ( current ) { + + if ( s.responseFields[ current ] ) { + jqXHR[ s.responseFields[ current ] ] = response; + } + + // Apply the dataFilter if provided + if ( !prev && isSuccess && s.dataFilter ) { + response = s.dataFilter( response, s.dataType ); + } + + prev = current; + current = dataTypes.shift(); + + if ( current ) { + + // There's only work to do if current dataType is non-auto + if ( current === "*" ) { + + current = prev; + + // Convert response if prev dataType is non-auto and differs from current + } else if ( prev !== "*" && prev !== current ) { + + // Seek a direct converter + conv = converters[ prev + " " + current ] || converters[ "* " + current ]; + + // If none found, seek a pair + if ( !conv ) { + for ( conv2 in converters ) { + + // If conv2 outputs current + tmp = conv2.split( " " ); + if ( tmp[ 1 ] === current ) { + + // If prev can be converted to accepted input + conv = converters[ prev + " " + tmp[ 0 ] ] || + converters[ "* " + tmp[ 0 ] ]; + if ( conv ) { + // Condense equivalence converters + if ( conv === true ) { + conv = converters[ conv2 ]; + + // Otherwise, insert the intermediate dataType + } else if ( converters[ conv2 ] !== true ) { + current = tmp[ 0 ]; + dataTypes.unshift( tmp[ 1 ] ); + } + break; + } + } + } + } + + // Apply converter (if not an equivalence) + if ( conv !== true ) { + + // Unless errors are allowed to bubble, catch and return them + if ( conv && s[ "throws" ] ) { + response = conv( response ); + } else { + try { + response = conv( response ); + } catch ( e ) { + return { state: "parsererror", error: conv ? e : "No conversion from " + prev + " to " + current }; + } + } + } + } + } + } + + return { state: "success", data: response }; +} + +jQuery.extend({ + + // Counter for holding the number of active queries + active: 0, + + // Last-Modified header cache for next request + lastModified: {}, + etag: {}, + + ajaxSettings: { + url: ajaxLocation, + type: "GET", + isLocal: rlocalProtocol.test( ajaxLocParts[ 1 ] ), + global: true, + processData: true, + async: true, + contentType: "application/x-www-form-urlencoded; charset=UTF-8", + /* + timeout: 0, + data: null, + dataType: null, + username: null, + password: null, + cache: null, + throws: false, + traditional: false, + headers: {}, + */ + + accepts: { + "*": allTypes, + text: "text/plain", + html: "text/html", + xml: "application/xml, text/xml", + json: "application/json, text/javascript" + }, + + contents: { + xml: /xml/, + html: /html/, + json: /json/ + }, + + responseFields: { + xml: "responseXML", + text: "responseText", + json: "responseJSON" + }, + + // Data converters + // Keys separate source (or catchall "*") and destination types with a single space + converters: { + + // Convert anything to text + "* text": String, + + // Text to html (true = no transformation) + "text html": true, + + // Evaluate text as a json expression + "text json": jQuery.parseJSON, + + // Parse text as xml + "text xml": jQuery.parseXML + }, + + // For options that shouldn't be deep extended: + // you can add your own custom options here if + // and when you create one that shouldn't be + // deep extended (see ajaxExtend) + flatOptions: { + url: true, + context: true + } + }, + + // Creates a full fledged settings object into target + // with both ajaxSettings and settings fields. + // If target is omitted, writes into ajaxSettings. + ajaxSetup: function( target, settings ) { + return settings ? + + // Building a settings object + ajaxExtend( ajaxExtend( target, jQuery.ajaxSettings ), settings ) : + + // Extending ajaxSettings + ajaxExtend( jQuery.ajaxSettings, target ); + }, + + ajaxPrefilter: addToPrefiltersOrTransports( prefilters ), + ajaxTransport: addToPrefiltersOrTransports( transports ), + + // Main method + ajax: function( url, options ) { + + // If url is an object, simulate pre-1.5 signature + if ( typeof url === "object" ) { + options = url; + url = undefined; + } + + // Force options to be an object + options = options || {}; + + var // Cross-domain detection vars + parts, + // Loop variable + i, + // URL without anti-cache param + cacheURL, + // Response headers as string + responseHeadersString, + // timeout handle + timeoutTimer, + + // To know if global events are to be dispatched + fireGlobals, + + transport, + // Response headers + responseHeaders, + // Create the final options object + s = jQuery.ajaxSetup( {}, options ), + // Callbacks context + callbackContext = s.context || s, + // Context for global events is callbackContext if it is a DOM node or jQuery collection + globalEventContext = s.context && ( callbackContext.nodeType || callbackContext.jquery ) ? + jQuery( callbackContext ) : + jQuery.event, + // Deferreds + deferred = jQuery.Deferred(), + completeDeferred = jQuery.Callbacks("once memory"), + // Status-dependent callbacks + statusCode = s.statusCode || {}, + // Headers (they are sent all at once) + requestHeaders = {}, + requestHeadersNames = {}, + // The jqXHR state + state = 0, + // Default abort message + strAbort = "canceled", + // Fake xhr + jqXHR = { + readyState: 0, + + // Builds headers hashtable if needed + getResponseHeader: function( key ) { + var match; + if ( state === 2 ) { + if ( !responseHeaders ) { + responseHeaders = {}; + while ( (match = rheaders.exec( responseHeadersString )) ) { + responseHeaders[ match[1].toLowerCase() ] = match[ 2 ]; + } + } + match = responseHeaders[ key.toLowerCase() ]; + } + return match == null ? null : match; + }, + + // Raw string + getAllResponseHeaders: function() { + return state === 2 ? responseHeadersString : null; + }, + + // Caches the header + setRequestHeader: function( name, value ) { + var lname = name.toLowerCase(); + if ( !state ) { + name = requestHeadersNames[ lname ] = requestHeadersNames[ lname ] || name; + requestHeaders[ name ] = value; + } + return this; + }, + + // Overrides response content-type header + overrideMimeType: function( type ) { + if ( !state ) { + s.mimeType = type; + } + return this; + }, + + // Status-dependent callbacks + statusCode: function( map ) { + var code; + if ( map ) { + if ( state < 2 ) { + for ( code in map ) { + // Lazy-add the new callback in a way that preserves old ones + statusCode[ code ] = [ statusCode[ code ], map[ code ] ]; + } + } else { + // Execute the appropriate callbacks + jqXHR.always( map[ jqXHR.status ] ); + } + } + return this; + }, + + // Cancel the request + abort: function( statusText ) { + var finalText = statusText || strAbort; + if ( transport ) { + transport.abort( finalText ); + } + done( 0, finalText ); + return this; + } + }; + + // Attach deferreds + deferred.promise( jqXHR ).complete = completeDeferred.add; + jqXHR.success = jqXHR.done; + jqXHR.error = jqXHR.fail; + + // Remove hash character (#7531: and string promotion) + // Add protocol if not provided (#5866: IE7 issue with protocol-less urls) + // Handle falsy url in the settings object (#10093: consistency with old signature) + // We also use the url parameter if available + s.url = ( ( url || s.url || ajaxLocation ) + "" ).replace( rhash, "" ).replace( rprotocol, ajaxLocParts[ 1 ] + "//" ); + + // Alias method option to type as per ticket #12004 + s.type = options.method || options.type || s.method || s.type; + + // Extract dataTypes list + s.dataTypes = jQuery.trim( s.dataType || "*" ).toLowerCase().match( rnotwhite ) || [ "" ]; + + // A cross-domain request is in order when we have a protocol:host:port mismatch + if ( s.crossDomain == null ) { + parts = rurl.exec( s.url.toLowerCase() ); + s.crossDomain = !!( parts && + ( parts[ 1 ] !== ajaxLocParts[ 1 ] || parts[ 2 ] !== ajaxLocParts[ 2 ] || + ( parts[ 3 ] || ( parts[ 1 ] === "http:" ? "80" : "443" ) ) !== + ( ajaxLocParts[ 3 ] || ( ajaxLocParts[ 1 ] === "http:" ? "80" : "443" ) ) ) + ); + } + + // Convert data if not already a string + if ( s.data && s.processData && typeof s.data !== "string" ) { + s.data = jQuery.param( s.data, s.traditional ); + } + + // Apply prefilters + inspectPrefiltersOrTransports( prefilters, s, options, jqXHR ); + + // If request was aborted inside a prefilter, stop there + if ( state === 2 ) { + return jqXHR; + } + + // We can fire global events as of now if asked to + fireGlobals = s.global; + + // Watch for a new set of requests + if ( fireGlobals && jQuery.active++ === 0 ) { + jQuery.event.trigger("ajaxStart"); + } + + // Uppercase the type + s.type = s.type.toUpperCase(); + + // Determine if request has content + s.hasContent = !rnoContent.test( s.type ); + + // Save the URL in case we're toying with the If-Modified-Since + // and/or If-None-Match header later on + cacheURL = s.url; + + // More options handling for requests with no content + if ( !s.hasContent ) { + + // If data is available, append data to url + if ( s.data ) { + cacheURL = ( s.url += ( rquery.test( cacheURL ) ? "&" : "?" ) + s.data ); + // #9682: remove data so that it's not used in an eventual retry + delete s.data; + } + + // Add anti-cache in url if needed + if ( s.cache === false ) { + s.url = rts.test( cacheURL ) ? + + // If there is already a '_' parameter, set its value + cacheURL.replace( rts, "$1_=" + nonce++ ) : + + // Otherwise add one to the end + cacheURL + ( rquery.test( cacheURL ) ? "&" : "?" ) + "_=" + nonce++; + } + } + + // Set the If-Modified-Since and/or If-None-Match header, if in ifModified mode. + if ( s.ifModified ) { + if ( jQuery.lastModified[ cacheURL ] ) { + jqXHR.setRequestHeader( "If-Modified-Since", jQuery.lastModified[ cacheURL ] ); + } + if ( jQuery.etag[ cacheURL ] ) { + jqXHR.setRequestHeader( "If-None-Match", jQuery.etag[ cacheURL ] ); + } + } + + // Set the correct header, if data is being sent + if ( s.data && s.hasContent && s.contentType !== false || options.contentType ) { + jqXHR.setRequestHeader( "Content-Type", s.contentType ); + } + + // Set the Accepts header for the server, depending on the dataType + jqXHR.setRequestHeader( + "Accept", + s.dataTypes[ 0 ] && s.accepts[ s.dataTypes[0] ] ? + s.accepts[ s.dataTypes[0] ] + ( s.dataTypes[ 0 ] !== "*" ? ", " + allTypes + "; q=0.01" : "" ) : + s.accepts[ "*" ] + ); + + // Check for headers option + for ( i in s.headers ) { + jqXHR.setRequestHeader( i, s.headers[ i ] ); + } + + // Allow custom headers/mimetypes and early abort + if ( s.beforeSend && ( s.beforeSend.call( callbackContext, jqXHR, s ) === false || state === 2 ) ) { + // Abort if not done already and return + return jqXHR.abort(); + } + + // aborting is no longer a cancellation + strAbort = "abort"; + + // Install callbacks on deferreds + for ( i in { success: 1, error: 1, complete: 1 } ) { + jqXHR[ i ]( s[ i ] ); + } + + // Get transport + transport = inspectPrefiltersOrTransports( transports, s, options, jqXHR ); + + // If no transport, we auto-abort + if ( !transport ) { + done( -1, "No Transport" ); + } else { + jqXHR.readyState = 1; + + // Send global event + if ( fireGlobals ) { + globalEventContext.trigger( "ajaxSend", [ jqXHR, s ] ); + } + // Timeout + if ( s.async && s.timeout > 0 ) { + timeoutTimer = setTimeout(function() { + jqXHR.abort("timeout"); + }, s.timeout ); + } + + try { + state = 1; + transport.send( requestHeaders, done ); + } catch ( e ) { + // Propagate exception as error if not done + if ( state < 2 ) { + done( -1, e ); + // Simply rethrow otherwise + } else { + throw e; + } + } + } + + // Callback for when everything is done + function done( status, nativeStatusText, responses, headers ) { + var isSuccess, success, error, response, modified, + statusText = nativeStatusText; + + // Called once + if ( state === 2 ) { + return; + } + + // State is "done" now + state = 2; + + // Clear timeout if it exists + if ( timeoutTimer ) { + clearTimeout( timeoutTimer ); + } + + // Dereference transport for early garbage collection + // (no matter how long the jqXHR object will be used) + transport = undefined; + + // Cache response headers + responseHeadersString = headers || ""; + + // Set readyState + jqXHR.readyState = status > 0 ? 4 : 0; + + // Determine if successful + isSuccess = status >= 200 && status < 300 || status === 304; + + // Get response data + if ( responses ) { + response = ajaxHandleResponses( s, jqXHR, responses ); + } + + // Convert no matter what (that way responseXXX fields are always set) + response = ajaxConvert( s, response, jqXHR, isSuccess ); + + // If successful, handle type chaining + if ( isSuccess ) { + + // Set the If-Modified-Since and/or If-None-Match header, if in ifModified mode. + if ( s.ifModified ) { + modified = jqXHR.getResponseHeader("Last-Modified"); + if ( modified ) { + jQuery.lastModified[ cacheURL ] = modified; + } + modified = jqXHR.getResponseHeader("etag"); + if ( modified ) { + jQuery.etag[ cacheURL ] = modified; + } + } + + // if no content + if ( status === 204 || s.type === "HEAD" ) { + statusText = "nocontent"; + + // if not modified + } else if ( status === 304 ) { + statusText = "notmodified"; + + // If we have data, let's convert it + } else { + statusText = response.state; + success = response.data; + error = response.error; + isSuccess = !error; + } + } else { + // We extract error from statusText + // then normalize statusText and status for non-aborts + error = statusText; + if ( status || !statusText ) { + statusText = "error"; + if ( status < 0 ) { + status = 0; + } + } + } + + // Set data for the fake xhr object + jqXHR.status = status; + jqXHR.statusText = ( nativeStatusText || statusText ) + ""; + + // Success/Error + if ( isSuccess ) { + deferred.resolveWith( callbackContext, [ success, statusText, jqXHR ] ); + } else { + deferred.rejectWith( callbackContext, [ jqXHR, statusText, error ] ); + } + + // Status-dependent callbacks + jqXHR.statusCode( statusCode ); + statusCode = undefined; + + if ( fireGlobals ) { + globalEventContext.trigger( isSuccess ? "ajaxSuccess" : "ajaxError", + [ jqXHR, s, isSuccess ? success : error ] ); + } + + // Complete + completeDeferred.fireWith( callbackContext, [ jqXHR, statusText ] ); + + if ( fireGlobals ) { + globalEventContext.trigger( "ajaxComplete", [ jqXHR, s ] ); + // Handle the global AJAX counter + if ( !( --jQuery.active ) ) { + jQuery.event.trigger("ajaxStop"); + } + } + } + + return jqXHR; + }, + + getJSON: function( url, data, callback ) { + return jQuery.get( url, data, callback, "json" ); + }, + + getScript: function( url, callback ) { + return jQuery.get( url, undefined, callback, "script" ); + } +}); + +jQuery.each( [ "get", "post" ], function( i, method ) { + jQuery[ method ] = function( url, data, callback, type ) { + // shift arguments if data argument was omitted + if ( jQuery.isFunction( data ) ) { + type = type || callback; + callback = data; + data = undefined; + } + + return jQuery.ajax({ + url: url, + type: method, + dataType: type, + data: data, + success: callback + }); + }; +}); + +// Attach a bunch of functions for handling common AJAX events +jQuery.each( [ "ajaxStart", "ajaxStop", "ajaxComplete", "ajaxError", "ajaxSuccess", "ajaxSend" ], function( i, type ) { + jQuery.fn[ type ] = function( fn ) { + return this.on( type, fn ); + }; +}); + + +jQuery._evalUrl = function( url ) { + return jQuery.ajax({ + url: url, + type: "GET", + dataType: "script", + async: false, + global: false, + "throws": true + }); +}; + + +jQuery.fn.extend({ + wrapAll: function( html ) { + if ( jQuery.isFunction( html ) ) { + return this.each(function(i) { + jQuery(this).wrapAll( html.call(this, i) ); + }); + } + + if ( this[0] ) { + // The elements to wrap the target around + var wrap = jQuery( html, this[0].ownerDocument ).eq(0).clone(true); + + if ( this[0].parentNode ) { + wrap.insertBefore( this[0] ); + } + + wrap.map(function() { + var elem = this; + + while ( elem.firstChild && elem.firstChild.nodeType === 1 ) { + elem = elem.firstChild; + } + + return elem; + }).append( this ); + } + + return this; + }, + + wrapInner: function( html ) { + if ( jQuery.isFunction( html ) ) { + return this.each(function(i) { + jQuery(this).wrapInner( html.call(this, i) ); + }); + } + + return this.each(function() { + var self = jQuery( this ), + contents = self.contents(); + + if ( contents.length ) { + contents.wrapAll( html ); + + } else { + self.append( html ); + } + }); + }, + + wrap: function( html ) { + var isFunction = jQuery.isFunction( html ); + + return this.each(function(i) { + jQuery( this ).wrapAll( isFunction ? html.call(this, i) : html ); + }); + }, + + unwrap: function() { + return this.parent().each(function() { + if ( !jQuery.nodeName( this, "body" ) ) { + jQuery( this ).replaceWith( this.childNodes ); + } + }).end(); + } +}); + + +jQuery.expr.filters.hidden = function( elem ) { + // Support: Opera <= 12.12 + // Opera reports offsetWidths and offsetHeights less than zero on some elements + return elem.offsetWidth <= 0 && elem.offsetHeight <= 0 || + (!support.reliableHiddenOffsets() && + ((elem.style && elem.style.display) || jQuery.css( elem, "display" )) === "none"); +}; + +jQuery.expr.filters.visible = function( elem ) { + return !jQuery.expr.filters.hidden( elem ); +}; + + + + +var r20 = /%20/g, + rbracket = /\[\]$/, + rCRLF = /\r?\n/g, + rsubmitterTypes = /^(?:submit|button|image|reset|file)$/i, + rsubmittable = /^(?:input|select|textarea|keygen)/i; + +function buildParams( prefix, obj, traditional, add ) { + var name; + + if ( jQuery.isArray( obj ) ) { + // Serialize array item. + jQuery.each( obj, function( i, v ) { + if ( traditional || rbracket.test( prefix ) ) { + // Treat each array item as a scalar. + add( prefix, v ); + + } else { + // Item is non-scalar (array or object), encode its numeric index. + buildParams( prefix + "[" + ( typeof v === "object" ? i : "" ) + "]", v, traditional, add ); + } + }); + + } else if ( !traditional && jQuery.type( obj ) === "object" ) { + // Serialize object item. + for ( name in obj ) { + buildParams( prefix + "[" + name + "]", obj[ name ], traditional, add ); + } + + } else { + // Serialize scalar item. + add( prefix, obj ); + } +} + +// Serialize an array of form elements or a set of +// key/values into a query string +jQuery.param = function( a, traditional ) { + var prefix, + s = [], + add = function( key, value ) { + // If value is a function, invoke it and return its value + value = jQuery.isFunction( value ) ? value() : ( value == null ? "" : value ); + s[ s.length ] = encodeURIComponent( key ) + "=" + encodeURIComponent( value ); + }; + + // Set traditional to true for jQuery <= 1.3.2 behavior. + if ( traditional === undefined ) { + traditional = jQuery.ajaxSettings && jQuery.ajaxSettings.traditional; + } + + // If an array was passed in, assume that it is an array of form elements. + if ( jQuery.isArray( a ) || ( a.jquery && !jQuery.isPlainObject( a ) ) ) { + // Serialize the form elements + jQuery.each( a, function() { + add( this.name, this.value ); + }); + + } else { + // If traditional, encode the "old" way (the way 1.3.2 or older + // did it), otherwise encode params recursively. + for ( prefix in a ) { + buildParams( prefix, a[ prefix ], traditional, add ); + } + } + + // Return the resulting serialization + return s.join( "&" ).replace( r20, "+" ); +}; + +jQuery.fn.extend({ + serialize: function() { + return jQuery.param( this.serializeArray() ); + }, + serializeArray: function() { + return this.map(function() { + // Can add propHook for "elements" to filter or add form elements + var elements = jQuery.prop( this, "elements" ); + return elements ? jQuery.makeArray( elements ) : this; + }) + .filter(function() { + var type = this.type; + // Use .is(":disabled") so that fieldset[disabled] works + return this.name && !jQuery( this ).is( ":disabled" ) && + rsubmittable.test( this.nodeName ) && !rsubmitterTypes.test( type ) && + ( this.checked || !rcheckableType.test( type ) ); + }) + .map(function( i, elem ) { + var val = jQuery( this ).val(); + + return val == null ? + null : + jQuery.isArray( val ) ? + jQuery.map( val, function( val ) { + return { name: elem.name, value: val.replace( rCRLF, "\r\n" ) }; + }) : + { name: elem.name, value: val.replace( rCRLF, "\r\n" ) }; + }).get(); + } +}); + + +// Create the request object +// (This is still attached to ajaxSettings for backward compatibility) +jQuery.ajaxSettings.xhr = window.ActiveXObject !== undefined ? + // Support: IE6+ + function() { + + // XHR cannot access local files, always use ActiveX for that case + return !this.isLocal && + + // Support: IE7-8 + // oldIE XHR does not support non-RFC2616 methods (#13240) + // See http://msdn.microsoft.com/en-us/library/ie/ms536648(v=vs.85).aspx + // and http://www.w3.org/Protocols/rfc2616/rfc2616-sec9.html#sec9 + // Although this check for six methods instead of eight + // since IE also does not support "trace" and "connect" + /^(get|post|head|put|delete|options)$/i.test( this.type ) && + + createStandardXHR() || createActiveXHR(); + } : + // For all other browsers, use the standard XMLHttpRequest object + createStandardXHR; + +var xhrId = 0, + xhrCallbacks = {}, + xhrSupported = jQuery.ajaxSettings.xhr(); + +// Support: IE<10 +// Open requests must be manually aborted on unload (#5280) +if ( window.ActiveXObject ) { + jQuery( window ).on( "unload", function() { + for ( var key in xhrCallbacks ) { + xhrCallbacks[ key ]( undefined, true ); + } + }); +} + +// Determine support properties +support.cors = !!xhrSupported && ( "withCredentials" in xhrSupported ); +xhrSupported = support.ajax = !!xhrSupported; + +// Create transport if the browser can provide an xhr +if ( xhrSupported ) { + + jQuery.ajaxTransport(function( options ) { + // Cross domain only allowed if supported through XMLHttpRequest + if ( !options.crossDomain || support.cors ) { + + var callback; + + return { + send: function( headers, complete ) { + var i, + xhr = options.xhr(), + id = ++xhrId; + + // Open the socket + xhr.open( options.type, options.url, options.async, options.username, options.password ); + + // Apply custom fields if provided + if ( options.xhrFields ) { + for ( i in options.xhrFields ) { + xhr[ i ] = options.xhrFields[ i ]; + } + } + + // Override mime type if needed + if ( options.mimeType && xhr.overrideMimeType ) { + xhr.overrideMimeType( options.mimeType ); + } + + // X-Requested-With header + // For cross-domain requests, seeing as conditions for a preflight are + // akin to a jigsaw puzzle, we simply never set it to be sure. + // (it can always be set on a per-request basis or even using ajaxSetup) + // For same-domain requests, won't change header if already provided. + if ( !options.crossDomain && !headers["X-Requested-With"] ) { + headers["X-Requested-With"] = "XMLHttpRequest"; + } + + // Set headers + for ( i in headers ) { + // Support: IE<9 + // IE's ActiveXObject throws a 'Type Mismatch' exception when setting + // request header to a null-value. + // + // To keep consistent with other XHR implementations, cast the value + // to string and ignore `undefined`. + if ( headers[ i ] !== undefined ) { + xhr.setRequestHeader( i, headers[ i ] + "" ); + } + } + + // Do send the request + // This may raise an exception which is actually + // handled in jQuery.ajax (so no try/catch here) + xhr.send( ( options.hasContent && options.data ) || null ); + + // Listener + callback = function( _, isAbort ) { + var status, statusText, responses; + + // Was never called and is aborted or complete + if ( callback && ( isAbort || xhr.readyState === 4 ) ) { + // Clean up + delete xhrCallbacks[ id ]; + callback = undefined; + xhr.onreadystatechange = jQuery.noop; + + // Abort manually if needed + if ( isAbort ) { + if ( xhr.readyState !== 4 ) { + xhr.abort(); + } + } else { + responses = {}; + status = xhr.status; + + // Support: IE<10 + // Accessing binary-data responseText throws an exception + // (#11426) + if ( typeof xhr.responseText === "string" ) { + responses.text = xhr.responseText; + } + + // Firefox throws an exception when accessing + // statusText for faulty cross-domain requests + try { + statusText = xhr.statusText; + } catch( e ) { + // We normalize with Webkit giving an empty statusText + statusText = ""; + } + + // Filter status for non standard behaviors + + // If the request is local and we have data: assume a success + // (success with no data won't get notified, that's the best we + // can do given current implementations) + if ( !status && options.isLocal && !options.crossDomain ) { + status = responses.text ? 200 : 404; + // IE - #1450: sometimes returns 1223 when it should be 204 + } else if ( status === 1223 ) { + status = 204; + } + } + } + + // Call complete if needed + if ( responses ) { + complete( status, statusText, responses, xhr.getAllResponseHeaders() ); + } + }; + + if ( !options.async ) { + // if we're in sync mode we fire the callback + callback(); + } else if ( xhr.readyState === 4 ) { + // (IE6 & IE7) if it's in cache and has been + // retrieved directly we need to fire the callback + setTimeout( callback ); + } else { + // Add to the list of active xhr callbacks + xhr.onreadystatechange = xhrCallbacks[ id ] = callback; + } + }, + + abort: function() { + if ( callback ) { + callback( undefined, true ); + } + } + }; + } + }); +} + +// Functions to create xhrs +function createStandardXHR() { + try { + return new window.XMLHttpRequest(); + } catch( e ) {} +} + +function createActiveXHR() { + try { + return new window.ActiveXObject( "Microsoft.XMLHTTP" ); + } catch( e ) {} +} + + + + +// Install script dataType +jQuery.ajaxSetup({ + accepts: { + script: "text/javascript, application/javascript, application/ecmascript, application/x-ecmascript" + }, + contents: { + script: /(?:java|ecma)script/ + }, + converters: { + "text script": function( text ) { + jQuery.globalEval( text ); + return text; + } + } +}); + +// Handle cache's special case and global +jQuery.ajaxPrefilter( "script", function( s ) { + if ( s.cache === undefined ) { + s.cache = false; + } + if ( s.crossDomain ) { + s.type = "GET"; + s.global = false; + } +}); + +// Bind script tag hack transport +jQuery.ajaxTransport( "script", function(s) { + + // This transport only deals with cross domain requests + if ( s.crossDomain ) { + + var script, + head = document.head || jQuery("head")[0] || document.documentElement; + + return { + + send: function( _, callback ) { + + script = document.createElement("script"); + + script.async = true; + + if ( s.scriptCharset ) { + script.charset = s.scriptCharset; + } + + script.src = s.url; + + // Attach handlers for all browsers + script.onload = script.onreadystatechange = function( _, isAbort ) { + + if ( isAbort || !script.readyState || /loaded|complete/.test( script.readyState ) ) { + + // Handle memory leak in IE + script.onload = script.onreadystatechange = null; + + // Remove the script + if ( script.parentNode ) { + script.parentNode.removeChild( script ); + } + + // Dereference the script + script = null; + + // Callback if not abort + if ( !isAbort ) { + callback( 200, "success" ); + } + } + }; + + // Circumvent IE6 bugs with base elements (#2709 and #4378) by prepending + // Use native DOM manipulation to avoid our domManip AJAX trickery + head.insertBefore( script, head.firstChild ); + }, + + abort: function() { + if ( script ) { + script.onload( undefined, true ); + } + } + }; + } +}); + + + + +var oldCallbacks = [], + rjsonp = /(=)\?(?=&|$)|\?\?/; + +// Default jsonp settings +jQuery.ajaxSetup({ + jsonp: "callback", + jsonpCallback: function() { + var callback = oldCallbacks.pop() || ( jQuery.expando + "_" + ( nonce++ ) ); + this[ callback ] = true; + return callback; + } +}); + +// Detect, normalize options and install callbacks for jsonp requests +jQuery.ajaxPrefilter( "json jsonp", function( s, originalSettings, jqXHR ) { + + var callbackName, overwritten, responseContainer, + jsonProp = s.jsonp !== false && ( rjsonp.test( s.url ) ? + "url" : + typeof s.data === "string" && !( s.contentType || "" ).indexOf("application/x-www-form-urlencoded") && rjsonp.test( s.data ) && "data" + ); + + // Handle iff the expected data type is "jsonp" or we have a parameter to set + if ( jsonProp || s.dataTypes[ 0 ] === "jsonp" ) { + + // Get callback name, remembering preexisting value associated with it + callbackName = s.jsonpCallback = jQuery.isFunction( s.jsonpCallback ) ? + s.jsonpCallback() : + s.jsonpCallback; + + // Insert callback into url or form data + if ( jsonProp ) { + s[ jsonProp ] = s[ jsonProp ].replace( rjsonp, "$1" + callbackName ); + } else if ( s.jsonp !== false ) { + s.url += ( rquery.test( s.url ) ? "&" : "?" ) + s.jsonp + "=" + callbackName; + } + + // Use data converter to retrieve json after script execution + s.converters["script json"] = function() { + if ( !responseContainer ) { + jQuery.error( callbackName + " was not called" ); + } + return responseContainer[ 0 ]; + }; + + // force json dataType + s.dataTypes[ 0 ] = "json"; + + // Install callback + overwritten = window[ callbackName ]; + window[ callbackName ] = function() { + responseContainer = arguments; + }; + + // Clean-up function (fires after converters) + jqXHR.always(function() { + // Restore preexisting value + window[ callbackName ] = overwritten; + + // Save back as free + if ( s[ callbackName ] ) { + // make sure that re-using the options doesn't screw things around + s.jsonpCallback = originalSettings.jsonpCallback; + + // save the callback name for future use + oldCallbacks.push( callbackName ); + } + + // Call if it was a function and we have a response + if ( responseContainer && jQuery.isFunction( overwritten ) ) { + overwritten( responseContainer[ 0 ] ); + } + + responseContainer = overwritten = undefined; + }); + + // Delegate to script + return "script"; + } +}); + + + + +// data: string of html +// context (optional): If specified, the fragment will be created in this context, defaults to document +// keepScripts (optional): If true, will include scripts passed in the html string +jQuery.parseHTML = function( data, context, keepScripts ) { + if ( !data || typeof data !== "string" ) { + return null; + } + if ( typeof context === "boolean" ) { + keepScripts = context; + context = false; + } + context = context || document; + + var parsed = rsingleTag.exec( data ), + scripts = !keepScripts && []; + + // Single tag + if ( parsed ) { + return [ context.createElement( parsed[1] ) ]; + } + + parsed = jQuery.buildFragment( [ data ], context, scripts ); + + if ( scripts && scripts.length ) { + jQuery( scripts ).remove(); + } + + return jQuery.merge( [], parsed.childNodes ); +}; + + +// Keep a copy of the old load method +var _load = jQuery.fn.load; + +/** + * Load a url into a page + */ +jQuery.fn.load = function( url, params, callback ) { + if ( typeof url !== "string" && _load ) { + return _load.apply( this, arguments ); + } + + var selector, response, type, + self = this, + off = url.indexOf(" "); + + if ( off >= 0 ) { + selector = jQuery.trim( url.slice( off, url.length ) ); + url = url.slice( 0, off ); + } + + // If it's a function + if ( jQuery.isFunction( params ) ) { + + // We assume that it's the callback + callback = params; + params = undefined; + + // Otherwise, build a param string + } else if ( params && typeof params === "object" ) { + type = "POST"; + } + + // If we have elements to modify, make the request + if ( self.length > 0 ) { + jQuery.ajax({ + url: url, + + // if "type" variable is undefined, then "GET" method will be used + type: type, + dataType: "html", + data: params + }).done(function( responseText ) { + + // Save response for use in complete callback + response = arguments; + + self.html( selector ? + + // If a selector was specified, locate the right elements in a dummy div + // Exclude scripts to avoid IE 'Permission Denied' errors + jQuery("<div>").append( jQuery.parseHTML( responseText ) ).find( selector ) : + + // Otherwise use the full result + responseText ); + + }).complete( callback && function( jqXHR, status ) { + self.each( callback, response || [ jqXHR.responseText, status, jqXHR ] ); + }); + } + + return this; +}; + + + + +jQuery.expr.filters.animated = function( elem ) { + return jQuery.grep(jQuery.timers, function( fn ) { + return elem === fn.elem; + }).length; +}; + + + + + +var docElem = window.document.documentElement; + +/** + * Gets a window from an element + */ +function getWindow( elem ) { + return jQuery.isWindow( elem ) ? + elem : + elem.nodeType === 9 ? + elem.defaultView || elem.parentWindow : + false; +} + +jQuery.offset = { + setOffset: function( elem, options, i ) { + var curPosition, curLeft, curCSSTop, curTop, curOffset, curCSSLeft, calculatePosition, + position = jQuery.css( elem, "position" ), + curElem = jQuery( elem ), + props = {}; + + // set position first, in-case top/left are set even on static elem + if ( position === "static" ) { + elem.style.position = "relative"; + } + + curOffset = curElem.offset(); + curCSSTop = jQuery.css( elem, "top" ); + curCSSLeft = jQuery.css( elem, "left" ); + calculatePosition = ( position === "absolute" || position === "fixed" ) && + jQuery.inArray("auto", [ curCSSTop, curCSSLeft ] ) > -1; + + // need to be able to calculate position if either top or left is auto and position is either absolute or fixed + if ( calculatePosition ) { + curPosition = curElem.position(); + curTop = curPosition.top; + curLeft = curPosition.left; + } else { + curTop = parseFloat( curCSSTop ) || 0; + curLeft = parseFloat( curCSSLeft ) || 0; + } + + if ( jQuery.isFunction( options ) ) { + options = options.call( elem, i, curOffset ); + } + + if ( options.top != null ) { + props.top = ( options.top - curOffset.top ) + curTop; + } + if ( options.left != null ) { + props.left = ( options.left - curOffset.left ) + curLeft; + } + + if ( "using" in options ) { + options.using.call( elem, props ); + } else { + curElem.css( props ); + } + } +}; + +jQuery.fn.extend({ + offset: function( options ) { + if ( arguments.length ) { + return options === undefined ? + this : + this.each(function( i ) { + jQuery.offset.setOffset( this, options, i ); + }); + } + + var docElem, win, + box = { top: 0, left: 0 }, + elem = this[ 0 ], + doc = elem && elem.ownerDocument; + + if ( !doc ) { + return; + } + + docElem = doc.documentElement; + + // Make sure it's not a disconnected DOM node + if ( !jQuery.contains( docElem, elem ) ) { + return box; + } + + // If we don't have gBCR, just use 0,0 rather than error + // BlackBerry 5, iOS 3 (original iPhone) + if ( typeof elem.getBoundingClientRect !== strundefined ) { + box = elem.getBoundingClientRect(); + } + win = getWindow( doc ); + return { + top: box.top + ( win.pageYOffset || docElem.scrollTop ) - ( docElem.clientTop || 0 ), + left: box.left + ( win.pageXOffset || docElem.scrollLeft ) - ( docElem.clientLeft || 0 ) + }; + }, + + position: function() { + if ( !this[ 0 ] ) { + return; + } + + var offsetParent, offset, + parentOffset = { top: 0, left: 0 }, + elem = this[ 0 ]; + + // fixed elements are offset from window (parentOffset = {top:0, left: 0}, because it is its only offset parent + if ( jQuery.css( elem, "position" ) === "fixed" ) { + // we assume that getBoundingClientRect is available when computed position is fixed + offset = elem.getBoundingClientRect(); + } else { + // Get *real* offsetParent + offsetParent = this.offsetParent(); + + // Get correct offsets + offset = this.offset(); + if ( !jQuery.nodeName( offsetParent[ 0 ], "html" ) ) { + parentOffset = offsetParent.offset(); + } + + // Add offsetParent borders + parentOffset.top += jQuery.css( offsetParent[ 0 ], "borderTopWidth", true ); + parentOffset.left += jQuery.css( offsetParent[ 0 ], "borderLeftWidth", true ); + } + + // Subtract parent offsets and element margins + // note: when an element has margin: auto the offsetLeft and marginLeft + // are the same in Safari causing offset.left to incorrectly be 0 + return { + top: offset.top - parentOffset.top - jQuery.css( elem, "marginTop", true ), + left: offset.left - parentOffset.left - jQuery.css( elem, "marginLeft", true) + }; + }, + + offsetParent: function() { + return this.map(function() { + var offsetParent = this.offsetParent || docElem; + + while ( offsetParent && ( !jQuery.nodeName( offsetParent, "html" ) && jQuery.css( offsetParent, "position" ) === "static" ) ) { + offsetParent = offsetParent.offsetParent; + } + return offsetParent || docElem; + }); + } +}); + +// Create scrollLeft and scrollTop methods +jQuery.each( { scrollLeft: "pageXOffset", scrollTop: "pageYOffset" }, function( method, prop ) { + var top = /Y/.test( prop ); + + jQuery.fn[ method ] = function( val ) { + return access( this, function( elem, method, val ) { + var win = getWindow( elem ); + + if ( val === undefined ) { + return win ? (prop in win) ? win[ prop ] : + win.document.documentElement[ method ] : + elem[ method ]; + } + + if ( win ) { + win.scrollTo( + !top ? val : jQuery( win ).scrollLeft(), + top ? val : jQuery( win ).scrollTop() + ); + + } else { + elem[ method ] = val; + } + }, method, val, arguments.length, null ); + }; +}); + +// Add the top/left cssHooks using jQuery.fn.position +// Webkit bug: https://bugs.webkit.org/show_bug.cgi?id=29084 +// getComputedStyle returns percent when specified for top/left/bottom/right +// rather than make the css module depend on the offset module, we just check for it here +jQuery.each( [ "top", "left" ], function( i, prop ) { + jQuery.cssHooks[ prop ] = addGetHookIf( support.pixelPosition, + function( elem, computed ) { + if ( computed ) { + computed = curCSS( elem, prop ); + // if curCSS returns percentage, fallback to offset + return rnumnonpx.test( computed ) ? + jQuery( elem ).position()[ prop ] + "px" : + computed; + } + } + ); +}); + + +// Create innerHeight, innerWidth, height, width, outerHeight and outerWidth methods +jQuery.each( { Height: "height", Width: "width" }, function( name, type ) { + jQuery.each( { padding: "inner" + name, content: type, "": "outer" + name }, function( defaultExtra, funcName ) { + // margin is only for outerHeight, outerWidth + jQuery.fn[ funcName ] = function( margin, value ) { + var chainable = arguments.length && ( defaultExtra || typeof margin !== "boolean" ), + extra = defaultExtra || ( margin === true || value === true ? "margin" : "border" ); + + return access( this, function( elem, type, value ) { + var doc; + + if ( jQuery.isWindow( elem ) ) { + // As of 5/8/2012 this will yield incorrect results for Mobile Safari, but there + // isn't a whole lot we can do. See pull request at this URL for discussion: + // https://github.com/jquery/jquery/pull/764 + return elem.document.documentElement[ "client" + name ]; + } + + // Get document width or height + if ( elem.nodeType === 9 ) { + doc = elem.documentElement; + + // Either scroll[Width/Height] or offset[Width/Height] or client[Width/Height], whichever is greatest + // unfortunately, this causes bug #3838 in IE6/8 only, but there is currently no good, small way to fix it. + return Math.max( + elem.body[ "scroll" + name ], doc[ "scroll" + name ], + elem.body[ "offset" + name ], doc[ "offset" + name ], + doc[ "client" + name ] + ); + } + + return value === undefined ? + // Get width or height on the element, requesting but not forcing parseFloat + jQuery.css( elem, type, extra ) : + + // Set width or height on the element + jQuery.style( elem, type, value, extra ); + }, type, chainable ? margin : undefined, chainable, null ); + }; + }); +}); + + +// The number of elements contained in the matched element set +jQuery.fn.size = function() { + return this.length; +}; + +jQuery.fn.andSelf = jQuery.fn.addBack; + + + + +// Register as a named AMD module, since jQuery can be concatenated with other +// files that may use define, but not via a proper concatenation script that +// understands anonymous AMD modules. A named AMD is safest and most robust +// way to register. Lowercase jquery is used because AMD module names are +// derived from file names, and jQuery is normally delivered in a lowercase +// file name. Do this after creating the global so that if an AMD module wants +// to call noConflict to hide this version of jQuery, it will work. + +// Note that for maximum portability, libraries that are not jQuery should +// declare themselves as anonymous modules, and avoid setting a global if an +// AMD loader is present. jQuery is a special case. For more information, see +// https://github.com/jrburke/requirejs/wiki/Updating-existing-libraries#wiki-anon + +if ( typeof define === "function" && define.amd ) { + define( "jquery", [], function() { + return jQuery; + }); +} + + + + +var + // Map over jQuery in case of overwrite + _jQuery = window.jQuery, + + // Map over the $ in case of overwrite + _$ = window.$; + +jQuery.noConflict = function( deep ) { + if ( window.$ === jQuery ) { + window.$ = _$; + } + + if ( deep && window.jQuery === jQuery ) { + window.jQuery = _jQuery; + } + + return jQuery; +}; + +// Expose jQuery and $ identifiers, even in +// AMD (#7102#comment:10, https://github.com/jquery/jquery/pull/557) +// and CommonJS for browser emulators (#13566) +if ( typeof noGlobal === strundefined ) { + window.jQuery = window.$ = jQuery; +} + + + + +return jQuery; + +})); diff --git a/doc/html/_static/jquery.js b/doc/html/_static/jquery.js index 415ff510..ab28a247 100644 --- a/doc/html/_static/jquery.js +++ b/doc/html/_static/jquery.js @@ -1,10351 +1,4 @@ -/*! - * jQuery JavaScript Library v1.11.3 - * http://jquery.com/ - * - * Includes Sizzle.js - * http://sizzlejs.com/ - * - * Copyright 2005, 2014 jQuery Foundation, Inc. and other contributors - * Released under the MIT license - * http://jquery.org/license - * - * Date: 2015-09-23T12:31Z - */ - -(function( global, factory ) { - - if ( typeof module === "object" && typeof module.exports === "object" ) { - // For CommonJS and CommonJS-like environments where a proper window is present, - // execute the factory and get jQuery - // For environments that do not inherently posses a window with a document - // (such as Node.js), expose a jQuery-making factory as module.exports - // This accentuates the need for the creation of a real window - // e.g. var jQuery = require("jquery")(window); - // See ticket #14549 for more info - module.exports = global.document ? - factory( global, true ) : - function( w ) { - if ( !w.document ) { - throw new Error( "jQuery requires a window with a document" ); - } - return factory( w ); - }; - } else { - factory( global ); - } - -// Pass this if window is not defined yet -}(typeof window !== "undefined" ? window : this, function( window, noGlobal ) { - -// Can't do this because several apps including ASP.NET trace -// the stack via arguments.caller.callee and Firefox dies if -// you try to trace through "use strict" call chains. (#13335) -// Support: Firefox 18+ -// -var deletedIds = []; - -var slice = deletedIds.slice; - -var concat = deletedIds.concat; - -var push = deletedIds.push; - -var indexOf = deletedIds.indexOf; - -var class2type = {}; - -var toString = class2type.toString; - -var hasOwn = class2type.hasOwnProperty; - -var support = {}; - - - -var - version = "1.11.3", - - // Define a local copy of jQuery - jQuery = function( selector, context ) { - // The jQuery object is actually just the init constructor 'enhanced' - // Need init if jQuery is called (just allow error to be thrown if not included) - return new jQuery.fn.init( selector, context ); - }, - - // Support: Android<4.1, IE<9 - // Make sure we trim BOM and NBSP - rtrim = /^[\s\uFEFF\xA0]+|[\s\uFEFF\xA0]+$/g, - - // Matches dashed string for camelizing - rmsPrefix = /^-ms-/, - rdashAlpha = /-([\da-z])/gi, - - // Used by jQuery.camelCase as callback to replace() - fcamelCase = function( all, letter ) { - return letter.toUpperCase(); - }; - -jQuery.fn = jQuery.prototype = { - // The current version of jQuery being used - jquery: version, - - constructor: jQuery, - - // Start with an empty selector - selector: "", - - // The default length of a jQuery object is 0 - length: 0, - - toArray: function() { - return slice.call( this ); - }, - - // Get the Nth element in the matched element set OR - // Get the whole matched element set as a clean array - get: function( num ) { - return num != null ? - - // Return just the one element from the set - ( num < 0 ? this[ num + this.length ] : this[ num ] ) : - - // Return all the elements in a clean array - slice.call( this ); - }, - - // Take an array of elements and push it onto the stack - // (returning the new matched element set) - pushStack: function( elems ) { - - // Build a new jQuery matched element set - var ret = jQuery.merge( this.constructor(), elems ); - - // Add the old object onto the stack (as a reference) - ret.prevObject = this; - ret.context = this.context; - - // Return the newly-formed element set - return ret; - }, - - // Execute a callback for every element in the matched set. - // (You can seed the arguments with an array of args, but this is - // only used internally.) - each: function( callback, args ) { - return jQuery.each( this, callback, args ); - }, - - map: function( callback ) { - return this.pushStack( jQuery.map(this, function( elem, i ) { - return callback.call( elem, i, elem ); - })); - }, - - slice: function() { - return this.pushStack( slice.apply( this, arguments ) ); - }, - - first: function() { - return this.eq( 0 ); - }, - - last: function() { - return this.eq( -1 ); - }, - - eq: function( i ) { - var len = this.length, - j = +i + ( i < 0 ? len : 0 ); - return this.pushStack( j >= 0 && j < len ? [ this[j] ] : [] ); - }, - - end: function() { - return this.prevObject || this.constructor(null); - }, - - // For internal use only. - // Behaves like an Array's method, not like a jQuery method. - push: push, - sort: deletedIds.sort, - splice: deletedIds.splice -}; - -jQuery.extend = jQuery.fn.extend = function() { - var src, copyIsArray, copy, name, options, clone, - target = arguments[0] || {}, - i = 1, - length = arguments.length, - deep = false; - - // Handle a deep copy situation - if ( typeof target === "boolean" ) { - deep = target; - - // skip the boolean and the target - target = arguments[ i ] || {}; - i++; - } - - // Handle case when target is a string or something (possible in deep copy) - if ( typeof target !== "object" && !jQuery.isFunction(target) ) { - target = {}; - } - - // extend jQuery itself if only one argument is passed - if ( i === length ) { - target = this; - i--; - } - - for ( ; i < length; i++ ) { - // Only deal with non-null/undefined values - if ( (options = arguments[ i ]) != null ) { - // Extend the base object - for ( name in options ) { - src = target[ name ]; - copy = options[ name ]; - - // Prevent never-ending loop - if ( target === copy ) { - continue; - } - - // Recurse if we're merging plain objects or arrays - if ( deep && copy && ( jQuery.isPlainObject(copy) || (copyIsArray = jQuery.isArray(copy)) ) ) { - if ( copyIsArray ) { - copyIsArray = false; - clone = src && jQuery.isArray(src) ? src : []; - - } else { - clone = src && jQuery.isPlainObject(src) ? src : {}; - } - - // Never move original objects, clone them - target[ name ] = jQuery.extend( deep, clone, copy ); - - // Don't bring in undefined values - } else if ( copy !== undefined ) { - target[ name ] = copy; - } - } - } - } - - // Return the modified object - return target; -}; - -jQuery.extend({ - // Unique for each copy of jQuery on the page - expando: "jQuery" + ( version + Math.random() ).replace( /\D/g, "" ), - - // Assume jQuery is ready without the ready module - isReady: true, - - error: function( msg ) { - throw new Error( msg ); - }, - - noop: function() {}, - - // See test/unit/core.js for details concerning isFunction. - // Since version 1.3, DOM methods and functions like alert - // aren't supported. They return false on IE (#2968). - isFunction: function( obj ) { - return jQuery.type(obj) === "function"; - }, - - isArray: Array.isArray || function( obj ) { - return jQuery.type(obj) === "array"; - }, - - isWindow: function( obj ) { - /* jshint eqeqeq: false */ - return obj != null && obj == obj.window; - }, - - isNumeric: function( obj ) { - // parseFloat NaNs numeric-cast false positives (null|true|false|"") - // ...but misinterprets leading-number strings, particularly hex literals ("0x...") - // subtraction forces infinities to NaN - // adding 1 corrects loss of precision from parseFloat (#15100) - return !jQuery.isArray( obj ) && (obj - parseFloat( obj ) + 1) >= 0; - }, - - isEmptyObject: function( obj ) { - var name; - for ( name in obj ) { - return false; - } - return true; - }, - - isPlainObject: function( obj ) { - var key; - - // Must be an Object. - // Because of IE, we also have to check the presence of the constructor property. - // Make sure that DOM nodes and window objects don't pass through, as well - if ( !obj || jQuery.type(obj) !== "object" || obj.nodeType || jQuery.isWindow( obj ) ) { - return false; - } - - try { - // Not own constructor property must be Object - if ( obj.constructor && - !hasOwn.call(obj, "constructor") && - !hasOwn.call(obj.constructor.prototype, "isPrototypeOf") ) { - return false; - } - } catch ( e ) { - // IE8,9 Will throw exceptions on certain host objects #9897 - return false; - } - - // Support: IE<9 - // Handle iteration over inherited properties before own properties. - if ( support.ownLast ) { - for ( key in obj ) { - return hasOwn.call( obj, key ); - } - } - - // Own properties are enumerated firstly, so to speed up, - // if last one is own, then all properties are own. - for ( key in obj ) {} - - return key === undefined || hasOwn.call( obj, key ); - }, - - type: function( obj ) { - if ( obj == null ) { - return obj + ""; - } - return typeof obj === "object" || typeof obj === "function" ? - class2type[ toString.call(obj) ] || "object" : - typeof obj; - }, - - // Evaluates a script in a global context - // Workarounds based on findings by Jim Driscoll - // http://weblogs.java.net/blog/driscoll/archive/2009/09/08/eval-javascript-global-context - globalEval: function( data ) { - if ( data && jQuery.trim( data ) ) { - // We use execScript on Internet Explorer - // We use an anonymous function so that context is window - // rather than jQuery in Firefox - ( window.execScript || function( data ) { - window[ "eval" ].call( window, data ); - } )( data ); - } - }, - - // Convert dashed to camelCase; used by the css and data modules - // Microsoft forgot to hump their vendor prefix (#9572) - camelCase: function( string ) { - return string.replace( rmsPrefix, "ms-" ).replace( rdashAlpha, fcamelCase ); - }, - - nodeName: function( elem, name ) { - return elem.nodeName && elem.nodeName.toLowerCase() === name.toLowerCase(); - }, - - // args is for internal usage only - each: function( obj, callback, args ) { - var value, - i = 0, - length = obj.length, - isArray = isArraylike( obj ); - - if ( args ) { - if ( isArray ) { - for ( ; i < length; i++ ) { - value = callback.apply( obj[ i ], args ); - - if ( value === false ) { - break; - } - } - } else { - for ( i in obj ) { - value = callback.apply( obj[ i ], args ); - - if ( value === false ) { - break; - } - } - } - - // A special, fast, case for the most common use of each - } else { - if ( isArray ) { - for ( ; i < length; i++ ) { - value = callback.call( obj[ i ], i, obj[ i ] ); - - if ( value === false ) { - break; - } - } - } else { - for ( i in obj ) { - value = callback.call( obj[ i ], i, obj[ i ] ); - - if ( value === false ) { - break; - } - } - } - } - - return obj; - }, - - // Support: Android<4.1, IE<9 - trim: function( text ) { - return text == null ? - "" : - ( text + "" ).replace( rtrim, "" ); - }, - - // results is for internal usage only - makeArray: function( arr, results ) { - var ret = results || []; - - if ( arr != null ) { - if ( isArraylike( Object(arr) ) ) { - jQuery.merge( ret, - typeof arr === "string" ? - [ arr ] : arr - ); - } else { - push.call( ret, arr ); - } - } - - return ret; - }, - - inArray: function( elem, arr, i ) { - var len; - - if ( arr ) { - if ( indexOf ) { - return indexOf.call( arr, elem, i ); - } - - len = arr.length; - i = i ? i < 0 ? Math.max( 0, len + i ) : i : 0; - - for ( ; i < len; i++ ) { - // Skip accessing in sparse arrays - if ( i in arr && arr[ i ] === elem ) { - return i; - } - } - } - - return -1; - }, - - merge: function( first, second ) { - var len = +second.length, - j = 0, - i = first.length; - - while ( j < len ) { - first[ i++ ] = second[ j++ ]; - } - - // Support: IE<9 - // Workaround casting of .length to NaN on otherwise arraylike objects (e.g., NodeLists) - if ( len !== len ) { - while ( second[j] !== undefined ) { - first[ i++ ] = second[ j++ ]; - } - } - - first.length = i; - - return first; - }, - - grep: function( elems, callback, invert ) { - var callbackInverse, - matches = [], - i = 0, - length = elems.length, - callbackExpect = !invert; - - // Go through the array, only saving the items - // that pass the validator function - for ( ; i < length; i++ ) { - callbackInverse = !callback( elems[ i ], i ); - if ( callbackInverse !== callbackExpect ) { - matches.push( elems[ i ] ); - } - } - - return matches; - }, - - // arg is for internal usage only - map: function( elems, callback, arg ) { - var value, - i = 0, - length = elems.length, - isArray = isArraylike( elems ), - ret = []; - - // Go through the array, translating each of the items to their new values - if ( isArray ) { - for ( ; i < length; i++ ) { - value = callback( elems[ i ], i, arg ); - - if ( value != null ) { - ret.push( value ); - } - } - - // Go through every key on the object, - } else { - for ( i in elems ) { - value = callback( elems[ i ], i, arg ); - - if ( value != null ) { - ret.push( value ); - } - } - } - - // Flatten any nested arrays - return concat.apply( [], ret ); - }, - - // A global GUID counter for objects - guid: 1, - - // Bind a function to a context, optionally partially applying any - // arguments. - proxy: function( fn, context ) { - var args, proxy, tmp; - - if ( typeof context === "string" ) { - tmp = fn[ context ]; - context = fn; - fn = tmp; - } - - // Quick check to determine if target is callable, in the spec - // this throws a TypeError, but we will just return undefined. - if ( !jQuery.isFunction( fn ) ) { - return undefined; - } - - // Simulated bind - args = slice.call( arguments, 2 ); - proxy = function() { - return fn.apply( context || this, args.concat( slice.call( arguments ) ) ); - }; - - // Set the guid of unique handler to the same of original handler, so it can be removed - proxy.guid = fn.guid = fn.guid || jQuery.guid++; - - return proxy; - }, - - now: function() { - return +( new Date() ); - }, - - // jQuery.support is not used in Core but other projects attach their - // properties to it so it needs to exist. - support: support -}); - -// Populate the class2type map -jQuery.each("Boolean Number String Function Array Date RegExp Object Error".split(" "), function(i, name) { - class2type[ "[object " + name + "]" ] = name.toLowerCase(); -}); - -function isArraylike( obj ) { - - // Support: iOS 8.2 (not reproducible in simulator) - // `in` check used to prevent JIT error (gh-2145) - // hasOwn isn't used here due to false negatives - // regarding Nodelist length in IE - var length = "length" in obj && obj.length, - type = jQuery.type( obj ); - - if ( type === "function" || jQuery.isWindow( obj ) ) { - return false; - } - - if ( obj.nodeType === 1 && length ) { - return true; - } - - return type === "array" || length === 0 || - typeof length === "number" && length > 0 && ( length - 1 ) in obj; -} -var Sizzle = -/*! - * Sizzle CSS Selector Engine v2.2.0-pre - * http://sizzlejs.com/ - * - * Copyright 2008, 2014 jQuery Foundation, Inc. and other contributors - * Released under the MIT license - * http://jquery.org/license - * - * Date: 2014-12-16 - */ -(function( window ) { - -var i, - support, - Expr, - getText, - isXML, - tokenize, - compile, - select, - outermostContext, - sortInput, - hasDuplicate, - - // Local document vars - setDocument, - document, - docElem, - documentIsHTML, - rbuggyQSA, - rbuggyMatches, - matches, - contains, - - // Instance-specific data - expando = "sizzle" + 1 * new Date(), - preferredDoc = window.document, - dirruns = 0, - done = 0, - classCache = createCache(), - tokenCache = createCache(), - compilerCache = createCache(), - sortOrder = function( a, b ) { - if ( a === b ) { - hasDuplicate = true; - } - return 0; - }, - - // General-purpose constants - MAX_NEGATIVE = 1 << 31, - - // Instance methods - hasOwn = ({}).hasOwnProperty, - arr = [], - pop = arr.pop, - push_native = arr.push, - push = arr.push, - slice = arr.slice, - // Use a stripped-down indexOf as it's faster than native - // http://jsperf.com/thor-indexof-vs-for/5 - indexOf = function( list, elem ) { - var i = 0, - len = list.length; - for ( ; i < len; i++ ) { - if ( list[i] === elem ) { - return i; - } - } - return -1; - }, - - booleans = "checked|selected|async|autofocus|autoplay|controls|defer|disabled|hidden|ismap|loop|multiple|open|readonly|required|scoped", - - // Regular expressions - - // Whitespace characters http://www.w3.org/TR/css3-selectors/#whitespace - whitespace = "[\\x20\\t\\r\\n\\f]", - // http://www.w3.org/TR/css3-syntax/#characters - characterEncoding = "(?:\\\\.|[\\w-]|[^\\x00-\\xa0])+", - - // Loosely modeled on CSS identifier characters - // An unquoted value should be a CSS identifier http://www.w3.org/TR/css3-selectors/#attribute-selectors - // Proper syntax: http://www.w3.org/TR/CSS21/syndata.html#value-def-identifier - identifier = characterEncoding.replace( "w", "w#" ), - - // Attribute selectors: http://www.w3.org/TR/selectors/#attribute-selectors - attributes = "\\[" + whitespace + "*(" + characterEncoding + ")(?:" + whitespace + - // Operator (capture 2) - "*([*^$|!~]?=)" + whitespace + - // "Attribute values must be CSS identifiers [capture 5] or strings [capture 3 or capture 4]" - "*(?:'((?:\\\\.|[^\\\\'])*)'|\"((?:\\\\.|[^\\\\\"])*)\"|(" + identifier + "))|)" + whitespace + - "*\\]", - - pseudos = ":(" + characterEncoding + ")(?:\\((" + - // To reduce the number of selectors needing tokenize in the preFilter, prefer arguments: - // 1. quoted (capture 3; capture 4 or capture 5) - "('((?:\\\\.|[^\\\\'])*)'|\"((?:\\\\.|[^\\\\\"])*)\")|" + - // 2. simple (capture 6) - "((?:\\\\.|[^\\\\()[\\]]|" + attributes + ")*)|" + - // 3. anything else (capture 2) - ".*" + - ")\\)|)", - - // Leading and non-escaped trailing whitespace, capturing some non-whitespace characters preceding the latter - rwhitespace = new RegExp( whitespace + "+", "g" ), - rtrim = new RegExp( "^" + whitespace + "+|((?:^|[^\\\\])(?:\\\\.)*)" + whitespace + "+$", "g" ), - - rcomma = new RegExp( "^" + whitespace + "*," + whitespace + "*" ), - rcombinators = new RegExp( "^" + whitespace + "*([>+~]|" + whitespace + ")" + whitespace + "*" ), - - rattributeQuotes = new RegExp( "=" + whitespace + "*([^\\]'\"]*?)" + whitespace + "*\\]", "g" ), - - rpseudo = new RegExp( pseudos ), - ridentifier = new RegExp( "^" + identifier + "$" ), - - matchExpr = { - "ID": new RegExp( "^#(" + characterEncoding + ")" ), - "CLASS": new RegExp( "^\\.(" + characterEncoding + ")" ), - "TAG": new RegExp( "^(" + characterEncoding.replace( "w", "w*" ) + ")" ), - "ATTR": new RegExp( "^" + attributes ), - "PSEUDO": new RegExp( "^" + pseudos ), - "CHILD": new RegExp( "^:(only|first|last|nth|nth-last)-(child|of-type)(?:\\(" + whitespace + - "*(even|odd|(([+-]|)(\\d*)n|)" + whitespace + "*(?:([+-]|)" + whitespace + - "*(\\d+)|))" + whitespace + "*\\)|)", "i" ), - "bool": new RegExp( "^(?:" + booleans + ")$", "i" ), - // For use in libraries implementing .is() - // We use this for POS matching in `select` - "needsContext": new RegExp( "^" + whitespace + "*[>+~]|:(even|odd|eq|gt|lt|nth|first|last)(?:\\(" + - whitespace + "*((?:-\\d)?\\d*)" + whitespace + "*\\)|)(?=[^-]|$)", "i" ) - }, - - rinputs = /^(?:input|select|textarea|button)$/i, - rheader = /^h\d$/i, - - rnative = /^[^{]+\{\s*\[native \w/, - - // Easily-parseable/retrievable ID or TAG or CLASS selectors - rquickExpr = /^(?:#([\w-]+)|(\w+)|\.([\w-]+))$/, - - rsibling = /[+~]/, - rescape = /'|\\/g, - - // CSS escapes http://www.w3.org/TR/CSS21/syndata.html#escaped-characters - runescape = new RegExp( "\\\\([\\da-f]{1,6}" + whitespace + "?|(" + whitespace + ")|.)", "ig" ), - funescape = function( _, escaped, escapedWhitespace ) { - var high = "0x" + escaped - 0x10000; - // NaN means non-codepoint - // Support: Firefox<24 - // Workaround erroneous numeric interpretation of +"0x" - return high !== high || escapedWhitespace ? - escaped : - high < 0 ? - // BMP codepoint - String.fromCharCode( high + 0x10000 ) : - // Supplemental Plane codepoint (surrogate pair) - String.fromCharCode( high >> 10 | 0xD800, high & 0x3FF | 0xDC00 ); - }, - - // Used for iframes - // See setDocument() - // Removing the function wrapper causes a "Permission Denied" - // error in IE - unloadHandler = function() { - setDocument(); - }; - -// Optimize for push.apply( _, NodeList ) -try { - push.apply( - (arr = slice.call( preferredDoc.childNodes )), - preferredDoc.childNodes - ); - // Support: Android<4.0 - // Detect silently failing push.apply - arr[ preferredDoc.childNodes.length ].nodeType; -} catch ( e ) { - push = { apply: arr.length ? - - // Leverage slice if possible - function( target, els ) { - push_native.apply( target, slice.call(els) ); - } : - - // Support: IE<9 - // Otherwise append directly - function( target, els ) { - var j = target.length, - i = 0; - // Can't trust NodeList.length - while ( (target[j++] = els[i++]) ) {} - target.length = j - 1; - } - }; -} - -function Sizzle( selector, context, results, seed ) { - var match, elem, m, nodeType, - // QSA vars - i, groups, old, nid, newContext, newSelector; - - if ( ( context ? context.ownerDocument || context : preferredDoc ) !== document ) { - setDocument( context ); - } - - context = context || document; - results = results || []; - nodeType = context.nodeType; - - if ( typeof selector !== "string" || !selector || - nodeType !== 1 && nodeType !== 9 && nodeType !== 11 ) { - - return results; - } - - if ( !seed && documentIsHTML ) { - - // Try to shortcut find operations when possible (e.g., not under DocumentFragment) - if ( nodeType !== 11 && (match = rquickExpr.exec( selector )) ) { - // Speed-up: Sizzle("#ID") - if ( (m = match[1]) ) { - if ( nodeType === 9 ) { - elem = context.getElementById( m ); - // Check parentNode to catch when Blackberry 4.6 returns - // nodes that are no longer in the document (jQuery #6963) - if ( elem && elem.parentNode ) { - // Handle the case where IE, Opera, and Webkit return items - // by name instead of ID - if ( elem.id === m ) { - results.push( elem ); - return results; - } - } else { - return results; - } - } else { - // Context is not a document - if ( context.ownerDocument && (elem = context.ownerDocument.getElementById( m )) && - contains( context, elem ) && elem.id === m ) { - results.push( elem ); - return results; - } - } - - // Speed-up: Sizzle("TAG") - } else if ( match[2] ) { - push.apply( results, context.getElementsByTagName( selector ) ); - return results; - - // Speed-up: Sizzle(".CLASS") - } else if ( (m = match[3]) && support.getElementsByClassName ) { - push.apply( results, context.getElementsByClassName( m ) ); - return results; - } - } - - // QSA path - if ( support.qsa && (!rbuggyQSA || !rbuggyQSA.test( selector )) ) { - nid = old = expando; - newContext = context; - newSelector = nodeType !== 1 && selector; - - // qSA works strangely on Element-rooted queries - // We can work around this by specifying an extra ID on the root - // and working up from there (Thanks to Andrew Dupont for the technique) - // IE 8 doesn't work on object elements - if ( nodeType === 1 && context.nodeName.toLowerCase() !== "object" ) { - groups = tokenize( selector ); - - if ( (old = context.getAttribute("id")) ) { - nid = old.replace( rescape, "\\$&" ); - } else { - context.setAttribute( "id", nid ); - } - nid = "[id='" + nid + "'] "; - - i = groups.length; - while ( i-- ) { - groups[i] = nid + toSelector( groups[i] ); - } - newContext = rsibling.test( selector ) && testContext( context.parentNode ) || context; - newSelector = groups.join(","); - } - - if ( newSelector ) { - try { - push.apply( results, - newContext.querySelectorAll( newSelector ) - ); - return results; - } catch(qsaError) { - } finally { - if ( !old ) { - context.removeAttribute("id"); - } - } - } - } - } - - // All others - return select( selector.replace( rtrim, "$1" ), context, results, seed ); -} - -/** - * Create key-value caches of limited size - * @returns {Function(string, Object)} Returns the Object data after storing it on itself with - * property name the (space-suffixed) string and (if the cache is larger than Expr.cacheLength) - * deleting the oldest entry - */ -function createCache() { - var keys = []; - - function cache( key, value ) { - // Use (key + " ") to avoid collision with native prototype properties (see Issue #157) - if ( keys.push( key + " " ) > Expr.cacheLength ) { - // Only keep the most recent entries - delete cache[ keys.shift() ]; - } - return (cache[ key + " " ] = value); - } - return cache; -} - -/** - * Mark a function for special use by Sizzle - * @param {Function} fn The function to mark - */ -function markFunction( fn ) { - fn[ expando ] = true; - return fn; -} - -/** - * Support testing using an element - * @param {Function} fn Passed the created div and expects a boolean result - */ -function assert( fn ) { - var div = document.createElement("div"); - - try { - return !!fn( div ); - } catch (e) { - return false; - } finally { - // Remove from its parent by default - if ( div.parentNode ) { - div.parentNode.removeChild( div ); - } - // release memory in IE - div = null; - } -} - -/** - * Adds the same handler for all of the specified attrs - * @param {String} attrs Pipe-separated list of attributes - * @param {Function} handler The method that will be applied - */ -function addHandle( attrs, handler ) { - var arr = attrs.split("|"), - i = attrs.length; - - while ( i-- ) { - Expr.attrHandle[ arr[i] ] = handler; - } -} - -/** - * Checks document order of two siblings - * @param {Element} a - * @param {Element} b - * @returns {Number} Returns less than 0 if a precedes b, greater than 0 if a follows b - */ -function siblingCheck( a, b ) { - var cur = b && a, - diff = cur && a.nodeType === 1 && b.nodeType === 1 && - ( ~b.sourceIndex || MAX_NEGATIVE ) - - ( ~a.sourceIndex || MAX_NEGATIVE ); - - // Use IE sourceIndex if available on both nodes - if ( diff ) { - return diff; - } - - // Check if b follows a - if ( cur ) { - while ( (cur = cur.nextSibling) ) { - if ( cur === b ) { - return -1; - } - } - } - - return a ? 1 : -1; -} - -/** - * Returns a function to use in pseudos for input types - * @param {String} type - */ -function createInputPseudo( type ) { - return function( elem ) { - var name = elem.nodeName.toLowerCase(); - return name === "input" && elem.type === type; - }; -} - -/** - * Returns a function to use in pseudos for buttons - * @param {String} type - */ -function createButtonPseudo( type ) { - return function( elem ) { - var name = elem.nodeName.toLowerCase(); - return (name === "input" || name === "button") && elem.type === type; - }; -} - -/** - * Returns a function to use in pseudos for positionals - * @param {Function} fn - */ -function createPositionalPseudo( fn ) { - return markFunction(function( argument ) { - argument = +argument; - return markFunction(function( seed, matches ) { - var j, - matchIndexes = fn( [], seed.length, argument ), - i = matchIndexes.length; - - // Match elements found at the specified indexes - while ( i-- ) { - if ( seed[ (j = matchIndexes[i]) ] ) { - seed[j] = !(matches[j] = seed[j]); - } - } - }); - }); -} - -/** - * Checks a node for validity as a Sizzle context - * @param {Element|Object=} context - * @returns {Element|Object|Boolean} The input node if acceptable, otherwise a falsy value - */ -function testContext( context ) { - return context && typeof context.getElementsByTagName !== "undefined" && context; -} - -// Expose support vars for convenience -support = Sizzle.support = {}; - -/** - * Detects XML nodes - * @param {Element|Object} elem An element or a document - * @returns {Boolean} True iff elem is a non-HTML XML node - */ -isXML = Sizzle.isXML = function( elem ) { - // documentElement is verified for cases where it doesn't yet exist - // (such as loading iframes in IE - #4833) - var documentElement = elem && (elem.ownerDocument || elem).documentElement; - return documentElement ? documentElement.nodeName !== "HTML" : false; -}; - -/** - * Sets document-related variables once based on the current document - * @param {Element|Object} [doc] An element or document object to use to set the document - * @returns {Object} Returns the current document - */ -setDocument = Sizzle.setDocument = function( node ) { - var hasCompare, parent, - doc = node ? node.ownerDocument || node : preferredDoc; - - // If no document and documentElement is available, return - if ( doc === document || doc.nodeType !== 9 || !doc.documentElement ) { - return document; - } - - // Set our document - document = doc; - docElem = doc.documentElement; - parent = doc.defaultView; - - // Support: IE>8 - // If iframe document is assigned to "document" variable and if iframe has been reloaded, - // IE will throw "permission denied" error when accessing "document" variable, see jQuery #13936 - // IE6-8 do not support the defaultView property so parent will be undefined - if ( parent && parent !== parent.top ) { - // IE11 does not have attachEvent, so all must suffer - if ( parent.addEventListener ) { - parent.addEventListener( "unload", unloadHandler, false ); - } else if ( parent.attachEvent ) { - parent.attachEvent( "onunload", unloadHandler ); - } - } - - /* Support tests - ---------------------------------------------------------------------- */ - documentIsHTML = !isXML( doc ); - - /* Attributes - ---------------------------------------------------------------------- */ - - // Support: IE<8 - // Verify that getAttribute really returns attributes and not properties - // (excepting IE8 booleans) - support.attributes = assert(function( div ) { - div.className = "i"; - return !div.getAttribute("className"); - }); - - /* getElement(s)By* - ---------------------------------------------------------------------- */ - - // Check if getElementsByTagName("*") returns only elements - support.getElementsByTagName = assert(function( div ) { - div.appendChild( doc.createComment("") ); - return !div.getElementsByTagName("*").length; - }); - - // Support: IE<9 - support.getElementsByClassName = rnative.test( doc.getElementsByClassName ); - - // Support: IE<10 - // Check if getElementById returns elements by name - // The broken getElementById methods don't pick up programatically-set names, - // so use a roundabout getElementsByName test - support.getById = assert(function( div ) { - docElem.appendChild( div ).id = expando; - return !doc.getElementsByName || !doc.getElementsByName( expando ).length; - }); - - // ID find and filter - if ( support.getById ) { - Expr.find["ID"] = function( id, context ) { - if ( typeof context.getElementById !== "undefined" && documentIsHTML ) { - var m = context.getElementById( id ); - // Check parentNode to catch when Blackberry 4.6 returns - // nodes that are no longer in the document #6963 - return m && m.parentNode ? [ m ] : []; - } - }; - Expr.filter["ID"] = function( id ) { - var attrId = id.replace( runescape, funescape ); - return function( elem ) { - return elem.getAttribute("id") === attrId; - }; - }; - } else { - // Support: IE6/7 - // getElementById is not reliable as a find shortcut - delete Expr.find["ID"]; - - Expr.filter["ID"] = function( id ) { - var attrId = id.replace( runescape, funescape ); - return function( elem ) { - var node = typeof elem.getAttributeNode !== "undefined" && elem.getAttributeNode("id"); - return node && node.value === attrId; - }; - }; - } - - // Tag - Expr.find["TAG"] = support.getElementsByTagName ? - function( tag, context ) { - if ( typeof context.getElementsByTagName !== "undefined" ) { - return context.getElementsByTagName( tag ); - - // DocumentFragment nodes don't have gEBTN - } else if ( support.qsa ) { - return context.querySelectorAll( tag ); - } - } : - - function( tag, context ) { - var elem, - tmp = [], - i = 0, - // By happy coincidence, a (broken) gEBTN appears on DocumentFragment nodes too - results = context.getElementsByTagName( tag ); - - // Filter out possible comments - if ( tag === "*" ) { - while ( (elem = results[i++]) ) { - if ( elem.nodeType === 1 ) { - tmp.push( elem ); - } - } - - return tmp; - } - return results; - }; - - // Class - Expr.find["CLASS"] = support.getElementsByClassName && function( className, context ) { - if ( documentIsHTML ) { - return context.getElementsByClassName( className ); - } - }; - - /* QSA/matchesSelector - ---------------------------------------------------------------------- */ - - // QSA and matchesSelector support - - // matchesSelector(:active) reports false when true (IE9/Opera 11.5) - rbuggyMatches = []; - - // qSa(:focus) reports false when true (Chrome 21) - // We allow this because of a bug in IE8/9 that throws an error - // whenever `document.activeElement` is accessed on an iframe - // So, we allow :focus to pass through QSA all the time to avoid the IE error - // See http://bugs.jquery.com/ticket/13378 - rbuggyQSA = []; - - if ( (support.qsa = rnative.test( doc.querySelectorAll )) ) { - // Build QSA regex - // Regex strategy adopted from Diego Perini - assert(function( div ) { - // Select is set to empty string on purpose - // This is to test IE's treatment of not explicitly - // setting a boolean content attribute, - // since its presence should be enough - // http://bugs.jquery.com/ticket/12359 - docElem.appendChild( div ).innerHTML = "<a id='" + expando + "'></a>" + - "<select id='" + expando + "-\f]' msallowcapture=''>" + - "<option selected=''></option></select>"; - - // Support: IE8, Opera 11-12.16 - // Nothing should be selected when empty strings follow ^= or $= or *= - // The test attribute must be unknown in Opera but "safe" for WinRT - // http://msdn.microsoft.com/en-us/library/ie/hh465388.aspx#attribute_section - if ( div.querySelectorAll("[msallowcapture^='']").length ) { - rbuggyQSA.push( "[*^$]=" + whitespace + "*(?:''|\"\")" ); - } - - // Support: IE8 - // Boolean attributes and "value" are not treated correctly - if ( !div.querySelectorAll("[selected]").length ) { - rbuggyQSA.push( "\\[" + whitespace + "*(?:value|" + booleans + ")" ); - } - - // Support: Chrome<29, Android<4.2+, Safari<7.0+, iOS<7.0+, PhantomJS<1.9.7+ - if ( !div.querySelectorAll( "[id~=" + expando + "-]" ).length ) { - rbuggyQSA.push("~="); - } - - // Webkit/Opera - :checked should return selected option elements - // http://www.w3.org/TR/2011/REC-css3-selectors-20110929/#checked - // IE8 throws error here and will not see later tests - if ( !div.querySelectorAll(":checked").length ) { - rbuggyQSA.push(":checked"); - } - - // Support: Safari 8+, iOS 8+ - // https://bugs.webkit.org/show_bug.cgi?id=136851 - // In-page `selector#id sibing-combinator selector` fails - if ( !div.querySelectorAll( "a#" + expando + "+*" ).length ) { - rbuggyQSA.push(".#.+[+~]"); - } - }); - - assert(function( div ) { - // Support: Windows 8 Native Apps - // The type and name attributes are restricted during .innerHTML assignment - var input = doc.createElement("input"); - input.setAttribute( "type", "hidden" ); - div.appendChild( input ).setAttribute( "name", "D" ); - - // Support: IE8 - // Enforce case-sensitivity of name attribute - if ( div.querySelectorAll("[name=d]").length ) { - rbuggyQSA.push( "name" + whitespace + "*[*^$|!~]?=" ); - } - - // FF 3.5 - :enabled/:disabled and hidden elements (hidden elements are still enabled) - // IE8 throws error here and will not see later tests - if ( !div.querySelectorAll(":enabled").length ) { - rbuggyQSA.push( ":enabled", ":disabled" ); - } - - // Opera 10-11 does not throw on post-comma invalid pseudos - div.querySelectorAll("*,:x"); - rbuggyQSA.push(",.*:"); - }); - } - - if ( (support.matchesSelector = rnative.test( (matches = docElem.matches || - docElem.webkitMatchesSelector || - docElem.mozMatchesSelector || - docElem.oMatchesSelector || - docElem.msMatchesSelector) )) ) { - - assert(function( div ) { - // Check to see if it's possible to do matchesSelector - // on a disconnected node (IE 9) - support.disconnectedMatch = matches.call( div, "div" ); - - // This should fail with an exception - // Gecko does not error, returns false instead - matches.call( div, "[s!='']:x" ); - rbuggyMatches.push( "!=", pseudos ); - }); - } - - rbuggyQSA = rbuggyQSA.length && new RegExp( rbuggyQSA.join("|") ); - rbuggyMatches = rbuggyMatches.length && new RegExp( rbuggyMatches.join("|") ); - - /* Contains - ---------------------------------------------------------------------- */ - hasCompare = rnative.test( docElem.compareDocumentPosition ); - - // Element contains another - // Purposefully does not implement inclusive descendent - // As in, an element does not contain itself - contains = hasCompare || rnative.test( docElem.contains ) ? - function( a, b ) { - var adown = a.nodeType === 9 ? a.documentElement : a, - bup = b && b.parentNode; - return a === bup || !!( bup && bup.nodeType === 1 && ( - adown.contains ? - adown.contains( bup ) : - a.compareDocumentPosition && a.compareDocumentPosition( bup ) & 16 - )); - } : - function( a, b ) { - if ( b ) { - while ( (b = b.parentNode) ) { - if ( b === a ) { - return true; - } - } - } - return false; - }; - - /* Sorting - ---------------------------------------------------------------------- */ - - // Document order sorting - sortOrder = hasCompare ? - function( a, b ) { - - // Flag for duplicate removal - if ( a === b ) { - hasDuplicate = true; - return 0; - } - - // Sort on method existence if only one input has compareDocumentPosition - var compare = !a.compareDocumentPosition - !b.compareDocumentPosition; - if ( compare ) { - return compare; - } - - // Calculate position if both inputs belong to the same document - compare = ( a.ownerDocument || a ) === ( b.ownerDocument || b ) ? - a.compareDocumentPosition( b ) : - - // Otherwise we know they are disconnected - 1; - - // Disconnected nodes - if ( compare & 1 || - (!support.sortDetached && b.compareDocumentPosition( a ) === compare) ) { - - // Choose the first element that is related to our preferred document - if ( a === doc || a.ownerDocument === preferredDoc && contains(preferredDoc, a) ) { - return -1; - } - if ( b === doc || b.ownerDocument === preferredDoc && contains(preferredDoc, b) ) { - return 1; - } - - // Maintain original order - return sortInput ? - ( indexOf( sortInput, a ) - indexOf( sortInput, b ) ) : - 0; - } - - return compare & 4 ? -1 : 1; - } : - function( a, b ) { - // Exit early if the nodes are identical - if ( a === b ) { - hasDuplicate = true; - return 0; - } - - var cur, - i = 0, - aup = a.parentNode, - bup = b.parentNode, - ap = [ a ], - bp = [ b ]; - - // Parentless nodes are either documents or disconnected - if ( !aup || !bup ) { - return a === doc ? -1 : - b === doc ? 1 : - aup ? -1 : - bup ? 1 : - sortInput ? - ( indexOf( sortInput, a ) - indexOf( sortInput, b ) ) : - 0; - - // If the nodes are siblings, we can do a quick check - } else if ( aup === bup ) { - return siblingCheck( a, b ); - } - - // Otherwise we need full lists of their ancestors for comparison - cur = a; - while ( (cur = cur.parentNode) ) { - ap.unshift( cur ); - } - cur = b; - while ( (cur = cur.parentNode) ) { - bp.unshift( cur ); - } - - // Walk down the tree looking for a discrepancy - while ( ap[i] === bp[i] ) { - i++; - } - - return i ? - // Do a sibling check if the nodes have a common ancestor - siblingCheck( ap[i], bp[i] ) : - - // Otherwise nodes in our document sort first - ap[i] === preferredDoc ? -1 : - bp[i] === preferredDoc ? 1 : - 0; - }; - - return doc; -}; - -Sizzle.matches = function( expr, elements ) { - return Sizzle( expr, null, null, elements ); -}; - -Sizzle.matchesSelector = function( elem, expr ) { - // Set document vars if needed - if ( ( elem.ownerDocument || elem ) !== document ) { - setDocument( elem ); - } - - // Make sure that attribute selectors are quoted - expr = expr.replace( rattributeQuotes, "='$1']" ); - - if ( support.matchesSelector && documentIsHTML && - ( !rbuggyMatches || !rbuggyMatches.test( expr ) ) && - ( !rbuggyQSA || !rbuggyQSA.test( expr ) ) ) { - - try { - var ret = matches.call( elem, expr ); - - // IE 9's matchesSelector returns false on disconnected nodes - if ( ret || support.disconnectedMatch || - // As well, disconnected nodes are said to be in a document - // fragment in IE 9 - elem.document && elem.document.nodeType !== 11 ) { - return ret; - } - } catch (e) {} - } - - return Sizzle( expr, document, null, [ elem ] ).length > 0; -}; - -Sizzle.contains = function( context, elem ) { - // Set document vars if needed - if ( ( context.ownerDocument || context ) !== document ) { - setDocument( context ); - } - return contains( context, elem ); -}; - -Sizzle.attr = function( elem, name ) { - // Set document vars if needed - if ( ( elem.ownerDocument || elem ) !== document ) { - setDocument( elem ); - } - - var fn = Expr.attrHandle[ name.toLowerCase() ], - // Don't get fooled by Object.prototype properties (jQuery #13807) - val = fn && hasOwn.call( Expr.attrHandle, name.toLowerCase() ) ? - fn( elem, name, !documentIsHTML ) : - undefined; - - return val !== undefined ? - val : - support.attributes || !documentIsHTML ? - elem.getAttribute( name ) : - (val = elem.getAttributeNode(name)) && val.specified ? - val.value : - null; -}; - -Sizzle.error = function( msg ) { - throw new Error( "Syntax error, unrecognized expression: " + msg ); -}; - -/** - * Document sorting and removing duplicates - * @param {ArrayLike} results - */ -Sizzle.uniqueSort = function( results ) { - var elem, - duplicates = [], - j = 0, - i = 0; - - // Unless we *know* we can detect duplicates, assume their presence - hasDuplicate = !support.detectDuplicates; - sortInput = !support.sortStable && results.slice( 0 ); - results.sort( sortOrder ); - - if ( hasDuplicate ) { - while ( (elem = results[i++]) ) { - if ( elem === results[ i ] ) { - j = duplicates.push( i ); - } - } - while ( j-- ) { - results.splice( duplicates[ j ], 1 ); - } - } - - // Clear input after sorting to release objects - // See https://github.com/jquery/sizzle/pull/225 - sortInput = null; - - return results; -}; - -/** - * Utility function for retrieving the text value of an array of DOM nodes - * @param {Array|Element} elem - */ -getText = Sizzle.getText = function( elem ) { - var node, - ret = "", - i = 0, - nodeType = elem.nodeType; - - if ( !nodeType ) { - // If no nodeType, this is expected to be an array - while ( (node = elem[i++]) ) { - // Do not traverse comment nodes - ret += getText( node ); - } - } else if ( nodeType === 1 || nodeType === 9 || nodeType === 11 ) { - // Use textContent for elements - // innerText usage removed for consistency of new lines (jQuery #11153) - if ( typeof elem.textContent === "string" ) { - return elem.textContent; - } else { - // Traverse its children - for ( elem = elem.firstChild; elem; elem = elem.nextSibling ) { - ret += getText( elem ); - } - } - } else if ( nodeType === 3 || nodeType === 4 ) { - return elem.nodeValue; - } - // Do not include comment or processing instruction nodes - - return ret; -}; - -Expr = Sizzle.selectors = { - - // Can be adjusted by the user - cacheLength: 50, - - createPseudo: markFunction, - - match: matchExpr, - - attrHandle: {}, - - find: {}, - - relative: { - ">": { dir: "parentNode", first: true }, - " ": { dir: "parentNode" }, - "+": { dir: "previousSibling", first: true }, - "~": { dir: "previousSibling" } - }, - - preFilter: { - "ATTR": function( match ) { - match[1] = match[1].replace( runescape, funescape ); - - // Move the given value to match[3] whether quoted or unquoted - match[3] = ( match[3] || match[4] || match[5] || "" ).replace( runescape, funescape ); - - if ( match[2] === "~=" ) { - match[3] = " " + match[3] + " "; - } - - return match.slice( 0, 4 ); - }, - - "CHILD": function( match ) { - /* matches from matchExpr["CHILD"] - 1 type (only|nth|...) - 2 what (child|of-type) - 3 argument (even|odd|\d*|\d*n([+-]\d+)?|...) - 4 xn-component of xn+y argument ([+-]?\d*n|) - 5 sign of xn-component - 6 x of xn-component - 7 sign of y-component - 8 y of y-component - */ - match[1] = match[1].toLowerCase(); - - if ( match[1].slice( 0, 3 ) === "nth" ) { - // nth-* requires argument - if ( !match[3] ) { - Sizzle.error( match[0] ); - } - - // numeric x and y parameters for Expr.filter.CHILD - // remember that false/true cast respectively to 0/1 - match[4] = +( match[4] ? match[5] + (match[6] || 1) : 2 * ( match[3] === "even" || match[3] === "odd" ) ); - match[5] = +( ( match[7] + match[8] ) || match[3] === "odd" ); - - // other types prohibit arguments - } else if ( match[3] ) { - Sizzle.error( match[0] ); - } - - return match; - }, - - "PSEUDO": function( match ) { - var excess, - unquoted = !match[6] && match[2]; - - if ( matchExpr["CHILD"].test( match[0] ) ) { - return null; - } - - // Accept quoted arguments as-is - if ( match[3] ) { - match[2] = match[4] || match[5] || ""; - - // Strip excess characters from unquoted arguments - } else if ( unquoted && rpseudo.test( unquoted ) && - // Get excess from tokenize (recursively) - (excess = tokenize( unquoted, true )) && - // advance to the next closing parenthesis - (excess = unquoted.indexOf( ")", unquoted.length - excess ) - unquoted.length) ) { - - // excess is a negative index - match[0] = match[0].slice( 0, excess ); - match[2] = unquoted.slice( 0, excess ); - } - - // Return only captures needed by the pseudo filter method (type and argument) - return match.slice( 0, 3 ); - } - }, - - filter: { - - "TAG": function( nodeNameSelector ) { - var nodeName = nodeNameSelector.replace( runescape, funescape ).toLowerCase(); - return nodeNameSelector === "*" ? - function() { return true; } : - function( elem ) { - return elem.nodeName && elem.nodeName.toLowerCase() === nodeName; - }; - }, - - "CLASS": function( className ) { - var pattern = classCache[ className + " " ]; - - return pattern || - (pattern = new RegExp( "(^|" + whitespace + ")" + className + "(" + whitespace + "|$)" )) && - classCache( className, function( elem ) { - return pattern.test( typeof elem.className === "string" && elem.className || typeof elem.getAttribute !== "undefined" && elem.getAttribute("class") || "" ); - }); - }, - - "ATTR": function( name, operator, check ) { - return function( elem ) { - var result = Sizzle.attr( elem, name ); - - if ( result == null ) { - return operator === "!="; - } - if ( !operator ) { - return true; - } - - result += ""; - - return operator === "=" ? result === check : - operator === "!=" ? result !== check : - operator === "^=" ? check && result.indexOf( check ) === 0 : - operator === "*=" ? check && result.indexOf( check ) > -1 : - operator === "$=" ? check && result.slice( -check.length ) === check : - operator === "~=" ? ( " " + result.replace( rwhitespace, " " ) + " " ).indexOf( check ) > -1 : - operator === "|=" ? result === check || result.slice( 0, check.length + 1 ) === check + "-" : - false; - }; - }, - - "CHILD": function( type, what, argument, first, last ) { - var simple = type.slice( 0, 3 ) !== "nth", - forward = type.slice( -4 ) !== "last", - ofType = what === "of-type"; - - return first === 1 && last === 0 ? - - // Shortcut for :nth-*(n) - function( elem ) { - return !!elem.parentNode; - } : - - function( elem, context, xml ) { - var cache, outerCache, node, diff, nodeIndex, start, - dir = simple !== forward ? "nextSibling" : "previousSibling", - parent = elem.parentNode, - name = ofType && elem.nodeName.toLowerCase(), - useCache = !xml && !ofType; - - if ( parent ) { - - // :(first|last|only)-(child|of-type) - if ( simple ) { - while ( dir ) { - node = elem; - while ( (node = node[ dir ]) ) { - if ( ofType ? node.nodeName.toLowerCase() === name : node.nodeType === 1 ) { - return false; - } - } - // Reverse direction for :only-* (if we haven't yet done so) - start = dir = type === "only" && !start && "nextSibling"; - } - return true; - } - - start = [ forward ? parent.firstChild : parent.lastChild ]; - - // non-xml :nth-child(...) stores cache data on `parent` - if ( forward && useCache ) { - // Seek `elem` from a previously-cached index - outerCache = parent[ expando ] || (parent[ expando ] = {}); - cache = outerCache[ type ] || []; - nodeIndex = cache[0] === dirruns && cache[1]; - diff = cache[0] === dirruns && cache[2]; - node = nodeIndex && parent.childNodes[ nodeIndex ]; - - while ( (node = ++nodeIndex && node && node[ dir ] || - - // Fallback to seeking `elem` from the start - (diff = nodeIndex = 0) || start.pop()) ) { - - // When found, cache indexes on `parent` and break - if ( node.nodeType === 1 && ++diff && node === elem ) { - outerCache[ type ] = [ dirruns, nodeIndex, diff ]; - break; - } - } - - // Use previously-cached element index if available - } else if ( useCache && (cache = (elem[ expando ] || (elem[ expando ] = {}))[ type ]) && cache[0] === dirruns ) { - diff = cache[1]; - - // xml :nth-child(...) or :nth-last-child(...) or :nth(-last)?-of-type(...) - } else { - // Use the same loop as above to seek `elem` from the start - while ( (node = ++nodeIndex && node && node[ dir ] || - (diff = nodeIndex = 0) || start.pop()) ) { - - if ( ( ofType ? node.nodeName.toLowerCase() === name : node.nodeType === 1 ) && ++diff ) { - // Cache the index of each encountered element - if ( useCache ) { - (node[ expando ] || (node[ expando ] = {}))[ type ] = [ dirruns, diff ]; - } - - if ( node === elem ) { - break; - } - } - } - } - - // Incorporate the offset, then check against cycle size - diff -= last; - return diff === first || ( diff % first === 0 && diff / first >= 0 ); - } - }; - }, - - "PSEUDO": function( pseudo, argument ) { - // pseudo-class names are case-insensitive - // http://www.w3.org/TR/selectors/#pseudo-classes - // Prioritize by case sensitivity in case custom pseudos are added with uppercase letters - // Remember that setFilters inherits from pseudos - var args, - fn = Expr.pseudos[ pseudo ] || Expr.setFilters[ pseudo.toLowerCase() ] || - Sizzle.error( "unsupported pseudo: " + pseudo ); - - // The user may use createPseudo to indicate that - // arguments are needed to create the filter function - // just as Sizzle does - if ( fn[ expando ] ) { - return fn( argument ); - } - - // But maintain support for old signatures - if ( fn.length > 1 ) { - args = [ pseudo, pseudo, "", argument ]; - return Expr.setFilters.hasOwnProperty( pseudo.toLowerCase() ) ? - markFunction(function( seed, matches ) { - var idx, - matched = fn( seed, argument ), - i = matched.length; - while ( i-- ) { - idx = indexOf( seed, matched[i] ); - seed[ idx ] = !( matches[ idx ] = matched[i] ); - } - }) : - function( elem ) { - return fn( elem, 0, args ); - }; - } - - return fn; - } - }, - - pseudos: { - // Potentially complex pseudos - "not": markFunction(function( selector ) { - // Trim the selector passed to compile - // to avoid treating leading and trailing - // spaces as combinators - var input = [], - results = [], - matcher = compile( selector.replace( rtrim, "$1" ) ); - - return matcher[ expando ] ? - markFunction(function( seed, matches, context, xml ) { - var elem, - unmatched = matcher( seed, null, xml, [] ), - i = seed.length; - - // Match elements unmatched by `matcher` - while ( i-- ) { - if ( (elem = unmatched[i]) ) { - seed[i] = !(matches[i] = elem); - } - } - }) : - function( elem, context, xml ) { - input[0] = elem; - matcher( input, null, xml, results ); - // Don't keep the element (issue #299) - input[0] = null; - return !results.pop(); - }; - }), - - "has": markFunction(function( selector ) { - return function( elem ) { - return Sizzle( selector, elem ).length > 0; - }; - }), - - "contains": markFunction(function( text ) { - text = text.replace( runescape, funescape ); - return function( elem ) { - return ( elem.textContent || elem.innerText || getText( elem ) ).indexOf( text ) > -1; - }; - }), - - // "Whether an element is represented by a :lang() selector - // is based solely on the element's language value - // being equal to the identifier C, - // or beginning with the identifier C immediately followed by "-". - // The matching of C against the element's language value is performed case-insensitively. - // The identifier C does not have to be a valid language name." - // http://www.w3.org/TR/selectors/#lang-pseudo - "lang": markFunction( function( lang ) { - // lang value must be a valid identifier - if ( !ridentifier.test(lang || "") ) { - Sizzle.error( "unsupported lang: " + lang ); - } - lang = lang.replace( runescape, funescape ).toLowerCase(); - return function( elem ) { - var elemLang; - do { - if ( (elemLang = documentIsHTML ? - elem.lang : - elem.getAttribute("xml:lang") || elem.getAttribute("lang")) ) { - - elemLang = elemLang.toLowerCase(); - return elemLang === lang || elemLang.indexOf( lang + "-" ) === 0; - } - } while ( (elem = elem.parentNode) && elem.nodeType === 1 ); - return false; - }; - }), - - // Miscellaneous - "target": function( elem ) { - var hash = window.location && window.location.hash; - return hash && hash.slice( 1 ) === elem.id; - }, - - "root": function( elem ) { - return elem === docElem; - }, - - "focus": function( elem ) { - return elem === document.activeElement && (!document.hasFocus || document.hasFocus()) && !!(elem.type || elem.href || ~elem.tabIndex); - }, - - // Boolean properties - "enabled": function( elem ) { - return elem.disabled === false; - }, - - "disabled": function( elem ) { - return elem.disabled === true; - }, - - "checked": function( elem ) { - // In CSS3, :checked should return both checked and selected elements - // http://www.w3.org/TR/2011/REC-css3-selectors-20110929/#checked - var nodeName = elem.nodeName.toLowerCase(); - return (nodeName === "input" && !!elem.checked) || (nodeName === "option" && !!elem.selected); - }, - - "selected": function( elem ) { - // Accessing this property makes selected-by-default - // options in Safari work properly - if ( elem.parentNode ) { - elem.parentNode.selectedIndex; - } - - return elem.selected === true; - }, - - // Contents - "empty": function( elem ) { - // http://www.w3.org/TR/selectors/#empty-pseudo - // :empty is negated by element (1) or content nodes (text: 3; cdata: 4; entity ref: 5), - // but not by others (comment: 8; processing instruction: 7; etc.) - // nodeType < 6 works because attributes (2) do not appear as children - for ( elem = elem.firstChild; elem; elem = elem.nextSibling ) { - if ( elem.nodeType < 6 ) { - return false; - } - } - return true; - }, - - "parent": function( elem ) { - return !Expr.pseudos["empty"]( elem ); - }, - - // Element/input types - "header": function( elem ) { - return rheader.test( elem.nodeName ); - }, - - "input": function( elem ) { - return rinputs.test( elem.nodeName ); - }, - - "button": function( elem ) { - var name = elem.nodeName.toLowerCase(); - return name === "input" && elem.type === "button" || name === "button"; - }, - - "text": function( elem ) { - var attr; - return elem.nodeName.toLowerCase() === "input" && - elem.type === "text" && - - // Support: IE<8 - // New HTML5 attribute values (e.g., "search") appear with elem.type === "text" - ( (attr = elem.getAttribute("type")) == null || attr.toLowerCase() === "text" ); - }, - - // Position-in-collection - "first": createPositionalPseudo(function() { - return [ 0 ]; - }), - - "last": createPositionalPseudo(function( matchIndexes, length ) { - return [ length - 1 ]; - }), - - "eq": createPositionalPseudo(function( matchIndexes, length, argument ) { - return [ argument < 0 ? argument + length : argument ]; - }), - - "even": createPositionalPseudo(function( matchIndexes, length ) { - var i = 0; - for ( ; i < length; i += 2 ) { - matchIndexes.push( i ); - } - return matchIndexes; - }), - - "odd": createPositionalPseudo(function( matchIndexes, length ) { - var i = 1; - for ( ; i < length; i += 2 ) { - matchIndexes.push( i ); - } - return matchIndexes; - }), - - "lt": createPositionalPseudo(function( matchIndexes, length, argument ) { - var i = argument < 0 ? argument + length : argument; - for ( ; --i >= 0; ) { - matchIndexes.push( i ); - } - return matchIndexes; - }), - - "gt": createPositionalPseudo(function( matchIndexes, length, argument ) { - var i = argument < 0 ? argument + length : argument; - for ( ; ++i < length; ) { - matchIndexes.push( i ); - } - return matchIndexes; - }) - } -}; - -Expr.pseudos["nth"] = Expr.pseudos["eq"]; - -// Add button/input type pseudos -for ( i in { radio: true, checkbox: true, file: true, password: true, image: true } ) { - Expr.pseudos[ i ] = createInputPseudo( i ); -} -for ( i in { submit: true, reset: true } ) { - Expr.pseudos[ i ] = createButtonPseudo( i ); -} - -// Easy API for creating new setFilters -function setFilters() {} -setFilters.prototype = Expr.filters = Expr.pseudos; -Expr.setFilters = new setFilters(); - -tokenize = Sizzle.tokenize = function( selector, parseOnly ) { - var matched, match, tokens, type, - soFar, groups, preFilters, - cached = tokenCache[ selector + " " ]; - - if ( cached ) { - return parseOnly ? 0 : cached.slice( 0 ); - } - - soFar = selector; - groups = []; - preFilters = Expr.preFilter; - - while ( soFar ) { - - // Comma and first run - if ( !matched || (match = rcomma.exec( soFar )) ) { - if ( match ) { - // Don't consume trailing commas as valid - soFar = soFar.slice( match[0].length ) || soFar; - } - groups.push( (tokens = []) ); - } - - matched = false; - - // Combinators - if ( (match = rcombinators.exec( soFar )) ) { - matched = match.shift(); - tokens.push({ - value: matched, - // Cast descendant combinators to space - type: match[0].replace( rtrim, " " ) - }); - soFar = soFar.slice( matched.length ); - } - - // Filters - for ( type in Expr.filter ) { - if ( (match = matchExpr[ type ].exec( soFar )) && (!preFilters[ type ] || - (match = preFilters[ type ]( match ))) ) { - matched = match.shift(); - tokens.push({ - value: matched, - type: type, - matches: match - }); - soFar = soFar.slice( matched.length ); - } - } - - if ( !matched ) { - break; - } - } - - // Return the length of the invalid excess - // if we're just parsing - // Otherwise, throw an error or return tokens - return parseOnly ? - soFar.length : - soFar ? - Sizzle.error( selector ) : - // Cache the tokens - tokenCache( selector, groups ).slice( 0 ); -}; - -function toSelector( tokens ) { - var i = 0, - len = tokens.length, - selector = ""; - for ( ; i < len; i++ ) { - selector += tokens[i].value; - } - return selector; -} - -function addCombinator( matcher, combinator, base ) { - var dir = combinator.dir, - checkNonElements = base && dir === "parentNode", - doneName = done++; - - return combinator.first ? - // Check against closest ancestor/preceding element - function( elem, context, xml ) { - while ( (elem = elem[ dir ]) ) { - if ( elem.nodeType === 1 || checkNonElements ) { - return matcher( elem, context, xml ); - } - } - } : - - // Check against all ancestor/preceding elements - function( elem, context, xml ) { - var oldCache, outerCache, - newCache = [ dirruns, doneName ]; - - // We can't set arbitrary data on XML nodes, so they don't benefit from dir caching - if ( xml ) { - while ( (elem = elem[ dir ]) ) { - if ( elem.nodeType === 1 || checkNonElements ) { - if ( matcher( elem, context, xml ) ) { - return true; - } - } - } - } else { - while ( (elem = elem[ dir ]) ) { - if ( elem.nodeType === 1 || checkNonElements ) { - outerCache = elem[ expando ] || (elem[ expando ] = {}); - if ( (oldCache = outerCache[ dir ]) && - oldCache[ 0 ] === dirruns && oldCache[ 1 ] === doneName ) { - - // Assign to newCache so results back-propagate to previous elements - return (newCache[ 2 ] = oldCache[ 2 ]); - } else { - // Reuse newcache so results back-propagate to previous elements - outerCache[ dir ] = newCache; - - // A match means we're done; a fail means we have to keep checking - if ( (newCache[ 2 ] = matcher( elem, context, xml )) ) { - return true; - } - } - } - } - } - }; -} - -function elementMatcher( matchers ) { - return matchers.length > 1 ? - function( elem, context, xml ) { - var i = matchers.length; - while ( i-- ) { - if ( !matchers[i]( elem, context, xml ) ) { - return false; - } - } - return true; - } : - matchers[0]; -} - -function multipleContexts( selector, contexts, results ) { - var i = 0, - len = contexts.length; - for ( ; i < len; i++ ) { - Sizzle( selector, contexts[i], results ); - } - return results; -} - -function condense( unmatched, map, filter, context, xml ) { - var elem, - newUnmatched = [], - i = 0, - len = unmatched.length, - mapped = map != null; - - for ( ; i < len; i++ ) { - if ( (elem = unmatched[i]) ) { - if ( !filter || filter( elem, context, xml ) ) { - newUnmatched.push( elem ); - if ( mapped ) { - map.push( i ); - } - } - } - } - - return newUnmatched; -} - -function setMatcher( preFilter, selector, matcher, postFilter, postFinder, postSelector ) { - if ( postFilter && !postFilter[ expando ] ) { - postFilter = setMatcher( postFilter ); - } - if ( postFinder && !postFinder[ expando ] ) { - postFinder = setMatcher( postFinder, postSelector ); - } - return markFunction(function( seed, results, context, xml ) { - var temp, i, elem, - preMap = [], - postMap = [], - preexisting = results.length, - - // Get initial elements from seed or context - elems = seed || multipleContexts( selector || "*", context.nodeType ? [ context ] : context, [] ), - - // Prefilter to get matcher input, preserving a map for seed-results synchronization - matcherIn = preFilter && ( seed || !selector ) ? - condense( elems, preMap, preFilter, context, xml ) : - elems, - - matcherOut = matcher ? - // If we have a postFinder, or filtered seed, or non-seed postFilter or preexisting results, - postFinder || ( seed ? preFilter : preexisting || postFilter ) ? - - // ...intermediate processing is necessary - [] : - - // ...otherwise use results directly - results : - matcherIn; - - // Find primary matches - if ( matcher ) { - matcher( matcherIn, matcherOut, context, xml ); - } - - // Apply postFilter - if ( postFilter ) { - temp = condense( matcherOut, postMap ); - postFilter( temp, [], context, xml ); - - // Un-match failing elements by moving them back to matcherIn - i = temp.length; - while ( i-- ) { - if ( (elem = temp[i]) ) { - matcherOut[ postMap[i] ] = !(matcherIn[ postMap[i] ] = elem); - } - } - } - - if ( seed ) { - if ( postFinder || preFilter ) { - if ( postFinder ) { - // Get the final matcherOut by condensing this intermediate into postFinder contexts - temp = []; - i = matcherOut.length; - while ( i-- ) { - if ( (elem = matcherOut[i]) ) { - // Restore matcherIn since elem is not yet a final match - temp.push( (matcherIn[i] = elem) ); - } - } - postFinder( null, (matcherOut = []), temp, xml ); - } - - // Move matched elements from seed to results to keep them synchronized - i = matcherOut.length; - while ( i-- ) { - if ( (elem = matcherOut[i]) && - (temp = postFinder ? indexOf( seed, elem ) : preMap[i]) > -1 ) { - - seed[temp] = !(results[temp] = elem); - } - } - } - - // Add elements to results, through postFinder if defined - } else { - matcherOut = condense( - matcherOut === results ? - matcherOut.splice( preexisting, matcherOut.length ) : - matcherOut - ); - if ( postFinder ) { - postFinder( null, results, matcherOut, xml ); - } else { - push.apply( results, matcherOut ); - } - } - }); -} - -function matcherFromTokens( tokens ) { - var checkContext, matcher, j, - len = tokens.length, - leadingRelative = Expr.relative[ tokens[0].type ], - implicitRelative = leadingRelative || Expr.relative[" "], - i = leadingRelative ? 1 : 0, - - // The foundational matcher ensures that elements are reachable from top-level context(s) - matchContext = addCombinator( function( elem ) { - return elem === checkContext; - }, implicitRelative, true ), - matchAnyContext = addCombinator( function( elem ) { - return indexOf( checkContext, elem ) > -1; - }, implicitRelative, true ), - matchers = [ function( elem, context, xml ) { - var ret = ( !leadingRelative && ( xml || context !== outermostContext ) ) || ( - (checkContext = context).nodeType ? - matchContext( elem, context, xml ) : - matchAnyContext( elem, context, xml ) ); - // Avoid hanging onto element (issue #299) - checkContext = null; - return ret; - } ]; - - for ( ; i < len; i++ ) { - if ( (matcher = Expr.relative[ tokens[i].type ]) ) { - matchers = [ addCombinator(elementMatcher( matchers ), matcher) ]; - } else { - matcher = Expr.filter[ tokens[i].type ].apply( null, tokens[i].matches ); - - // Return special upon seeing a positional matcher - if ( matcher[ expando ] ) { - // Find the next relative operator (if any) for proper handling - j = ++i; - for ( ; j < len; j++ ) { - if ( Expr.relative[ tokens[j].type ] ) { - break; - } - } - return setMatcher( - i > 1 && elementMatcher( matchers ), - i > 1 && toSelector( - // If the preceding token was a descendant combinator, insert an implicit any-element `*` - tokens.slice( 0, i - 1 ).concat({ value: tokens[ i - 2 ].type === " " ? "*" : "" }) - ).replace( rtrim, "$1" ), - matcher, - i < j && matcherFromTokens( tokens.slice( i, j ) ), - j < len && matcherFromTokens( (tokens = tokens.slice( j )) ), - j < len && toSelector( tokens ) - ); - } - matchers.push( matcher ); - } - } - - return elementMatcher( matchers ); -} - -function matcherFromGroupMatchers( elementMatchers, setMatchers ) { - var bySet = setMatchers.length > 0, - byElement = elementMatchers.length > 0, - superMatcher = function( seed, context, xml, results, outermost ) { - var elem, j, matcher, - matchedCount = 0, - i = "0", - unmatched = seed && [], - setMatched = [], - contextBackup = outermostContext, - // We must always have either seed elements or outermost context - elems = seed || byElement && Expr.find["TAG"]( "*", outermost ), - // Use integer dirruns iff this is the outermost matcher - dirrunsUnique = (dirruns += contextBackup == null ? 1 : Math.random() || 0.1), - len = elems.length; - - if ( outermost ) { - outermostContext = context !== document && context; - } - - // Add elements passing elementMatchers directly to results - // Keep `i` a string if there are no elements so `matchedCount` will be "00" below - // Support: IE<9, Safari - // Tolerate NodeList properties (IE: "length"; Safari: <number>) matching elements by id - for ( ; i !== len && (elem = elems[i]) != null; i++ ) { - if ( byElement && elem ) { - j = 0; - while ( (matcher = elementMatchers[j++]) ) { - if ( matcher( elem, context, xml ) ) { - results.push( elem ); - break; - } - } - if ( outermost ) { - dirruns = dirrunsUnique; - } - } - - // Track unmatched elements for set filters - if ( bySet ) { - // They will have gone through all possible matchers - if ( (elem = !matcher && elem) ) { - matchedCount--; - } - - // Lengthen the array for every element, matched or not - if ( seed ) { - unmatched.push( elem ); - } - } - } - - // Apply set filters to unmatched elements - matchedCount += i; - if ( bySet && i !== matchedCount ) { - j = 0; - while ( (matcher = setMatchers[j++]) ) { - matcher( unmatched, setMatched, context, xml ); - } - - if ( seed ) { - // Reintegrate element matches to eliminate the need for sorting - if ( matchedCount > 0 ) { - while ( i-- ) { - if ( !(unmatched[i] || setMatched[i]) ) { - setMatched[i] = pop.call( results ); - } - } - } - - // Discard index placeholder values to get only actual matches - setMatched = condense( setMatched ); - } - - // Add matches to results - push.apply( results, setMatched ); - - // Seedless set matches succeeding multiple successful matchers stipulate sorting - if ( outermost && !seed && setMatched.length > 0 && - ( matchedCount + setMatchers.length ) > 1 ) { - - Sizzle.uniqueSort( results ); - } - } - - // Override manipulation of globals by nested matchers - if ( outermost ) { - dirruns = dirrunsUnique; - outermostContext = contextBackup; - } - - return unmatched; - }; - - return bySet ? - markFunction( superMatcher ) : - superMatcher; -} - -compile = Sizzle.compile = function( selector, match /* Internal Use Only */ ) { - var i, - setMatchers = [], - elementMatchers = [], - cached = compilerCache[ selector + " " ]; - - if ( !cached ) { - // Generate a function of recursive functions that can be used to check each element - if ( !match ) { - match = tokenize( selector ); - } - i = match.length; - while ( i-- ) { - cached = matcherFromTokens( match[i] ); - if ( cached[ expando ] ) { - setMatchers.push( cached ); - } else { - elementMatchers.push( cached ); - } - } - - // Cache the compiled function - cached = compilerCache( selector, matcherFromGroupMatchers( elementMatchers, setMatchers ) ); - - // Save selector and tokenization - cached.selector = selector; - } - return cached; -}; - -/** - * A low-level selection function that works with Sizzle's compiled - * selector functions - * @param {String|Function} selector A selector or a pre-compiled - * selector function built with Sizzle.compile - * @param {Element} context - * @param {Array} [results] - * @param {Array} [seed] A set of elements to match against - */ -select = Sizzle.select = function( selector, context, results, seed ) { - var i, tokens, token, type, find, - compiled = typeof selector === "function" && selector, - match = !seed && tokenize( (selector = compiled.selector || selector) ); - - results = results || []; - - // Try to minimize operations if there is no seed and only one group - if ( match.length === 1 ) { - - // Take a shortcut and set the context if the root selector is an ID - tokens = match[0] = match[0].slice( 0 ); - if ( tokens.length > 2 && (token = tokens[0]).type === "ID" && - support.getById && context.nodeType === 9 && documentIsHTML && - Expr.relative[ tokens[1].type ] ) { - - context = ( Expr.find["ID"]( token.matches[0].replace(runescape, funescape), context ) || [] )[0]; - if ( !context ) { - return results; - - // Precompiled matchers will still verify ancestry, so step up a level - } else if ( compiled ) { - context = context.parentNode; - } - - selector = selector.slice( tokens.shift().value.length ); - } - - // Fetch a seed set for right-to-left matching - i = matchExpr["needsContext"].test( selector ) ? 0 : tokens.length; - while ( i-- ) { - token = tokens[i]; - - // Abort if we hit a combinator - if ( Expr.relative[ (type = token.type) ] ) { - break; - } - if ( (find = Expr.find[ type ]) ) { - // Search, expanding context for leading sibling combinators - if ( (seed = find( - token.matches[0].replace( runescape, funescape ), - rsibling.test( tokens[0].type ) && testContext( context.parentNode ) || context - )) ) { - - // If seed is empty or no tokens remain, we can return early - tokens.splice( i, 1 ); - selector = seed.length && toSelector( tokens ); - if ( !selector ) { - push.apply( results, seed ); - return results; - } - - break; - } - } - } - } - - // Compile and execute a filtering function if one is not provided - // Provide `match` to avoid retokenization if we modified the selector above - ( compiled || compile( selector, match ) )( - seed, - context, - !documentIsHTML, - results, - rsibling.test( selector ) && testContext( context.parentNode ) || context - ); - return results; -}; - -// One-time assignments - -// Sort stability -support.sortStable = expando.split("").sort( sortOrder ).join("") === expando; - -// Support: Chrome 14-35+ -// Always assume duplicates if they aren't passed to the comparison function -support.detectDuplicates = !!hasDuplicate; - -// Initialize against the default document -setDocument(); - -// Support: Webkit<537.32 - Safari 6.0.3/Chrome 25 (fixed in Chrome 27) -// Detached nodes confoundingly follow *each other* -support.sortDetached = assert(function( div1 ) { - // Should return 1, but returns 4 (following) - return div1.compareDocumentPosition( document.createElement("div") ) & 1; -}); - -// Support: IE<8 -// Prevent attribute/property "interpolation" -// http://msdn.microsoft.com/en-us/library/ms536429%28VS.85%29.aspx -if ( !assert(function( div ) { - div.innerHTML = "<a href='#'></a>"; - return div.firstChild.getAttribute("href") === "#" ; -}) ) { - addHandle( "type|href|height|width", function( elem, name, isXML ) { - if ( !isXML ) { - return elem.getAttribute( name, name.toLowerCase() === "type" ? 1 : 2 ); - } - }); -} - -// Support: IE<9 -// Use defaultValue in place of getAttribute("value") -if ( !support.attributes || !assert(function( div ) { - div.innerHTML = "<input/>"; - div.firstChild.setAttribute( "value", "" ); - return div.firstChild.getAttribute( "value" ) === ""; -}) ) { - addHandle( "value", function( elem, name, isXML ) { - if ( !isXML && elem.nodeName.toLowerCase() === "input" ) { - return elem.defaultValue; - } - }); -} - -// Support: IE<9 -// Use getAttributeNode to fetch booleans when getAttribute lies -if ( !assert(function( div ) { - return div.getAttribute("disabled") == null; -}) ) { - addHandle( booleans, function( elem, name, isXML ) { - var val; - if ( !isXML ) { - return elem[ name ] === true ? name.toLowerCase() : - (val = elem.getAttributeNode( name )) && val.specified ? - val.value : - null; - } - }); -} - -return Sizzle; - -})( window ); - - - -jQuery.find = Sizzle; -jQuery.expr = Sizzle.selectors; -jQuery.expr[":"] = jQuery.expr.pseudos; -jQuery.unique = Sizzle.uniqueSort; -jQuery.text = Sizzle.getText; -jQuery.isXMLDoc = Sizzle.isXML; -jQuery.contains = Sizzle.contains; - - - -var rneedsContext = jQuery.expr.match.needsContext; - -var rsingleTag = (/^<(\w+)\s*\/?>(?:<\/\1>|)$/); - - - -var risSimple = /^.[^:#\[\.,]*$/; - -// Implement the identical functionality for filter and not -function winnow( elements, qualifier, not ) { - if ( jQuery.isFunction( qualifier ) ) { - return jQuery.grep( elements, function( elem, i ) { - /* jshint -W018 */ - return !!qualifier.call( elem, i, elem ) !== not; - }); - - } - - if ( qualifier.nodeType ) { - return jQuery.grep( elements, function( elem ) { - return ( elem === qualifier ) !== not; - }); - - } - - if ( typeof qualifier === "string" ) { - if ( risSimple.test( qualifier ) ) { - return jQuery.filter( qualifier, elements, not ); - } - - qualifier = jQuery.filter( qualifier, elements ); - } - - return jQuery.grep( elements, function( elem ) { - return ( jQuery.inArray( elem, qualifier ) >= 0 ) !== not; - }); -} - -jQuery.filter = function( expr, elems, not ) { - var elem = elems[ 0 ]; - - if ( not ) { - expr = ":not(" + expr + ")"; - } - - return elems.length === 1 && elem.nodeType === 1 ? - jQuery.find.matchesSelector( elem, expr ) ? [ elem ] : [] : - jQuery.find.matches( expr, jQuery.grep( elems, function( elem ) { - return elem.nodeType === 1; - })); -}; - -jQuery.fn.extend({ - find: function( selector ) { - var i, - ret = [], - self = this, - len = self.length; - - if ( typeof selector !== "string" ) { - return this.pushStack( jQuery( selector ).filter(function() { - for ( i = 0; i < len; i++ ) { - if ( jQuery.contains( self[ i ], this ) ) { - return true; - } - } - }) ); - } - - for ( i = 0; i < len; i++ ) { - jQuery.find( selector, self[ i ], ret ); - } - - // Needed because $( selector, context ) becomes $( context ).find( selector ) - ret = this.pushStack( len > 1 ? jQuery.unique( ret ) : ret ); - ret.selector = this.selector ? this.selector + " " + selector : selector; - return ret; - }, - filter: function( selector ) { - return this.pushStack( winnow(this, selector || [], false) ); - }, - not: function( selector ) { - return this.pushStack( winnow(this, selector || [], true) ); - }, - is: function( selector ) { - return !!winnow( - this, - - // If this is a positional/relative selector, check membership in the returned set - // so $("p:first").is("p:last") won't return true for a doc with two "p". - typeof selector === "string" && rneedsContext.test( selector ) ? - jQuery( selector ) : - selector || [], - false - ).length; - } -}); - - -// Initialize a jQuery object - - -// A central reference to the root jQuery(document) -var rootjQuery, - - // Use the correct document accordingly with window argument (sandbox) - document = window.document, - - // A simple way to check for HTML strings - // Prioritize #id over <tag> to avoid XSS via location.hash (#9521) - // Strict HTML recognition (#11290: must start with <) - rquickExpr = /^(?:\s*(<[\w\W]+>)[^>]*|#([\w-]*))$/, - - init = jQuery.fn.init = function( selector, context ) { - var match, elem; - - // HANDLE: $(""), $(null), $(undefined), $(false) - if ( !selector ) { - return this; - } - - // Handle HTML strings - if ( typeof selector === "string" ) { - if ( selector.charAt(0) === "<" && selector.charAt( selector.length - 1 ) === ">" && selector.length >= 3 ) { - // Assume that strings that start and end with <> are HTML and skip the regex check - match = [ null, selector, null ]; - - } else { - match = rquickExpr.exec( selector ); - } - - // Match html or make sure no context is specified for #id - if ( match && (match[1] || !context) ) { - - // HANDLE: $(html) -> $(array) - if ( match[1] ) { - context = context instanceof jQuery ? context[0] : context; - - // scripts is true for back-compat - // Intentionally let the error be thrown if parseHTML is not present - jQuery.merge( this, jQuery.parseHTML( - match[1], - context && context.nodeType ? context.ownerDocument || context : document, - true - ) ); - - // HANDLE: $(html, props) - if ( rsingleTag.test( match[1] ) && jQuery.isPlainObject( context ) ) { - for ( match in context ) { - // Properties of context are called as methods if possible - if ( jQuery.isFunction( this[ match ] ) ) { - this[ match ]( context[ match ] ); - - // ...and otherwise set as attributes - } else { - this.attr( match, context[ match ] ); - } - } - } - - return this; - - // HANDLE: $(#id) - } else { - elem = document.getElementById( match[2] ); - - // Check parentNode to catch when Blackberry 4.6 returns - // nodes that are no longer in the document #6963 - if ( elem && elem.parentNode ) { - // Handle the case where IE and Opera return items - // by name instead of ID - if ( elem.id !== match[2] ) { - return rootjQuery.find( selector ); - } - - // Otherwise, we inject the element directly into the jQuery object - this.length = 1; - this[0] = elem; - } - - this.context = document; - this.selector = selector; - return this; - } - - // HANDLE: $(expr, $(...)) - } else if ( !context || context.jquery ) { - return ( context || rootjQuery ).find( selector ); - - // HANDLE: $(expr, context) - // (which is just equivalent to: $(context).find(expr) - } else { - return this.constructor( context ).find( selector ); - } - - // HANDLE: $(DOMElement) - } else if ( selector.nodeType ) { - this.context = this[0] = selector; - this.length = 1; - return this; - - // HANDLE: $(function) - // Shortcut for document ready - } else if ( jQuery.isFunction( selector ) ) { - return typeof rootjQuery.ready !== "undefined" ? - rootjQuery.ready( selector ) : - // Execute immediately if ready is not present - selector( jQuery ); - } - - if ( selector.selector !== undefined ) { - this.selector = selector.selector; - this.context = selector.context; - } - - return jQuery.makeArray( selector, this ); - }; - -// Give the init function the jQuery prototype for later instantiation -init.prototype = jQuery.fn; - -// Initialize central reference -rootjQuery = jQuery( document ); - - -var rparentsprev = /^(?:parents|prev(?:Until|All))/, - // methods guaranteed to produce a unique set when starting from a unique set - guaranteedUnique = { - children: true, - contents: true, - next: true, - prev: true - }; - -jQuery.extend({ - dir: function( elem, dir, until ) { - var matched = [], - cur = elem[ dir ]; - - while ( cur && cur.nodeType !== 9 && (until === undefined || cur.nodeType !== 1 || !jQuery( cur ).is( until )) ) { - if ( cur.nodeType === 1 ) { - matched.push( cur ); - } - cur = cur[dir]; - } - return matched; - }, - - sibling: function( n, elem ) { - var r = []; - - for ( ; n; n = n.nextSibling ) { - if ( n.nodeType === 1 && n !== elem ) { - r.push( n ); - } - } - - return r; - } -}); - -jQuery.fn.extend({ - has: function( target ) { - var i, - targets = jQuery( target, this ), - len = targets.length; - - return this.filter(function() { - for ( i = 0; i < len; i++ ) { - if ( jQuery.contains( this, targets[i] ) ) { - return true; - } - } - }); - }, - - closest: function( selectors, context ) { - var cur, - i = 0, - l = this.length, - matched = [], - pos = rneedsContext.test( selectors ) || typeof selectors !== "string" ? - jQuery( selectors, context || this.context ) : - 0; - - for ( ; i < l; i++ ) { - for ( cur = this[i]; cur && cur !== context; cur = cur.parentNode ) { - // Always skip document fragments - if ( cur.nodeType < 11 && (pos ? - pos.index(cur) > -1 : - - // Don't pass non-elements to Sizzle - cur.nodeType === 1 && - jQuery.find.matchesSelector(cur, selectors)) ) { - - matched.push( cur ); - break; - } - } - } - - return this.pushStack( matched.length > 1 ? jQuery.unique( matched ) : matched ); - }, - - // Determine the position of an element within - // the matched set of elements - index: function( elem ) { - - // No argument, return index in parent - if ( !elem ) { - return ( this[0] && this[0].parentNode ) ? this.first().prevAll().length : -1; - } - - // index in selector - if ( typeof elem === "string" ) { - return jQuery.inArray( this[0], jQuery( elem ) ); - } - - // Locate the position of the desired element - return jQuery.inArray( - // If it receives a jQuery object, the first element is used - elem.jquery ? elem[0] : elem, this ); - }, - - add: function( selector, context ) { - return this.pushStack( - jQuery.unique( - jQuery.merge( this.get(), jQuery( selector, context ) ) - ) - ); - }, - - addBack: function( selector ) { - return this.add( selector == null ? - this.prevObject : this.prevObject.filter(selector) - ); - } -}); - -function sibling( cur, dir ) { - do { - cur = cur[ dir ]; - } while ( cur && cur.nodeType !== 1 ); - - return cur; -} - -jQuery.each({ - parent: function( elem ) { - var parent = elem.parentNode; - return parent && parent.nodeType !== 11 ? parent : null; - }, - parents: function( elem ) { - return jQuery.dir( elem, "parentNode" ); - }, - parentsUntil: function( elem, i, until ) { - return jQuery.dir( elem, "parentNode", until ); - }, - next: function( elem ) { - return sibling( elem, "nextSibling" ); - }, - prev: function( elem ) { - return sibling( elem, "previousSibling" ); - }, - nextAll: function( elem ) { - return jQuery.dir( elem, "nextSibling" ); - }, - prevAll: function( elem ) { - return jQuery.dir( elem, "previousSibling" ); - }, - nextUntil: function( elem, i, until ) { - return jQuery.dir( elem, "nextSibling", until ); - }, - prevUntil: function( elem, i, until ) { - return jQuery.dir( elem, "previousSibling", until ); - }, - siblings: function( elem ) { - return jQuery.sibling( ( elem.parentNode || {} ).firstChild, elem ); - }, - children: function( elem ) { - return jQuery.sibling( elem.firstChild ); - }, - contents: function( elem ) { - return jQuery.nodeName( elem, "iframe" ) ? - elem.contentDocument || elem.contentWindow.document : - jQuery.merge( [], elem.childNodes ); - } -}, function( name, fn ) { - jQuery.fn[ name ] = function( until, selector ) { - var ret = jQuery.map( this, fn, until ); - - if ( name.slice( -5 ) !== "Until" ) { - selector = until; - } - - if ( selector && typeof selector === "string" ) { - ret = jQuery.filter( selector, ret ); - } - - if ( this.length > 1 ) { - // Remove duplicates - if ( !guaranteedUnique[ name ] ) { - ret = jQuery.unique( ret ); - } - - // Reverse order for parents* and prev-derivatives - if ( rparentsprev.test( name ) ) { - ret = ret.reverse(); - } - } - - return this.pushStack( ret ); - }; -}); -var rnotwhite = (/\S+/g); - - - -// String to Object options format cache -var optionsCache = {}; - -// Convert String-formatted options into Object-formatted ones and store in cache -function createOptions( options ) { - var object = optionsCache[ options ] = {}; - jQuery.each( options.match( rnotwhite ) || [], function( _, flag ) { - object[ flag ] = true; - }); - return object; -} - -/* - * Create a callback list using the following parameters: - * - * options: an optional list of space-separated options that will change how - * the callback list behaves or a more traditional option object - * - * By default a callback list will act like an event callback list and can be - * "fired" multiple times. - * - * Possible options: - * - * once: will ensure the callback list can only be fired once (like a Deferred) - * - * memory: will keep track of previous values and will call any callback added - * after the list has been fired right away with the latest "memorized" - * values (like a Deferred) - * - * unique: will ensure a callback can only be added once (no duplicate in the list) - * - * stopOnFalse: interrupt callings when a callback returns false - * - */ -jQuery.Callbacks = function( options ) { - - // Convert options from String-formatted to Object-formatted if needed - // (we check in cache first) - options = typeof options === "string" ? - ( optionsCache[ options ] || createOptions( options ) ) : - jQuery.extend( {}, options ); - - var // Flag to know if list is currently firing - firing, - // Last fire value (for non-forgettable lists) - memory, - // Flag to know if list was already fired - fired, - // End of the loop when firing - firingLength, - // Index of currently firing callback (modified by remove if needed) - firingIndex, - // First callback to fire (used internally by add and fireWith) - firingStart, - // Actual callback list - list = [], - // Stack of fire calls for repeatable lists - stack = !options.once && [], - // Fire callbacks - fire = function( data ) { - memory = options.memory && data; - fired = true; - firingIndex = firingStart || 0; - firingStart = 0; - firingLength = list.length; - firing = true; - for ( ; list && firingIndex < firingLength; firingIndex++ ) { - if ( list[ firingIndex ].apply( data[ 0 ], data[ 1 ] ) === false && options.stopOnFalse ) { - memory = false; // To prevent further calls using add - break; - } - } - firing = false; - if ( list ) { - if ( stack ) { - if ( stack.length ) { - fire( stack.shift() ); - } - } else if ( memory ) { - list = []; - } else { - self.disable(); - } - } - }, - // Actual Callbacks object - self = { - // Add a callback or a collection of callbacks to the list - add: function() { - if ( list ) { - // First, we save the current length - var start = list.length; - (function add( args ) { - jQuery.each( args, function( _, arg ) { - var type = jQuery.type( arg ); - if ( type === "function" ) { - if ( !options.unique || !self.has( arg ) ) { - list.push( arg ); - } - } else if ( arg && arg.length && type !== "string" ) { - // Inspect recursively - add( arg ); - } - }); - })( arguments ); - // Do we need to add the callbacks to the - // current firing batch? - if ( firing ) { - firingLength = list.length; - // With memory, if we're not firing then - // we should call right away - } else if ( memory ) { - firingStart = start; - fire( memory ); - } - } - return this; - }, - // Remove a callback from the list - remove: function() { - if ( list ) { - jQuery.each( arguments, function( _, arg ) { - var index; - while ( ( index = jQuery.inArray( arg, list, index ) ) > -1 ) { - list.splice( index, 1 ); - // Handle firing indexes - if ( firing ) { - if ( index <= firingLength ) { - firingLength--; - } - if ( index <= firingIndex ) { - firingIndex--; - } - } - } - }); - } - return this; - }, - // Check if a given callback is in the list. - // If no argument is given, return whether or not list has callbacks attached. - has: function( fn ) { - return fn ? jQuery.inArray( fn, list ) > -1 : !!( list && list.length ); - }, - // Remove all callbacks from the list - empty: function() { - list = []; - firingLength = 0; - return this; - }, - // Have the list do nothing anymore - disable: function() { - list = stack = memory = undefined; - return this; - }, - // Is it disabled? - disabled: function() { - return !list; - }, - // Lock the list in its current state - lock: function() { - stack = undefined; - if ( !memory ) { - self.disable(); - } - return this; - }, - // Is it locked? - locked: function() { - return !stack; - }, - // Call all callbacks with the given context and arguments - fireWith: function( context, args ) { - if ( list && ( !fired || stack ) ) { - args = args || []; - args = [ context, args.slice ? args.slice() : args ]; - if ( firing ) { - stack.push( args ); - } else { - fire( args ); - } - } - return this; - }, - // Call all the callbacks with the given arguments - fire: function() { - self.fireWith( this, arguments ); - return this; - }, - // To know if the callbacks have already been called at least once - fired: function() { - return !!fired; - } - }; - - return self; -}; - - -jQuery.extend({ - - Deferred: function( func ) { - var tuples = [ - // action, add listener, listener list, final state - [ "resolve", "done", jQuery.Callbacks("once memory"), "resolved" ], - [ "reject", "fail", jQuery.Callbacks("once memory"), "rejected" ], - [ "notify", "progress", jQuery.Callbacks("memory") ] - ], - state = "pending", - promise = { - state: function() { - return state; - }, - always: function() { - deferred.done( arguments ).fail( arguments ); - return this; - }, - then: function( /* fnDone, fnFail, fnProgress */ ) { - var fns = arguments; - return jQuery.Deferred(function( newDefer ) { - jQuery.each( tuples, function( i, tuple ) { - var fn = jQuery.isFunction( fns[ i ] ) && fns[ i ]; - // deferred[ done | fail | progress ] for forwarding actions to newDefer - deferred[ tuple[1] ](function() { - var returned = fn && fn.apply( this, arguments ); - if ( returned && jQuery.isFunction( returned.promise ) ) { - returned.promise() - .done( newDefer.resolve ) - .fail( newDefer.reject ) - .progress( newDefer.notify ); - } else { - newDefer[ tuple[ 0 ] + "With" ]( this === promise ? newDefer.promise() : this, fn ? [ returned ] : arguments ); - } - }); - }); - fns = null; - }).promise(); - }, - // Get a promise for this deferred - // If obj is provided, the promise aspect is added to the object - promise: function( obj ) { - return obj != null ? jQuery.extend( obj, promise ) : promise; - } - }, - deferred = {}; - - // Keep pipe for back-compat - promise.pipe = promise.then; - - // Add list-specific methods - jQuery.each( tuples, function( i, tuple ) { - var list = tuple[ 2 ], - stateString = tuple[ 3 ]; - - // promise[ done | fail | progress ] = list.add - promise[ tuple[1] ] = list.add; - - // Handle state - if ( stateString ) { - list.add(function() { - // state = [ resolved | rejected ] - state = stateString; - - // [ reject_list | resolve_list ].disable; progress_list.lock - }, tuples[ i ^ 1 ][ 2 ].disable, tuples[ 2 ][ 2 ].lock ); - } - - // deferred[ resolve | reject | notify ] - deferred[ tuple[0] ] = function() { - deferred[ tuple[0] + "With" ]( this === deferred ? promise : this, arguments ); - return this; - }; - deferred[ tuple[0] + "With" ] = list.fireWith; - }); - - // Make the deferred a promise - promise.promise( deferred ); - - // Call given func if any - if ( func ) { - func.call( deferred, deferred ); - } - - // All done! - return deferred; - }, - - // Deferred helper - when: function( subordinate /* , ..., subordinateN */ ) { - var i = 0, - resolveValues = slice.call( arguments ), - length = resolveValues.length, - - // the count of uncompleted subordinates - remaining = length !== 1 || ( subordinate && jQuery.isFunction( subordinate.promise ) ) ? length : 0, - - // the master Deferred. If resolveValues consist of only a single Deferred, just use that. - deferred = remaining === 1 ? subordinate : jQuery.Deferred(), - - // Update function for both resolve and progress values - updateFunc = function( i, contexts, values ) { - return function( value ) { - contexts[ i ] = this; - values[ i ] = arguments.length > 1 ? slice.call( arguments ) : value; - if ( values === progressValues ) { - deferred.notifyWith( contexts, values ); - - } else if ( !(--remaining) ) { - deferred.resolveWith( contexts, values ); - } - }; - }, - - progressValues, progressContexts, resolveContexts; - - // add listeners to Deferred subordinates; treat others as resolved - if ( length > 1 ) { - progressValues = new Array( length ); - progressContexts = new Array( length ); - resolveContexts = new Array( length ); - for ( ; i < length; i++ ) { - if ( resolveValues[ i ] && jQuery.isFunction( resolveValues[ i ].promise ) ) { - resolveValues[ i ].promise() - .done( updateFunc( i, resolveContexts, resolveValues ) ) - .fail( deferred.reject ) - .progress( updateFunc( i, progressContexts, progressValues ) ); - } else { - --remaining; - } - } - } - - // if we're not waiting on anything, resolve the master - if ( !remaining ) { - deferred.resolveWith( resolveContexts, resolveValues ); - } - - return deferred.promise(); - } -}); - - -// The deferred used on DOM ready -var readyList; - -jQuery.fn.ready = function( fn ) { - // Add the callback - jQuery.ready.promise().done( fn ); - - return this; -}; - -jQuery.extend({ - // Is the DOM ready to be used? Set to true once it occurs. - isReady: false, - - // A counter to track how many items to wait for before - // the ready event fires. See #6781 - readyWait: 1, - - // Hold (or release) the ready event - holdReady: function( hold ) { - if ( hold ) { - jQuery.readyWait++; - } else { - jQuery.ready( true ); - } - }, - - // Handle when the DOM is ready - ready: function( wait ) { - - // Abort if there are pending holds or we're already ready - if ( wait === true ? --jQuery.readyWait : jQuery.isReady ) { - return; - } - - // Make sure body exists, at least, in case IE gets a little overzealous (ticket #5443). - if ( !document.body ) { - return setTimeout( jQuery.ready ); - } - - // Remember that the DOM is ready - jQuery.isReady = true; - - // If a normal DOM Ready event fired, decrement, and wait if need be - if ( wait !== true && --jQuery.readyWait > 0 ) { - return; - } - - // If there are functions bound, to execute - readyList.resolveWith( document, [ jQuery ] ); - - // Trigger any bound ready events - if ( jQuery.fn.triggerHandler ) { - jQuery( document ).triggerHandler( "ready" ); - jQuery( document ).off( "ready" ); - } - } -}); - -/** - * Clean-up method for dom ready events - */ -function detach() { - if ( document.addEventListener ) { - document.removeEventListener( "DOMContentLoaded", completed, false ); - window.removeEventListener( "load", completed, false ); - - } else { - document.detachEvent( "onreadystatechange", completed ); - window.detachEvent( "onload", completed ); - } -} - -/** - * The ready event handler and self cleanup method - */ -function completed() { - // readyState === "complete" is good enough for us to call the dom ready in oldIE - if ( document.addEventListener || event.type === "load" || document.readyState === "complete" ) { - detach(); - jQuery.ready(); - } -} - -jQuery.ready.promise = function( obj ) { - if ( !readyList ) { - - readyList = jQuery.Deferred(); - - // Catch cases where $(document).ready() is called after the browser event has already occurred. - // we once tried to use readyState "interactive" here, but it caused issues like the one - // discovered by ChrisS here: http://bugs.jquery.com/ticket/12282#comment:15 - if ( document.readyState === "complete" ) { - // Handle it asynchronously to allow scripts the opportunity to delay ready - setTimeout( jQuery.ready ); - - // Standards-based browsers support DOMContentLoaded - } else if ( document.addEventListener ) { - // Use the handy event callback - document.addEventListener( "DOMContentLoaded", completed, false ); - - // A fallback to window.onload, that will always work - window.addEventListener( "load", completed, false ); - - // If IE event model is used - } else { - // Ensure firing before onload, maybe late but safe also for iframes - document.attachEvent( "onreadystatechange", completed ); - - // A fallback to window.onload, that will always work - window.attachEvent( "onload", completed ); - - // If IE and not a frame - // continually check to see if the document is ready - var top = false; - - try { - top = window.frameElement == null && document.documentElement; - } catch(e) {} - - if ( top && top.doScroll ) { - (function doScrollCheck() { - if ( !jQuery.isReady ) { - - try { - // Use the trick by Diego Perini - // http://javascript.nwbox.com/IEContentLoaded/ - top.doScroll("left"); - } catch(e) { - return setTimeout( doScrollCheck, 50 ); - } - - // detach all dom ready events - detach(); - - // and execute any waiting functions - jQuery.ready(); - } - })(); - } - } - } - return readyList.promise( obj ); -}; - - -var strundefined = typeof undefined; - - - -// Support: IE<9 -// Iteration over object's inherited properties before its own -var i; -for ( i in jQuery( support ) ) { - break; -} -support.ownLast = i !== "0"; - -// Note: most support tests are defined in their respective modules. -// false until the test is run -support.inlineBlockNeedsLayout = false; - -// Execute ASAP in case we need to set body.style.zoom -jQuery(function() { - // Minified: var a,b,c,d - var val, div, body, container; - - body = document.getElementsByTagName( "body" )[ 0 ]; - if ( !body || !body.style ) { - // Return for frameset docs that don't have a body - return; - } - - // Setup - div = document.createElement( "div" ); - container = document.createElement( "div" ); - container.style.cssText = "position:absolute;border:0;width:0;height:0;top:0;left:-9999px"; - body.appendChild( container ).appendChild( div ); - - if ( typeof div.style.zoom !== strundefined ) { - // Support: IE<8 - // Check if natively block-level elements act like inline-block - // elements when setting their display to 'inline' and giving - // them layout - div.style.cssText = "display:inline;margin:0;border:0;padding:1px;width:1px;zoom:1"; - - support.inlineBlockNeedsLayout = val = div.offsetWidth === 3; - if ( val ) { - // Prevent IE 6 from affecting layout for positioned elements #11048 - // Prevent IE from shrinking the body in IE 7 mode #12869 - // Support: IE<8 - body.style.zoom = 1; - } - } - - body.removeChild( container ); -}); - - - - -(function() { - var div = document.createElement( "div" ); - - // Execute the test only if not already executed in another module. - if (support.deleteExpando == null) { - // Support: IE<9 - support.deleteExpando = true; - try { - delete div.test; - } catch( e ) { - support.deleteExpando = false; - } - } - - // Null elements to avoid leaks in IE. - div = null; -})(); - - -/** - * Determines whether an object can have data - */ -jQuery.acceptData = function( elem ) { - var noData = jQuery.noData[ (elem.nodeName + " ").toLowerCase() ], - nodeType = +elem.nodeType || 1; - - // Do not set data on non-element DOM nodes because it will not be cleared (#8335). - return nodeType !== 1 && nodeType !== 9 ? - false : - - // Nodes accept data unless otherwise specified; rejection can be conditional - !noData || noData !== true && elem.getAttribute("classid") === noData; -}; - - -var rbrace = /^(?:\{[\w\W]*\}|\[[\w\W]*\])$/, - rmultiDash = /([A-Z])/g; - -function dataAttr( elem, key, data ) { - // If nothing was found internally, try to fetch any - // data from the HTML5 data-* attribute - if ( data === undefined && elem.nodeType === 1 ) { - - var name = "data-" + key.replace( rmultiDash, "-$1" ).toLowerCase(); - - data = elem.getAttribute( name ); - - if ( typeof data === "string" ) { - try { - data = data === "true" ? true : - data === "false" ? false : - data === "null" ? null : - // Only convert to a number if it doesn't change the string - +data + "" === data ? +data : - rbrace.test( data ) ? jQuery.parseJSON( data ) : - data; - } catch( e ) {} - - // Make sure we set the data so it isn't changed later - jQuery.data( elem, key, data ); - - } else { - data = undefined; - } - } - - return data; -} - -// checks a cache object for emptiness -function isEmptyDataObject( obj ) { - var name; - for ( name in obj ) { - - // if the public data object is empty, the private is still empty - if ( name === "data" && jQuery.isEmptyObject( obj[name] ) ) { - continue; - } - if ( name !== "toJSON" ) { - return false; - } - } - - return true; -} - -function internalData( elem, name, data, pvt /* Internal Use Only */ ) { - if ( !jQuery.acceptData( elem ) ) { - return; - } - - var ret, thisCache, - internalKey = jQuery.expando, - - // We have to handle DOM nodes and JS objects differently because IE6-7 - // can't GC object references properly across the DOM-JS boundary - isNode = elem.nodeType, - - // Only DOM nodes need the global jQuery cache; JS object data is - // attached directly to the object so GC can occur automatically - cache = isNode ? jQuery.cache : elem, - - // Only defining an ID for JS objects if its cache already exists allows - // the code to shortcut on the same path as a DOM node with no cache - id = isNode ? elem[ internalKey ] : elem[ internalKey ] && internalKey; - - // Avoid doing any more work than we need to when trying to get data on an - // object that has no data at all - if ( (!id || !cache[id] || (!pvt && !cache[id].data)) && data === undefined && typeof name === "string" ) { - return; - } - - if ( !id ) { - // Only DOM nodes need a new unique ID for each element since their data - // ends up in the global cache - if ( isNode ) { - id = elem[ internalKey ] = deletedIds.pop() || jQuery.guid++; - } else { - id = internalKey; - } - } - - if ( !cache[ id ] ) { - // Avoid exposing jQuery metadata on plain JS objects when the object - // is serialized using JSON.stringify - cache[ id ] = isNode ? {} : { toJSON: jQuery.noop }; - } - - // An object can be passed to jQuery.data instead of a key/value pair; this gets - // shallow copied over onto the existing cache - if ( typeof name === "object" || typeof name === "function" ) { - if ( pvt ) { - cache[ id ] = jQuery.extend( cache[ id ], name ); - } else { - cache[ id ].data = jQuery.extend( cache[ id ].data, name ); - } - } - - thisCache = cache[ id ]; - - // jQuery data() is stored in a separate object inside the object's internal data - // cache in order to avoid key collisions between internal data and user-defined - // data. - if ( !pvt ) { - if ( !thisCache.data ) { - thisCache.data = {}; - } - - thisCache = thisCache.data; - } - - if ( data !== undefined ) { - thisCache[ jQuery.camelCase( name ) ] = data; - } - - // Check for both converted-to-camel and non-converted data property names - // If a data property was specified - if ( typeof name === "string" ) { - - // First Try to find as-is property data - ret = thisCache[ name ]; - - // Test for null|undefined property data - if ( ret == null ) { - - // Try to find the camelCased property - ret = thisCache[ jQuery.camelCase( name ) ]; - } - } else { - ret = thisCache; - } - - return ret; -} - -function internalRemoveData( elem, name, pvt ) { - if ( !jQuery.acceptData( elem ) ) { - return; - } - - var thisCache, i, - isNode = elem.nodeType, - - // See jQuery.data for more information - cache = isNode ? jQuery.cache : elem, - id = isNode ? elem[ jQuery.expando ] : jQuery.expando; - - // If there is already no cache entry for this object, there is no - // purpose in continuing - if ( !cache[ id ] ) { - return; - } - - if ( name ) { - - thisCache = pvt ? cache[ id ] : cache[ id ].data; - - if ( thisCache ) { - - // Support array or space separated string names for data keys - if ( !jQuery.isArray( name ) ) { - - // try the string as a key before any manipulation - if ( name in thisCache ) { - name = [ name ]; - } else { - - // split the camel cased version by spaces unless a key with the spaces exists - name = jQuery.camelCase( name ); - if ( name in thisCache ) { - name = [ name ]; - } else { - name = name.split(" "); - } - } - } else { - // If "name" is an array of keys... - // When data is initially created, via ("key", "val") signature, - // keys will be converted to camelCase. - // Since there is no way to tell _how_ a key was added, remove - // both plain key and camelCase key. #12786 - // This will only penalize the array argument path. - name = name.concat( jQuery.map( name, jQuery.camelCase ) ); - } - - i = name.length; - while ( i-- ) { - delete thisCache[ name[i] ]; - } - - // If there is no data left in the cache, we want to continue - // and let the cache object itself get destroyed - if ( pvt ? !isEmptyDataObject(thisCache) : !jQuery.isEmptyObject(thisCache) ) { - return; - } - } - } - - // See jQuery.data for more information - if ( !pvt ) { - delete cache[ id ].data; - - // Don't destroy the parent cache unless the internal data object - // had been the only thing left in it - if ( !isEmptyDataObject( cache[ id ] ) ) { - return; - } - } - - // Destroy the cache - if ( isNode ) { - jQuery.cleanData( [ elem ], true ); - - // Use delete when supported for expandos or `cache` is not a window per isWindow (#10080) - /* jshint eqeqeq: false */ - } else if ( support.deleteExpando || cache != cache.window ) { - /* jshint eqeqeq: true */ - delete cache[ id ]; - - // When all else fails, null - } else { - cache[ id ] = null; - } -} - -jQuery.extend({ - cache: {}, - - // The following elements (space-suffixed to avoid Object.prototype collisions) - // throw uncatchable exceptions if you attempt to set expando properties - noData: { - "applet ": true, - "embed ": true, - // ...but Flash objects (which have this classid) *can* handle expandos - "object ": "clsid:D27CDB6E-AE6D-11cf-96B8-444553540000" - }, - - hasData: function( elem ) { - elem = elem.nodeType ? jQuery.cache[ elem[jQuery.expando] ] : elem[ jQuery.expando ]; - return !!elem && !isEmptyDataObject( elem ); - }, - - data: function( elem, name, data ) { - return internalData( elem, name, data ); - }, - - removeData: function( elem, name ) { - return internalRemoveData( elem, name ); - }, - - // For internal use only. - _data: function( elem, name, data ) { - return internalData( elem, name, data, true ); - }, - - _removeData: function( elem, name ) { - return internalRemoveData( elem, name, true ); - } -}); - -jQuery.fn.extend({ - data: function( key, value ) { - var i, name, data, - elem = this[0], - attrs = elem && elem.attributes; - - // Special expections of .data basically thwart jQuery.access, - // so implement the relevant behavior ourselves - - // Gets all values - if ( key === undefined ) { - if ( this.length ) { - data = jQuery.data( elem ); - - if ( elem.nodeType === 1 && !jQuery._data( elem, "parsedAttrs" ) ) { - i = attrs.length; - while ( i-- ) { - - // Support: IE11+ - // The attrs elements can be null (#14894) - if ( attrs[ i ] ) { - name = attrs[ i ].name; - if ( name.indexOf( "data-" ) === 0 ) { - name = jQuery.camelCase( name.slice(5) ); - dataAttr( elem, name, data[ name ] ); - } - } - } - jQuery._data( elem, "parsedAttrs", true ); - } - } - - return data; - } - - // Sets multiple values - if ( typeof key === "object" ) { - return this.each(function() { - jQuery.data( this, key ); - }); - } - - return arguments.length > 1 ? - - // Sets one value - this.each(function() { - jQuery.data( this, key, value ); - }) : - - // Gets one value - // Try to fetch any internally stored data first - elem ? dataAttr( elem, key, jQuery.data( elem, key ) ) : undefined; - }, - - removeData: function( key ) { - return this.each(function() { - jQuery.removeData( this, key ); - }); - } -}); - - -jQuery.extend({ - queue: function( elem, type, data ) { - var queue; - - if ( elem ) { - type = ( type || "fx" ) + "queue"; - queue = jQuery._data( elem, type ); - - // Speed up dequeue by getting out quickly if this is just a lookup - if ( data ) { - if ( !queue || jQuery.isArray(data) ) { - queue = jQuery._data( elem, type, jQuery.makeArray(data) ); - } else { - queue.push( data ); - } - } - return queue || []; - } - }, - - dequeue: function( elem, type ) { - type = type || "fx"; - - var queue = jQuery.queue( elem, type ), - startLength = queue.length, - fn = queue.shift(), - hooks = jQuery._queueHooks( elem, type ), - next = function() { - jQuery.dequeue( elem, type ); - }; - - // If the fx queue is dequeued, always remove the progress sentinel - if ( fn === "inprogress" ) { - fn = queue.shift(); - startLength--; - } - - if ( fn ) { - - // Add a progress sentinel to prevent the fx queue from being - // automatically dequeued - if ( type === "fx" ) { - queue.unshift( "inprogress" ); - } - - // clear up the last queue stop function - delete hooks.stop; - fn.call( elem, next, hooks ); - } - - if ( !startLength && hooks ) { - hooks.empty.fire(); - } - }, - - // not intended for public consumption - generates a queueHooks object, or returns the current one - _queueHooks: function( elem, type ) { - var key = type + "queueHooks"; - return jQuery._data( elem, key ) || jQuery._data( elem, key, { - empty: jQuery.Callbacks("once memory").add(function() { - jQuery._removeData( elem, type + "queue" ); - jQuery._removeData( elem, key ); - }) - }); - } -}); - -jQuery.fn.extend({ - queue: function( type, data ) { - var setter = 2; - - if ( typeof type !== "string" ) { - data = type; - type = "fx"; - setter--; - } - - if ( arguments.length < setter ) { - return jQuery.queue( this[0], type ); - } - - return data === undefined ? - this : - this.each(function() { - var queue = jQuery.queue( this, type, data ); - - // ensure a hooks for this queue - jQuery._queueHooks( this, type ); - - if ( type === "fx" && queue[0] !== "inprogress" ) { - jQuery.dequeue( this, type ); - } - }); - }, - dequeue: function( type ) { - return this.each(function() { - jQuery.dequeue( this, type ); - }); - }, - clearQueue: function( type ) { - return this.queue( type || "fx", [] ); - }, - // Get a promise resolved when queues of a certain type - // are emptied (fx is the type by default) - promise: function( type, obj ) { - var tmp, - count = 1, - defer = jQuery.Deferred(), - elements = this, - i = this.length, - resolve = function() { - if ( !( --count ) ) { - defer.resolveWith( elements, [ elements ] ); - } - }; - - if ( typeof type !== "string" ) { - obj = type; - type = undefined; - } - type = type || "fx"; - - while ( i-- ) { - tmp = jQuery._data( elements[ i ], type + "queueHooks" ); - if ( tmp && tmp.empty ) { - count++; - tmp.empty.add( resolve ); - } - } - resolve(); - return defer.promise( obj ); - } -}); -var pnum = (/[+-]?(?:\d*\.|)\d+(?:[eE][+-]?\d+|)/).source; - -var cssExpand = [ "Top", "Right", "Bottom", "Left" ]; - -var isHidden = function( elem, el ) { - // isHidden might be called from jQuery#filter function; - // in that case, element will be second argument - elem = el || elem; - return jQuery.css( elem, "display" ) === "none" || !jQuery.contains( elem.ownerDocument, elem ); - }; - - - -// Multifunctional method to get and set values of a collection -// The value/s can optionally be executed if it's a function -var access = jQuery.access = function( elems, fn, key, value, chainable, emptyGet, raw ) { - var i = 0, - length = elems.length, - bulk = key == null; - - // Sets many values - if ( jQuery.type( key ) === "object" ) { - chainable = true; - for ( i in key ) { - jQuery.access( elems, fn, i, key[i], true, emptyGet, raw ); - } - - // Sets one value - } else if ( value !== undefined ) { - chainable = true; - - if ( !jQuery.isFunction( value ) ) { - raw = true; - } - - if ( bulk ) { - // Bulk operations run against the entire set - if ( raw ) { - fn.call( elems, value ); - fn = null; - - // ...except when executing function values - } else { - bulk = fn; - fn = function( elem, key, value ) { - return bulk.call( jQuery( elem ), value ); - }; - } - } - - if ( fn ) { - for ( ; i < length; i++ ) { - fn( elems[i], key, raw ? value : value.call( elems[i], i, fn( elems[i], key ) ) ); - } - } - } - - return chainable ? - elems : - - // Gets - bulk ? - fn.call( elems ) : - length ? fn( elems[0], key ) : emptyGet; -}; -var rcheckableType = (/^(?:checkbox|radio)$/i); - - - -(function() { - // Minified: var a,b,c - var input = document.createElement( "input" ), - div = document.createElement( "div" ), - fragment = document.createDocumentFragment(); - - // Setup - div.innerHTML = " <link/><table></table><a href='/a'>a</a><input type='checkbox'/>"; - - // IE strips leading whitespace when .innerHTML is used - support.leadingWhitespace = div.firstChild.nodeType === 3; - - // Make sure that tbody elements aren't automatically inserted - // IE will insert them into empty tables - support.tbody = !div.getElementsByTagName( "tbody" ).length; - - // Make sure that link elements get serialized correctly by innerHTML - // This requires a wrapper element in IE - support.htmlSerialize = !!div.getElementsByTagName( "link" ).length; - - // Makes sure cloning an html5 element does not cause problems - // Where outerHTML is undefined, this still works - support.html5Clone = - document.createElement( "nav" ).cloneNode( true ).outerHTML !== "<:nav></:nav>"; - - // Check if a disconnected checkbox will retain its checked - // value of true after appended to the DOM (IE6/7) - input.type = "checkbox"; - input.checked = true; - fragment.appendChild( input ); - support.appendChecked = input.checked; - - // Make sure textarea (and checkbox) defaultValue is properly cloned - // Support: IE6-IE11+ - div.innerHTML = "<textarea>x</textarea>"; - support.noCloneChecked = !!div.cloneNode( true ).lastChild.defaultValue; - - // #11217 - WebKit loses check when the name is after the checked attribute - fragment.appendChild( div ); - div.innerHTML = "<input type='radio' checked='checked' name='t'/>"; - - // Support: Safari 5.1, iOS 5.1, Android 4.x, Android 2.3 - // old WebKit doesn't clone checked state correctly in fragments - support.checkClone = div.cloneNode( true ).cloneNode( true ).lastChild.checked; - - // Support: IE<9 - // Opera does not clone events (and typeof div.attachEvent === undefined). - // IE9-10 clones events bound via attachEvent, but they don't trigger with .click() - support.noCloneEvent = true; - if ( div.attachEvent ) { - div.attachEvent( "onclick", function() { - support.noCloneEvent = false; - }); - - div.cloneNode( true ).click(); - } - - // Execute the test only if not already executed in another module. - if (support.deleteExpando == null) { - // Support: IE<9 - support.deleteExpando = true; - try { - delete div.test; - } catch( e ) { - support.deleteExpando = false; - } - } -})(); - - -(function() { - var i, eventName, - div = document.createElement( "div" ); - - // Support: IE<9 (lack submit/change bubble), Firefox 23+ (lack focusin event) - for ( i in { submit: true, change: true, focusin: true }) { - eventName = "on" + i; - - if ( !(support[ i + "Bubbles" ] = eventName in window) ) { - // Beware of CSP restrictions (https://developer.mozilla.org/en/Security/CSP) - div.setAttribute( eventName, "t" ); - support[ i + "Bubbles" ] = div.attributes[ eventName ].expando === false; - } - } - - // Null elements to avoid leaks in IE. - div = null; -})(); - - -var rformElems = /^(?:input|select|textarea)$/i, - rkeyEvent = /^key/, - rmouseEvent = /^(?:mouse|pointer|contextmenu)|click/, - rfocusMorph = /^(?:focusinfocus|focusoutblur)$/, - rtypenamespace = /^([^.]*)(?:\.(.+)|)$/; - -function returnTrue() { - return true; -} - -function returnFalse() { - return false; -} - -function safeActiveElement() { - try { - return document.activeElement; - } catch ( err ) { } -} - -/* - * Helper functions for managing events -- not part of the public interface. - * Props to Dean Edwards' addEvent library for many of the ideas. - */ -jQuery.event = { - - global: {}, - - add: function( elem, types, handler, data, selector ) { - var tmp, events, t, handleObjIn, - special, eventHandle, handleObj, - handlers, type, namespaces, origType, - elemData = jQuery._data( elem ); - - // Don't attach events to noData or text/comment nodes (but allow plain objects) - if ( !elemData ) { - return; - } - - // Caller can pass in an object of custom data in lieu of the handler - if ( handler.handler ) { - handleObjIn = handler; - handler = handleObjIn.handler; - selector = handleObjIn.selector; - } - - // Make sure that the handler has a unique ID, used to find/remove it later - if ( !handler.guid ) { - handler.guid = jQuery.guid++; - } - - // Init the element's event structure and main handler, if this is the first - if ( !(events = elemData.events) ) { - events = elemData.events = {}; - } - if ( !(eventHandle = elemData.handle) ) { - eventHandle = elemData.handle = function( e ) { - // Discard the second event of a jQuery.event.trigger() and - // when an event is called after a page has unloaded - return typeof jQuery !== strundefined && (!e || jQuery.event.triggered !== e.type) ? - jQuery.event.dispatch.apply( eventHandle.elem, arguments ) : - undefined; - }; - // Add elem as a property of the handle fn to prevent a memory leak with IE non-native events - eventHandle.elem = elem; - } - - // Handle multiple events separated by a space - types = ( types || "" ).match( rnotwhite ) || [ "" ]; - t = types.length; - while ( t-- ) { - tmp = rtypenamespace.exec( types[t] ) || []; - type = origType = tmp[1]; - namespaces = ( tmp[2] || "" ).split( "." ).sort(); - - // There *must* be a type, no attaching namespace-only handlers - if ( !type ) { - continue; - } - - // If event changes its type, use the special event handlers for the changed type - special = jQuery.event.special[ type ] || {}; - - // If selector defined, determine special event api type, otherwise given type - type = ( selector ? special.delegateType : special.bindType ) || type; - - // Update special based on newly reset type - special = jQuery.event.special[ type ] || {}; - - // handleObj is passed to all event handlers - handleObj = jQuery.extend({ - type: type, - origType: origType, - data: data, - handler: handler, - guid: handler.guid, - selector: selector, - needsContext: selector && jQuery.expr.match.needsContext.test( selector ), - namespace: namespaces.join(".") - }, handleObjIn ); - - // Init the event handler queue if we're the first - if ( !(handlers = events[ type ]) ) { - handlers = events[ type ] = []; - handlers.delegateCount = 0; - - // Only use addEventListener/attachEvent if the special events handler returns false - if ( !special.setup || special.setup.call( elem, data, namespaces, eventHandle ) === false ) { - // Bind the global event handler to the element - if ( elem.addEventListener ) { - elem.addEventListener( type, eventHandle, false ); - - } else if ( elem.attachEvent ) { - elem.attachEvent( "on" + type, eventHandle ); - } - } - } - - if ( special.add ) { - special.add.call( elem, handleObj ); - - if ( !handleObj.handler.guid ) { - handleObj.handler.guid = handler.guid; - } - } - - // Add to the element's handler list, delegates in front - if ( selector ) { - handlers.splice( handlers.delegateCount++, 0, handleObj ); - } else { - handlers.push( handleObj ); - } - - // Keep track of which events have ever been used, for event optimization - jQuery.event.global[ type ] = true; - } - - // Nullify elem to prevent memory leaks in IE - elem = null; - }, - - // Detach an event or set of events from an element - remove: function( elem, types, handler, selector, mappedTypes ) { - var j, handleObj, tmp, - origCount, t, events, - special, handlers, type, - namespaces, origType, - elemData = jQuery.hasData( elem ) && jQuery._data( elem ); - - if ( !elemData || !(events = elemData.events) ) { - return; - } - - // Once for each type.namespace in types; type may be omitted - types = ( types || "" ).match( rnotwhite ) || [ "" ]; - t = types.length; - while ( t-- ) { - tmp = rtypenamespace.exec( types[t] ) || []; - type = origType = tmp[1]; - namespaces = ( tmp[2] || "" ).split( "." ).sort(); - - // Unbind all events (on this namespace, if provided) for the element - if ( !type ) { - for ( type in events ) { - jQuery.event.remove( elem, type + types[ t ], handler, selector, true ); - } - continue; - } - - special = jQuery.event.special[ type ] || {}; - type = ( selector ? special.delegateType : special.bindType ) || type; - handlers = events[ type ] || []; - tmp = tmp[2] && new RegExp( "(^|\\.)" + namespaces.join("\\.(?:.*\\.|)") + "(\\.|$)" ); - - // Remove matching events - origCount = j = handlers.length; - while ( j-- ) { - handleObj = handlers[ j ]; - - if ( ( mappedTypes || origType === handleObj.origType ) && - ( !handler || handler.guid === handleObj.guid ) && - ( !tmp || tmp.test( handleObj.namespace ) ) && - ( !selector || selector === handleObj.selector || selector === "**" && handleObj.selector ) ) { - handlers.splice( j, 1 ); - - if ( handleObj.selector ) { - handlers.delegateCount--; - } - if ( special.remove ) { - special.remove.call( elem, handleObj ); - } - } - } - - // Remove generic event handler if we removed something and no more handlers exist - // (avoids potential for endless recursion during removal of special event handlers) - if ( origCount && !handlers.length ) { - if ( !special.teardown || special.teardown.call( elem, namespaces, elemData.handle ) === false ) { - jQuery.removeEvent( elem, type, elemData.handle ); - } - - delete events[ type ]; - } - } - - // Remove the expando if it's no longer used - if ( jQuery.isEmptyObject( events ) ) { - delete elemData.handle; - - // removeData also checks for emptiness and clears the expando if empty - // so use it instead of delete - jQuery._removeData( elem, "events" ); - } - }, - - trigger: function( event, data, elem, onlyHandlers ) { - var handle, ontype, cur, - bubbleType, special, tmp, i, - eventPath = [ elem || document ], - type = hasOwn.call( event, "type" ) ? event.type : event, - namespaces = hasOwn.call( event, "namespace" ) ? event.namespace.split(".") : []; - - cur = tmp = elem = elem || document; - - // Don't do events on text and comment nodes - if ( elem.nodeType === 3 || elem.nodeType === 8 ) { - return; - } - - // focus/blur morphs to focusin/out; ensure we're not firing them right now - if ( rfocusMorph.test( type + jQuery.event.triggered ) ) { - return; - } - - if ( type.indexOf(".") >= 0 ) { - // Namespaced trigger; create a regexp to match event type in handle() - namespaces = type.split("."); - type = namespaces.shift(); - namespaces.sort(); - } - ontype = type.indexOf(":") < 0 && "on" + type; - - // Caller can pass in a jQuery.Event object, Object, or just an event type string - event = event[ jQuery.expando ] ? - event : - new jQuery.Event( type, typeof event === "object" && event ); - - // Trigger bitmask: & 1 for native handlers; & 2 for jQuery (always true) - event.isTrigger = onlyHandlers ? 2 : 3; - event.namespace = namespaces.join("."); - event.namespace_re = event.namespace ? - new RegExp( "(^|\\.)" + namespaces.join("\\.(?:.*\\.|)") + "(\\.|$)" ) : - null; - - // Clean up the event in case it is being reused - event.result = undefined; - if ( !event.target ) { - event.target = elem; - } - - // Clone any incoming data and prepend the event, creating the handler arg list - data = data == null ? - [ event ] : - jQuery.makeArray( data, [ event ] ); - - // Allow special events to draw outside the lines - special = jQuery.event.special[ type ] || {}; - if ( !onlyHandlers && special.trigger && special.trigger.apply( elem, data ) === false ) { - return; - } - - // Determine event propagation path in advance, per W3C events spec (#9951) - // Bubble up to document, then to window; watch for a global ownerDocument var (#9724) - if ( !onlyHandlers && !special.noBubble && !jQuery.isWindow( elem ) ) { - - bubbleType = special.delegateType || type; - if ( !rfocusMorph.test( bubbleType + type ) ) { - cur = cur.parentNode; - } - for ( ; cur; cur = cur.parentNode ) { - eventPath.push( cur ); - tmp = cur; - } - - // Only add window if we got to document (e.g., not plain obj or detached DOM) - if ( tmp === (elem.ownerDocument || document) ) { - eventPath.push( tmp.defaultView || tmp.parentWindow || window ); - } - } - - // Fire handlers on the event path - i = 0; - while ( (cur = eventPath[i++]) && !event.isPropagationStopped() ) { - - event.type = i > 1 ? - bubbleType : - special.bindType || type; - - // jQuery handler - handle = ( jQuery._data( cur, "events" ) || {} )[ event.type ] && jQuery._data( cur, "handle" ); - if ( handle ) { - handle.apply( cur, data ); - } - - // Native handler - handle = ontype && cur[ ontype ]; - if ( handle && handle.apply && jQuery.acceptData( cur ) ) { - event.result = handle.apply( cur, data ); - if ( event.result === false ) { - event.preventDefault(); - } - } - } - event.type = type; - - // If nobody prevented the default action, do it now - if ( !onlyHandlers && !event.isDefaultPrevented() ) { - - if ( (!special._default || special._default.apply( eventPath.pop(), data ) === false) && - jQuery.acceptData( elem ) ) { - - // Call a native DOM method on the target with the same name name as the event. - // Can't use an .isFunction() check here because IE6/7 fails that test. - // Don't do default actions on window, that's where global variables be (#6170) - if ( ontype && elem[ type ] && !jQuery.isWindow( elem ) ) { - - // Don't re-trigger an onFOO event when we call its FOO() method - tmp = elem[ ontype ]; - - if ( tmp ) { - elem[ ontype ] = null; - } - - // Prevent re-triggering of the same event, since we already bubbled it above - jQuery.event.triggered = type; - try { - elem[ type ](); - } catch ( e ) { - // IE<9 dies on focus/blur to hidden element (#1486,#12518) - // only reproducible on winXP IE8 native, not IE9 in IE8 mode - } - jQuery.event.triggered = undefined; - - if ( tmp ) { - elem[ ontype ] = tmp; - } - } - } - } - - return event.result; - }, - - dispatch: function( event ) { - - // Make a writable jQuery.Event from the native event object - event = jQuery.event.fix( event ); - - var i, ret, handleObj, matched, j, - handlerQueue = [], - args = slice.call( arguments ), - handlers = ( jQuery._data( this, "events" ) || {} )[ event.type ] || [], - special = jQuery.event.special[ event.type ] || {}; - - // Use the fix-ed jQuery.Event rather than the (read-only) native event - args[0] = event; - event.delegateTarget = this; - - // Call the preDispatch hook for the mapped type, and let it bail if desired - if ( special.preDispatch && special.preDispatch.call( this, event ) === false ) { - return; - } - - // Determine handlers - handlerQueue = jQuery.event.handlers.call( this, event, handlers ); - - // Run delegates first; they may want to stop propagation beneath us - i = 0; - while ( (matched = handlerQueue[ i++ ]) && !event.isPropagationStopped() ) { - event.currentTarget = matched.elem; - - j = 0; - while ( (handleObj = matched.handlers[ j++ ]) && !event.isImmediatePropagationStopped() ) { - - // Triggered event must either 1) have no namespace, or - // 2) have namespace(s) a subset or equal to those in the bound event (both can have no namespace). - if ( !event.namespace_re || event.namespace_re.test( handleObj.namespace ) ) { - - event.handleObj = handleObj; - event.data = handleObj.data; - - ret = ( (jQuery.event.special[ handleObj.origType ] || {}).handle || handleObj.handler ) - .apply( matched.elem, args ); - - if ( ret !== undefined ) { - if ( (event.result = ret) === false ) { - event.preventDefault(); - event.stopPropagation(); - } - } - } - } - } - - // Call the postDispatch hook for the mapped type - if ( special.postDispatch ) { - special.postDispatch.call( this, event ); - } - - return event.result; - }, - - handlers: function( event, handlers ) { - var sel, handleObj, matches, i, - handlerQueue = [], - delegateCount = handlers.delegateCount, - cur = event.target; - - // Find delegate handlers - // Black-hole SVG <use> instance trees (#13180) - // Avoid non-left-click bubbling in Firefox (#3861) - if ( delegateCount && cur.nodeType && (!event.button || event.type !== "click") ) { - - /* jshint eqeqeq: false */ - for ( ; cur != this; cur = cur.parentNode || this ) { - /* jshint eqeqeq: true */ - - // Don't check non-elements (#13208) - // Don't process clicks on disabled elements (#6911, #8165, #11382, #11764) - if ( cur.nodeType === 1 && (cur.disabled !== true || event.type !== "click") ) { - matches = []; - for ( i = 0; i < delegateCount; i++ ) { - handleObj = handlers[ i ]; - - // Don't conflict with Object.prototype properties (#13203) - sel = handleObj.selector + " "; - - if ( matches[ sel ] === undefined ) { - matches[ sel ] = handleObj.needsContext ? - jQuery( sel, this ).index( cur ) >= 0 : - jQuery.find( sel, this, null, [ cur ] ).length; - } - if ( matches[ sel ] ) { - matches.push( handleObj ); - } - } - if ( matches.length ) { - handlerQueue.push({ elem: cur, handlers: matches }); - } - } - } - } - - // Add the remaining (directly-bound) handlers - if ( delegateCount < handlers.length ) { - handlerQueue.push({ elem: this, handlers: handlers.slice( delegateCount ) }); - } - - return handlerQueue; - }, - - fix: function( event ) { - if ( event[ jQuery.expando ] ) { - return event; - } - - // Create a writable copy of the event object and normalize some properties - var i, prop, copy, - type = event.type, - originalEvent = event, - fixHook = this.fixHooks[ type ]; - - if ( !fixHook ) { - this.fixHooks[ type ] = fixHook = - rmouseEvent.test( type ) ? this.mouseHooks : - rkeyEvent.test( type ) ? this.keyHooks : - {}; - } - copy = fixHook.props ? this.props.concat( fixHook.props ) : this.props; - - event = new jQuery.Event( originalEvent ); - - i = copy.length; - while ( i-- ) { - prop = copy[ i ]; - event[ prop ] = originalEvent[ prop ]; - } - - // Support: IE<9 - // Fix target property (#1925) - if ( !event.target ) { - event.target = originalEvent.srcElement || document; - } - - // Support: Chrome 23+, Safari? - // Target should not be a text node (#504, #13143) - if ( event.target.nodeType === 3 ) { - event.target = event.target.parentNode; - } - - // Support: IE<9 - // For mouse/key events, metaKey==false if it's undefined (#3368, #11328) - event.metaKey = !!event.metaKey; - - return fixHook.filter ? fixHook.filter( event, originalEvent ) : event; - }, - - // Includes some event props shared by KeyEvent and MouseEvent - props: "altKey bubbles cancelable ctrlKey currentTarget eventPhase metaKey relatedTarget shiftKey target timeStamp view which".split(" "), - - fixHooks: {}, - - keyHooks: { - props: "char charCode key keyCode".split(" "), - filter: function( event, original ) { - - // Add which for key events - if ( event.which == null ) { - event.which = original.charCode != null ? original.charCode : original.keyCode; - } - - return event; - } - }, - - mouseHooks: { - props: "button buttons clientX clientY fromElement offsetX offsetY pageX pageY screenX screenY toElement".split(" "), - filter: function( event, original ) { - var body, eventDoc, doc, - button = original.button, - fromElement = original.fromElement; - - // Calculate pageX/Y if missing and clientX/Y available - if ( event.pageX == null && original.clientX != null ) { - eventDoc = event.target.ownerDocument || document; - doc = eventDoc.documentElement; - body = eventDoc.body; - - event.pageX = original.clientX + ( doc && doc.scrollLeft || body && body.scrollLeft || 0 ) - ( doc && doc.clientLeft || body && body.clientLeft || 0 ); - event.pageY = original.clientY + ( doc && doc.scrollTop || body && body.scrollTop || 0 ) - ( doc && doc.clientTop || body && body.clientTop || 0 ); - } - - // Add relatedTarget, if necessary - if ( !event.relatedTarget && fromElement ) { - event.relatedTarget = fromElement === event.target ? original.toElement : fromElement; - } - - // Add which for click: 1 === left; 2 === middle; 3 === right - // Note: button is not normalized, so don't use it - if ( !event.which && button !== undefined ) { - event.which = ( button & 1 ? 1 : ( button & 2 ? 3 : ( button & 4 ? 2 : 0 ) ) ); - } - - return event; - } - }, - - special: { - load: { - // Prevent triggered image.load events from bubbling to window.load - noBubble: true - }, - focus: { - // Fire native event if possible so blur/focus sequence is correct - trigger: function() { - if ( this !== safeActiveElement() && this.focus ) { - try { - this.focus(); - return false; - } catch ( e ) { - // Support: IE<9 - // If we error on focus to hidden element (#1486, #12518), - // let .trigger() run the handlers - } - } - }, - delegateType: "focusin" - }, - blur: { - trigger: function() { - if ( this === safeActiveElement() && this.blur ) { - this.blur(); - return false; - } - }, - delegateType: "focusout" - }, - click: { - // For checkbox, fire native event so checked state will be right - trigger: function() { - if ( jQuery.nodeName( this, "input" ) && this.type === "checkbox" && this.click ) { - this.click(); - return false; - } - }, - - // For cross-browser consistency, don't fire native .click() on links - _default: function( event ) { - return jQuery.nodeName( event.target, "a" ); - } - }, - - beforeunload: { - postDispatch: function( event ) { - - // Support: Firefox 20+ - // Firefox doesn't alert if the returnValue field is not set. - if ( event.result !== undefined && event.originalEvent ) { - event.originalEvent.returnValue = event.result; - } - } - } - }, - - simulate: function( type, elem, event, bubble ) { - // Piggyback on a donor event to simulate a different one. - // Fake originalEvent to avoid donor's stopPropagation, but if the - // simulated event prevents default then we do the same on the donor. - var e = jQuery.extend( - new jQuery.Event(), - event, - { - type: type, - isSimulated: true, - originalEvent: {} - } - ); - if ( bubble ) { - jQuery.event.trigger( e, null, elem ); - } else { - jQuery.event.dispatch.call( elem, e ); - } - if ( e.isDefaultPrevented() ) { - event.preventDefault(); - } - } -}; - -jQuery.removeEvent = document.removeEventListener ? - function( elem, type, handle ) { - if ( elem.removeEventListener ) { - elem.removeEventListener( type, handle, false ); - } - } : - function( elem, type, handle ) { - var name = "on" + type; - - if ( elem.detachEvent ) { - - // #8545, #7054, preventing memory leaks for custom events in IE6-8 - // detachEvent needed property on element, by name of that event, to properly expose it to GC - if ( typeof elem[ name ] === strundefined ) { - elem[ name ] = null; - } - - elem.detachEvent( name, handle ); - } - }; - -jQuery.Event = function( src, props ) { - // Allow instantiation without the 'new' keyword - if ( !(this instanceof jQuery.Event) ) { - return new jQuery.Event( src, props ); - } - - // Event object - if ( src && src.type ) { - this.originalEvent = src; - this.type = src.type; - - // Events bubbling up the document may have been marked as prevented - // by a handler lower down the tree; reflect the correct value. - this.isDefaultPrevented = src.defaultPrevented || - src.defaultPrevented === undefined && - // Support: IE < 9, Android < 4.0 - src.returnValue === false ? - returnTrue : - returnFalse; - - // Event type - } else { - this.type = src; - } - - // Put explicitly provided properties onto the event object - if ( props ) { - jQuery.extend( this, props ); - } - - // Create a timestamp if incoming event doesn't have one - this.timeStamp = src && src.timeStamp || jQuery.now(); - - // Mark it as fixed - this[ jQuery.expando ] = true; -}; - -// jQuery.Event is based on DOM3 Events as specified by the ECMAScript Language Binding -// http://www.w3.org/TR/2003/WD-DOM-Level-3-Events-20030331/ecma-script-binding.html -jQuery.Event.prototype = { - isDefaultPrevented: returnFalse, - isPropagationStopped: returnFalse, - isImmediatePropagationStopped: returnFalse, - - preventDefault: function() { - var e = this.originalEvent; - - this.isDefaultPrevented = returnTrue; - if ( !e ) { - return; - } - - // If preventDefault exists, run it on the original event - if ( e.preventDefault ) { - e.preventDefault(); - - // Support: IE - // Otherwise set the returnValue property of the original event to false - } else { - e.returnValue = false; - } - }, - stopPropagation: function() { - var e = this.originalEvent; - - this.isPropagationStopped = returnTrue; - if ( !e ) { - return; - } - // If stopPropagation exists, run it on the original event - if ( e.stopPropagation ) { - e.stopPropagation(); - } - - // Support: IE - // Set the cancelBubble property of the original event to true - e.cancelBubble = true; - }, - stopImmediatePropagation: function() { - var e = this.originalEvent; - - this.isImmediatePropagationStopped = returnTrue; - - if ( e && e.stopImmediatePropagation ) { - e.stopImmediatePropagation(); - } - - this.stopPropagation(); - } -}; - -// Create mouseenter/leave events using mouseover/out and event-time checks -jQuery.each({ - mouseenter: "mouseover", - mouseleave: "mouseout", - pointerenter: "pointerover", - pointerleave: "pointerout" -}, function( orig, fix ) { - jQuery.event.special[ orig ] = { - delegateType: fix, - bindType: fix, - - handle: function( event ) { - var ret, - target = this, - related = event.relatedTarget, - handleObj = event.handleObj; - - // For mousenter/leave call the handler if related is outside the target. - // NB: No relatedTarget if the mouse left/entered the browser window - if ( !related || (related !== target && !jQuery.contains( target, related )) ) { - event.type = handleObj.origType; - ret = handleObj.handler.apply( this, arguments ); - event.type = fix; - } - return ret; - } - }; -}); - -// IE submit delegation -if ( !support.submitBubbles ) { - - jQuery.event.special.submit = { - setup: function() { - // Only need this for delegated form submit events - if ( jQuery.nodeName( this, "form" ) ) { - return false; - } - - // Lazy-add a submit handler when a descendant form may potentially be submitted - jQuery.event.add( this, "click._submit keypress._submit", function( e ) { - // Node name check avoids a VML-related crash in IE (#9807) - var elem = e.target, - form = jQuery.nodeName( elem, "input" ) || jQuery.nodeName( elem, "button" ) ? elem.form : undefined; - if ( form && !jQuery._data( form, "submitBubbles" ) ) { - jQuery.event.add( form, "submit._submit", function( event ) { - event._submit_bubble = true; - }); - jQuery._data( form, "submitBubbles", true ); - } - }); - // return undefined since we don't need an event listener - }, - - postDispatch: function( event ) { - // If form was submitted by the user, bubble the event up the tree - if ( event._submit_bubble ) { - delete event._submit_bubble; - if ( this.parentNode && !event.isTrigger ) { - jQuery.event.simulate( "submit", this.parentNode, event, true ); - } - } - }, - - teardown: function() { - // Only need this for delegated form submit events - if ( jQuery.nodeName( this, "form" ) ) { - return false; - } - - // Remove delegated handlers; cleanData eventually reaps submit handlers attached above - jQuery.event.remove( this, "._submit" ); - } - }; -} - -// IE change delegation and checkbox/radio fix -if ( !support.changeBubbles ) { - - jQuery.event.special.change = { - - setup: function() { - - if ( rformElems.test( this.nodeName ) ) { - // IE doesn't fire change on a check/radio until blur; trigger it on click - // after a propertychange. Eat the blur-change in special.change.handle. - // This still fires onchange a second time for check/radio after blur. - if ( this.type === "checkbox" || this.type === "radio" ) { - jQuery.event.add( this, "propertychange._change", function( event ) { - if ( event.originalEvent.propertyName === "checked" ) { - this._just_changed = true; - } - }); - jQuery.event.add( this, "click._change", function( event ) { - if ( this._just_changed && !event.isTrigger ) { - this._just_changed = false; - } - // Allow triggered, simulated change events (#11500) - jQuery.event.simulate( "change", this, event, true ); - }); - } - return false; - } - // Delegated event; lazy-add a change handler on descendant inputs - jQuery.event.add( this, "beforeactivate._change", function( e ) { - var elem = e.target; - - if ( rformElems.test( elem.nodeName ) && !jQuery._data( elem, "changeBubbles" ) ) { - jQuery.event.add( elem, "change._change", function( event ) { - if ( this.parentNode && !event.isSimulated && !event.isTrigger ) { - jQuery.event.simulate( "change", this.parentNode, event, true ); - } - }); - jQuery._data( elem, "changeBubbles", true ); - } - }); - }, - - handle: function( event ) { - var elem = event.target; - - // Swallow native change events from checkbox/radio, we already triggered them above - if ( this !== elem || event.isSimulated || event.isTrigger || (elem.type !== "radio" && elem.type !== "checkbox") ) { - return event.handleObj.handler.apply( this, arguments ); - } - }, - - teardown: function() { - jQuery.event.remove( this, "._change" ); - - return !rformElems.test( this.nodeName ); - } - }; -} - -// Create "bubbling" focus and blur events -if ( !support.focusinBubbles ) { - jQuery.each({ focus: "focusin", blur: "focusout" }, function( orig, fix ) { - - // Attach a single capturing handler on the document while someone wants focusin/focusout - var handler = function( event ) { - jQuery.event.simulate( fix, event.target, jQuery.event.fix( event ), true ); - }; - - jQuery.event.special[ fix ] = { - setup: function() { - var doc = this.ownerDocument || this, - attaches = jQuery._data( doc, fix ); - - if ( !attaches ) { - doc.addEventListener( orig, handler, true ); - } - jQuery._data( doc, fix, ( attaches || 0 ) + 1 ); - }, - teardown: function() { - var doc = this.ownerDocument || this, - attaches = jQuery._data( doc, fix ) - 1; - - if ( !attaches ) { - doc.removeEventListener( orig, handler, true ); - jQuery._removeData( doc, fix ); - } else { - jQuery._data( doc, fix, attaches ); - } - } - }; - }); -} - -jQuery.fn.extend({ - - on: function( types, selector, data, fn, /*INTERNAL*/ one ) { - var type, origFn; - - // Types can be a map of types/handlers - if ( typeof types === "object" ) { - // ( types-Object, selector, data ) - if ( typeof selector !== "string" ) { - // ( types-Object, data ) - data = data || selector; - selector = undefined; - } - for ( type in types ) { - this.on( type, selector, data, types[ type ], one ); - } - return this; - } - - if ( data == null && fn == null ) { - // ( types, fn ) - fn = selector; - data = selector = undefined; - } else if ( fn == null ) { - if ( typeof selector === "string" ) { - // ( types, selector, fn ) - fn = data; - data = undefined; - } else { - // ( types, data, fn ) - fn = data; - data = selector; - selector = undefined; - } - } - if ( fn === false ) { - fn = returnFalse; - } else if ( !fn ) { - return this; - } - - if ( one === 1 ) { - origFn = fn; - fn = function( event ) { - // Can use an empty set, since event contains the info - jQuery().off( event ); - return origFn.apply( this, arguments ); - }; - // Use same guid so caller can remove using origFn - fn.guid = origFn.guid || ( origFn.guid = jQuery.guid++ ); - } - return this.each( function() { - jQuery.event.add( this, types, fn, data, selector ); - }); - }, - one: function( types, selector, data, fn ) { - return this.on( types, selector, data, fn, 1 ); - }, - off: function( types, selector, fn ) { - var handleObj, type; - if ( types && types.preventDefault && types.handleObj ) { - // ( event ) dispatched jQuery.Event - handleObj = types.handleObj; - jQuery( types.delegateTarget ).off( - handleObj.namespace ? handleObj.origType + "." + handleObj.namespace : handleObj.origType, - handleObj.selector, - handleObj.handler - ); - return this; - } - if ( typeof types === "object" ) { - // ( types-object [, selector] ) - for ( type in types ) { - this.off( type, selector, types[ type ] ); - } - return this; - } - if ( selector === false || typeof selector === "function" ) { - // ( types [, fn] ) - fn = selector; - selector = undefined; - } - if ( fn === false ) { - fn = returnFalse; - } - return this.each(function() { - jQuery.event.remove( this, types, fn, selector ); - }); - }, - - trigger: function( type, data ) { - return this.each(function() { - jQuery.event.trigger( type, data, this ); - }); - }, - triggerHandler: function( type, data ) { - var elem = this[0]; - if ( elem ) { - return jQuery.event.trigger( type, data, elem, true ); - } - } -}); - - -function createSafeFragment( document ) { - var list = nodeNames.split( "|" ), - safeFrag = document.createDocumentFragment(); - - if ( safeFrag.createElement ) { - while ( list.length ) { - safeFrag.createElement( - list.pop() - ); - } - } - return safeFrag; -} - -var nodeNames = "abbr|article|aside|audio|bdi|canvas|data|datalist|details|figcaption|figure|footer|" + - "header|hgroup|mark|meter|nav|output|progress|section|summary|time|video", - rinlinejQuery = / jQuery\d+="(?:null|\d+)"/g, - rnoshimcache = new RegExp("<(?:" + nodeNames + ")[\\s/>]", "i"), - rleadingWhitespace = /^\s+/, - rxhtmlTag = /<(?!area|br|col|embed|hr|img|input|link|meta|param)(([\w:]+)[^>]*)\/>/gi, - rtagName = /<([\w:]+)/, - rtbody = /<tbody/i, - rhtml = /<|&#?\w+;/, - rnoInnerhtml = /<(?:script|style|link)/i, - // checked="checked" or checked - rchecked = /checked\s*(?:[^=]|=\s*.checked.)/i, - rscriptType = /^$|\/(?:java|ecma)script/i, - rscriptTypeMasked = /^true\/(.*)/, - rcleanScript = /^\s*<!(?:\[CDATA\[|--)|(?:\]\]|--)>\s*$/g, - - // We have to close these tags to support XHTML (#13200) - wrapMap = { - option: [ 1, "<select multiple='multiple'>", "</select>" ], - legend: [ 1, "<fieldset>", "</fieldset>" ], - area: [ 1, "<map>", "</map>" ], - param: [ 1, "<object>", "</object>" ], - thead: [ 1, "<table>", "</table>" ], - tr: [ 2, "<table><tbody>", "</tbody></table>" ], - col: [ 2, "<table><tbody></tbody><colgroup>", "</colgroup></table>" ], - td: [ 3, "<table><tbody><tr>", "</tr></tbody></table>" ], - - // IE6-8 can't serialize link, script, style, or any html5 (NoScope) tags, - // unless wrapped in a div with non-breaking characters in front of it. - _default: support.htmlSerialize ? [ 0, "", "" ] : [ 1, "X<div>", "</div>" ] - }, - safeFragment = createSafeFragment( document ), - fragmentDiv = safeFragment.appendChild( document.createElement("div") ); - -wrapMap.optgroup = wrapMap.option; -wrapMap.tbody = wrapMap.tfoot = wrapMap.colgroup = wrapMap.caption = wrapMap.thead; -wrapMap.th = wrapMap.td; - -function getAll( context, tag ) { - var elems, elem, - i = 0, - found = typeof context.getElementsByTagName !== strundefined ? context.getElementsByTagName( tag || "*" ) : - typeof context.querySelectorAll !== strundefined ? context.querySelectorAll( tag || "*" ) : - undefined; - - if ( !found ) { - for ( found = [], elems = context.childNodes || context; (elem = elems[i]) != null; i++ ) { - if ( !tag || jQuery.nodeName( elem, tag ) ) { - found.push( elem ); - } else { - jQuery.merge( found, getAll( elem, tag ) ); - } - } - } - - return tag === undefined || tag && jQuery.nodeName( context, tag ) ? - jQuery.merge( [ context ], found ) : - found; -} - -// Used in buildFragment, fixes the defaultChecked property -function fixDefaultChecked( elem ) { - if ( rcheckableType.test( elem.type ) ) { - elem.defaultChecked = elem.checked; - } -} - -// Support: IE<8 -// Manipulating tables requires a tbody -function manipulationTarget( elem, content ) { - return jQuery.nodeName( elem, "table" ) && - jQuery.nodeName( content.nodeType !== 11 ? content : content.firstChild, "tr" ) ? - - elem.getElementsByTagName("tbody")[0] || - elem.appendChild( elem.ownerDocument.createElement("tbody") ) : - elem; -} - -// Replace/restore the type attribute of script elements for safe DOM manipulation -function disableScript( elem ) { - elem.type = (jQuery.find.attr( elem, "type" ) !== null) + "/" + elem.type; - return elem; -} -function restoreScript( elem ) { - var match = rscriptTypeMasked.exec( elem.type ); - if ( match ) { - elem.type = match[1]; - } else { - elem.removeAttribute("type"); - } - return elem; -} - -// Mark scripts as having already been evaluated -function setGlobalEval( elems, refElements ) { - var elem, - i = 0; - for ( ; (elem = elems[i]) != null; i++ ) { - jQuery._data( elem, "globalEval", !refElements || jQuery._data( refElements[i], "globalEval" ) ); - } -} - -function cloneCopyEvent( src, dest ) { - - if ( dest.nodeType !== 1 || !jQuery.hasData( src ) ) { - return; - } - - var type, i, l, - oldData = jQuery._data( src ), - curData = jQuery._data( dest, oldData ), - events = oldData.events; - - if ( events ) { - delete curData.handle; - curData.events = {}; - - for ( type in events ) { - for ( i = 0, l = events[ type ].length; i < l; i++ ) { - jQuery.event.add( dest, type, events[ type ][ i ] ); - } - } - } - - // make the cloned public data object a copy from the original - if ( curData.data ) { - curData.data = jQuery.extend( {}, curData.data ); - } -} - -function fixCloneNodeIssues( src, dest ) { - var nodeName, e, data; - - // We do not need to do anything for non-Elements - if ( dest.nodeType !== 1 ) { - return; - } - - nodeName = dest.nodeName.toLowerCase(); - - // IE6-8 copies events bound via attachEvent when using cloneNode. - if ( !support.noCloneEvent && dest[ jQuery.expando ] ) { - data = jQuery._data( dest ); - - for ( e in data.events ) { - jQuery.removeEvent( dest, e, data.handle ); - } - - // Event data gets referenced instead of copied if the expando gets copied too - dest.removeAttribute( jQuery.expando ); - } - - // IE blanks contents when cloning scripts, and tries to evaluate newly-set text - if ( nodeName === "script" && dest.text !== src.text ) { - disableScript( dest ).text = src.text; - restoreScript( dest ); - - // IE6-10 improperly clones children of object elements using classid. - // IE10 throws NoModificationAllowedError if parent is null, #12132. - } else if ( nodeName === "object" ) { - if ( dest.parentNode ) { - dest.outerHTML = src.outerHTML; - } - - // This path appears unavoidable for IE9. When cloning an object - // element in IE9, the outerHTML strategy above is not sufficient. - // If the src has innerHTML and the destination does not, - // copy the src.innerHTML into the dest.innerHTML. #10324 - if ( support.html5Clone && ( src.innerHTML && !jQuery.trim(dest.innerHTML) ) ) { - dest.innerHTML = src.innerHTML; - } - - } else if ( nodeName === "input" && rcheckableType.test( src.type ) ) { - // IE6-8 fails to persist the checked state of a cloned checkbox - // or radio button. Worse, IE6-7 fail to give the cloned element - // a checked appearance if the defaultChecked value isn't also set - - dest.defaultChecked = dest.checked = src.checked; - - // IE6-7 get confused and end up setting the value of a cloned - // checkbox/radio button to an empty string instead of "on" - if ( dest.value !== src.value ) { - dest.value = src.value; - } - - // IE6-8 fails to return the selected option to the default selected - // state when cloning options - } else if ( nodeName === "option" ) { - dest.defaultSelected = dest.selected = src.defaultSelected; - - // IE6-8 fails to set the defaultValue to the correct value when - // cloning other types of input fields - } else if ( nodeName === "input" || nodeName === "textarea" ) { - dest.defaultValue = src.defaultValue; - } -} - -jQuery.extend({ - clone: function( elem, dataAndEvents, deepDataAndEvents ) { - var destElements, node, clone, i, srcElements, - inPage = jQuery.contains( elem.ownerDocument, elem ); - - if ( support.html5Clone || jQuery.isXMLDoc(elem) || !rnoshimcache.test( "<" + elem.nodeName + ">" ) ) { - clone = elem.cloneNode( true ); - - // IE<=8 does not properly clone detached, unknown element nodes - } else { - fragmentDiv.innerHTML = elem.outerHTML; - fragmentDiv.removeChild( clone = fragmentDiv.firstChild ); - } - - if ( (!support.noCloneEvent || !support.noCloneChecked) && - (elem.nodeType === 1 || elem.nodeType === 11) && !jQuery.isXMLDoc(elem) ) { - - // We eschew Sizzle here for performance reasons: http://jsperf.com/getall-vs-sizzle/2 - destElements = getAll( clone ); - srcElements = getAll( elem ); - - // Fix all IE cloning issues - for ( i = 0; (node = srcElements[i]) != null; ++i ) { - // Ensure that the destination node is not null; Fixes #9587 - if ( destElements[i] ) { - fixCloneNodeIssues( node, destElements[i] ); - } - } - } - - // Copy the events from the original to the clone - if ( dataAndEvents ) { - if ( deepDataAndEvents ) { - srcElements = srcElements || getAll( elem ); - destElements = destElements || getAll( clone ); - - for ( i = 0; (node = srcElements[i]) != null; i++ ) { - cloneCopyEvent( node, destElements[i] ); - } - } else { - cloneCopyEvent( elem, clone ); - } - } - - // Preserve script evaluation history - destElements = getAll( clone, "script" ); - if ( destElements.length > 0 ) { - setGlobalEval( destElements, !inPage && getAll( elem, "script" ) ); - } - - destElements = srcElements = node = null; - - // Return the cloned set - return clone; - }, - - buildFragment: function( elems, context, scripts, selection ) { - var j, elem, contains, - tmp, tag, tbody, wrap, - l = elems.length, - - // Ensure a safe fragment - safe = createSafeFragment( context ), - - nodes = [], - i = 0; - - for ( ; i < l; i++ ) { - elem = elems[ i ]; - - if ( elem || elem === 0 ) { - - // Add nodes directly - if ( jQuery.type( elem ) === "object" ) { - jQuery.merge( nodes, elem.nodeType ? [ elem ] : elem ); - - // Convert non-html into a text node - } else if ( !rhtml.test( elem ) ) { - nodes.push( context.createTextNode( elem ) ); - - // Convert html into DOM nodes - } else { - tmp = tmp || safe.appendChild( context.createElement("div") ); - - // Deserialize a standard representation - tag = (rtagName.exec( elem ) || [ "", "" ])[ 1 ].toLowerCase(); - wrap = wrapMap[ tag ] || wrapMap._default; - - tmp.innerHTML = wrap[1] + elem.replace( rxhtmlTag, "<$1></$2>" ) + wrap[2]; - - // Descend through wrappers to the right content - j = wrap[0]; - while ( j-- ) { - tmp = tmp.lastChild; - } - - // Manually add leading whitespace removed by IE - if ( !support.leadingWhitespace && rleadingWhitespace.test( elem ) ) { - nodes.push( context.createTextNode( rleadingWhitespace.exec( elem )[0] ) ); - } - - // Remove IE's autoinserted <tbody> from table fragments - if ( !support.tbody ) { - - // String was a <table>, *may* have spurious <tbody> - elem = tag === "table" && !rtbody.test( elem ) ? - tmp.firstChild : - - // String was a bare <thead> or <tfoot> - wrap[1] === "<table>" && !rtbody.test( elem ) ? - tmp : - 0; - - j = elem && elem.childNodes.length; - while ( j-- ) { - if ( jQuery.nodeName( (tbody = elem.childNodes[j]), "tbody" ) && !tbody.childNodes.length ) { - elem.removeChild( tbody ); - } - } - } - - jQuery.merge( nodes, tmp.childNodes ); - - // Fix #12392 for WebKit and IE > 9 - tmp.textContent = ""; - - // Fix #12392 for oldIE - while ( tmp.firstChild ) { - tmp.removeChild( tmp.firstChild ); - } - - // Remember the top-level container for proper cleanup - tmp = safe.lastChild; - } - } - } - - // Fix #11356: Clear elements from fragment - if ( tmp ) { - safe.removeChild( tmp ); - } - - // Reset defaultChecked for any radios and checkboxes - // about to be appended to the DOM in IE 6/7 (#8060) - if ( !support.appendChecked ) { - jQuery.grep( getAll( nodes, "input" ), fixDefaultChecked ); - } - - i = 0; - while ( (elem = nodes[ i++ ]) ) { - - // #4087 - If origin and destination elements are the same, and this is - // that element, do not do anything - if ( selection && jQuery.inArray( elem, selection ) !== -1 ) { - continue; - } - - contains = jQuery.contains( elem.ownerDocument, elem ); - - // Append to fragment - tmp = getAll( safe.appendChild( elem ), "script" ); - - // Preserve script evaluation history - if ( contains ) { - setGlobalEval( tmp ); - } - - // Capture executables - if ( scripts ) { - j = 0; - while ( (elem = tmp[ j++ ]) ) { - if ( rscriptType.test( elem.type || "" ) ) { - scripts.push( elem ); - } - } - } - } - - tmp = null; - - return safe; - }, - - cleanData: function( elems, /* internal */ acceptData ) { - var elem, type, id, data, - i = 0, - internalKey = jQuery.expando, - cache = jQuery.cache, - deleteExpando = support.deleteExpando, - special = jQuery.event.special; - - for ( ; (elem = elems[i]) != null; i++ ) { - if ( acceptData || jQuery.acceptData( elem ) ) { - - id = elem[ internalKey ]; - data = id && cache[ id ]; - - if ( data ) { - if ( data.events ) { - for ( type in data.events ) { - if ( special[ type ] ) { - jQuery.event.remove( elem, type ); - - // This is a shortcut to avoid jQuery.event.remove's overhead - } else { - jQuery.removeEvent( elem, type, data.handle ); - } - } - } - - // Remove cache only if it was not already removed by jQuery.event.remove - if ( cache[ id ] ) { - - delete cache[ id ]; - - // IE does not allow us to delete expando properties from nodes, - // nor does it have a removeAttribute function on Document nodes; - // we must handle all of these cases - if ( deleteExpando ) { - delete elem[ internalKey ]; - - } else if ( typeof elem.removeAttribute !== strundefined ) { - elem.removeAttribute( internalKey ); - - } else { - elem[ internalKey ] = null; - } - - deletedIds.push( id ); - } - } - } - } - } -}); - -jQuery.fn.extend({ - text: function( value ) { - return access( this, function( value ) { - return value === undefined ? - jQuery.text( this ) : - this.empty().append( ( this[0] && this[0].ownerDocument || document ).createTextNode( value ) ); - }, null, value, arguments.length ); - }, - - append: function() { - return this.domManip( arguments, function( elem ) { - if ( this.nodeType === 1 || this.nodeType === 11 || this.nodeType === 9 ) { - var target = manipulationTarget( this, elem ); - target.appendChild( elem ); - } - }); - }, - - prepend: function() { - return this.domManip( arguments, function( elem ) { - if ( this.nodeType === 1 || this.nodeType === 11 || this.nodeType === 9 ) { - var target = manipulationTarget( this, elem ); - target.insertBefore( elem, target.firstChild ); - } - }); - }, - - before: function() { - return this.domManip( arguments, function( elem ) { - if ( this.parentNode ) { - this.parentNode.insertBefore( elem, this ); - } - }); - }, - - after: function() { - return this.domManip( arguments, function( elem ) { - if ( this.parentNode ) { - this.parentNode.insertBefore( elem, this.nextSibling ); - } - }); - }, - - remove: function( selector, keepData /* Internal Use Only */ ) { - var elem, - elems = selector ? jQuery.filter( selector, this ) : this, - i = 0; - - for ( ; (elem = elems[i]) != null; i++ ) { - - if ( !keepData && elem.nodeType === 1 ) { - jQuery.cleanData( getAll( elem ) ); - } - - if ( elem.parentNode ) { - if ( keepData && jQuery.contains( elem.ownerDocument, elem ) ) { - setGlobalEval( getAll( elem, "script" ) ); - } - elem.parentNode.removeChild( elem ); - } - } - - return this; - }, - - empty: function() { - var elem, - i = 0; - - for ( ; (elem = this[i]) != null; i++ ) { - // Remove element nodes and prevent memory leaks - if ( elem.nodeType === 1 ) { - jQuery.cleanData( getAll( elem, false ) ); - } - - // Remove any remaining nodes - while ( elem.firstChild ) { - elem.removeChild( elem.firstChild ); - } - - // If this is a select, ensure that it displays empty (#12336) - // Support: IE<9 - if ( elem.options && jQuery.nodeName( elem, "select" ) ) { - elem.options.length = 0; - } - } - - return this; - }, - - clone: function( dataAndEvents, deepDataAndEvents ) { - dataAndEvents = dataAndEvents == null ? false : dataAndEvents; - deepDataAndEvents = deepDataAndEvents == null ? dataAndEvents : deepDataAndEvents; - - return this.map(function() { - return jQuery.clone( this, dataAndEvents, deepDataAndEvents ); - }); - }, - - html: function( value ) { - return access( this, function( value ) { - var elem = this[ 0 ] || {}, - i = 0, - l = this.length; - - if ( value === undefined ) { - return elem.nodeType === 1 ? - elem.innerHTML.replace( rinlinejQuery, "" ) : - undefined; - } - - // See if we can take a shortcut and just use innerHTML - if ( typeof value === "string" && !rnoInnerhtml.test( value ) && - ( support.htmlSerialize || !rnoshimcache.test( value ) ) && - ( support.leadingWhitespace || !rleadingWhitespace.test( value ) ) && - !wrapMap[ (rtagName.exec( value ) || [ "", "" ])[ 1 ].toLowerCase() ] ) { - - value = value.replace( rxhtmlTag, "<$1></$2>" ); - - try { - for (; i < l; i++ ) { - // Remove element nodes and prevent memory leaks - elem = this[i] || {}; - if ( elem.nodeType === 1 ) { - jQuery.cleanData( getAll( elem, false ) ); - elem.innerHTML = value; - } - } - - elem = 0; - - // If using innerHTML throws an exception, use the fallback method - } catch(e) {} - } - - if ( elem ) { - this.empty().append( value ); - } - }, null, value, arguments.length ); - }, - - replaceWith: function() { - var arg = arguments[ 0 ]; - - // Make the changes, replacing each context element with the new content - this.domManip( arguments, function( elem ) { - arg = this.parentNode; - - jQuery.cleanData( getAll( this ) ); - - if ( arg ) { - arg.replaceChild( elem, this ); - } - }); - - // Force removal if there was no new content (e.g., from empty arguments) - return arg && (arg.length || arg.nodeType) ? this : this.remove(); - }, - - detach: function( selector ) { - return this.remove( selector, true ); - }, - - domManip: function( args, callback ) { - - // Flatten any nested arrays - args = concat.apply( [], args ); - - var first, node, hasScripts, - scripts, doc, fragment, - i = 0, - l = this.length, - set = this, - iNoClone = l - 1, - value = args[0], - isFunction = jQuery.isFunction( value ); - - // We can't cloneNode fragments that contain checked, in WebKit - if ( isFunction || - ( l > 1 && typeof value === "string" && - !support.checkClone && rchecked.test( value ) ) ) { - return this.each(function( index ) { - var self = set.eq( index ); - if ( isFunction ) { - args[0] = value.call( this, index, self.html() ); - } - self.domManip( args, callback ); - }); - } - - if ( l ) { - fragment = jQuery.buildFragment( args, this[ 0 ].ownerDocument, false, this ); - first = fragment.firstChild; - - if ( fragment.childNodes.length === 1 ) { - fragment = first; - } - - if ( first ) { - scripts = jQuery.map( getAll( fragment, "script" ), disableScript ); - hasScripts = scripts.length; - - // Use the original fragment for the last item instead of the first because it can end up - // being emptied incorrectly in certain situations (#8070). - for ( ; i < l; i++ ) { - node = fragment; - - if ( i !== iNoClone ) { - node = jQuery.clone( node, true, true ); - - // Keep references to cloned scripts for later restoration - if ( hasScripts ) { - jQuery.merge( scripts, getAll( node, "script" ) ); - } - } - - callback.call( this[i], node, i ); - } - - if ( hasScripts ) { - doc = scripts[ scripts.length - 1 ].ownerDocument; - - // Reenable scripts - jQuery.map( scripts, restoreScript ); - - // Evaluate executable scripts on first document insertion - for ( i = 0; i < hasScripts; i++ ) { - node = scripts[ i ]; - if ( rscriptType.test( node.type || "" ) && - !jQuery._data( node, "globalEval" ) && jQuery.contains( doc, node ) ) { - - if ( node.src ) { - // Optional AJAX dependency, but won't run scripts if not present - if ( jQuery._evalUrl ) { - jQuery._evalUrl( node.src ); - } - } else { - jQuery.globalEval( ( node.text || node.textContent || node.innerHTML || "" ).replace( rcleanScript, "" ) ); - } - } - } - } - - // Fix #11809: Avoid leaking memory - fragment = first = null; - } - } - - return this; - } -}); - -jQuery.each({ - appendTo: "append", - prependTo: "prepend", - insertBefore: "before", - insertAfter: "after", - replaceAll: "replaceWith" -}, function( name, original ) { - jQuery.fn[ name ] = function( selector ) { - var elems, - i = 0, - ret = [], - insert = jQuery( selector ), - last = insert.length - 1; - - for ( ; i <= last; i++ ) { - elems = i === last ? this : this.clone(true); - jQuery( insert[i] )[ original ]( elems ); - - // Modern browsers can apply jQuery collections as arrays, but oldIE needs a .get() - push.apply( ret, elems.get() ); - } - - return this.pushStack( ret ); - }; -}); - - -var iframe, - elemdisplay = {}; - -/** - * Retrieve the actual display of a element - * @param {String} name nodeName of the element - * @param {Object} doc Document object - */ -// Called only from within defaultDisplay -function actualDisplay( name, doc ) { - var style, - elem = jQuery( doc.createElement( name ) ).appendTo( doc.body ), - - // getDefaultComputedStyle might be reliably used only on attached element - display = window.getDefaultComputedStyle && ( style = window.getDefaultComputedStyle( elem[ 0 ] ) ) ? - - // Use of this method is a temporary fix (more like optmization) until something better comes along, - // since it was removed from specification and supported only in FF - style.display : jQuery.css( elem[ 0 ], "display" ); - - // We don't have any data stored on the element, - // so use "detach" method as fast way to get rid of the element - elem.detach(); - - return display; -} - -/** - * Try to determine the default display value of an element - * @param {String} nodeName - */ -function defaultDisplay( nodeName ) { - var doc = document, - display = elemdisplay[ nodeName ]; - - if ( !display ) { - display = actualDisplay( nodeName, doc ); - - // If the simple way fails, read from inside an iframe - if ( display === "none" || !display ) { - - // Use the already-created iframe if possible - iframe = (iframe || jQuery( "<iframe frameborder='0' width='0' height='0'/>" )).appendTo( doc.documentElement ); - - // Always write a new HTML skeleton so Webkit and Firefox don't choke on reuse - doc = ( iframe[ 0 ].contentWindow || iframe[ 0 ].contentDocument ).document; - - // Support: IE - doc.write(); - doc.close(); - - display = actualDisplay( nodeName, doc ); - iframe.detach(); - } - - // Store the correct default display - elemdisplay[ nodeName ] = display; - } - - return display; -} - - -(function() { - var shrinkWrapBlocksVal; - - support.shrinkWrapBlocks = function() { - if ( shrinkWrapBlocksVal != null ) { - return shrinkWrapBlocksVal; - } - - // Will be changed later if needed. - shrinkWrapBlocksVal = false; - - // Minified: var b,c,d - var div, body, container; - - body = document.getElementsByTagName( "body" )[ 0 ]; - if ( !body || !body.style ) { - // Test fired too early or in an unsupported environment, exit. - return; - } - - // Setup - div = document.createElement( "div" ); - container = document.createElement( "div" ); - container.style.cssText = "position:absolute;border:0;width:0;height:0;top:0;left:-9999px"; - body.appendChild( container ).appendChild( div ); - - // Support: IE6 - // Check if elements with layout shrink-wrap their children - if ( typeof div.style.zoom !== strundefined ) { - // Reset CSS: box-sizing; display; margin; border - div.style.cssText = - // Support: Firefox<29, Android 2.3 - // Vendor-prefix box-sizing - "-webkit-box-sizing:content-box;-moz-box-sizing:content-box;" + - "box-sizing:content-box;display:block;margin:0;border:0;" + - "padding:1px;width:1px;zoom:1"; - div.appendChild( document.createElement( "div" ) ).style.width = "5px"; - shrinkWrapBlocksVal = div.offsetWidth !== 3; - } - - body.removeChild( container ); - - return shrinkWrapBlocksVal; - }; - -})(); -var rmargin = (/^margin/); - -var rnumnonpx = new RegExp( "^(" + pnum + ")(?!px)[a-z%]+$", "i" ); - - - -var getStyles, curCSS, - rposition = /^(top|right|bottom|left)$/; - -if ( window.getComputedStyle ) { - getStyles = function( elem ) { - // Support: IE<=11+, Firefox<=30+ (#15098, #14150) - // IE throws on elements created in popups - // FF meanwhile throws on frame elements through "defaultView.getComputedStyle" - if ( elem.ownerDocument.defaultView.opener ) { - return elem.ownerDocument.defaultView.getComputedStyle( elem, null ); - } - - return window.getComputedStyle( elem, null ); - }; - - curCSS = function( elem, name, computed ) { - var width, minWidth, maxWidth, ret, - style = elem.style; - - computed = computed || getStyles( elem ); - - // getPropertyValue is only needed for .css('filter') in IE9, see #12537 - ret = computed ? computed.getPropertyValue( name ) || computed[ name ] : undefined; - - if ( computed ) { - - if ( ret === "" && !jQuery.contains( elem.ownerDocument, elem ) ) { - ret = jQuery.style( elem, name ); - } - - // A tribute to the "awesome hack by Dean Edwards" - // Chrome < 17 and Safari 5.0 uses "computed value" instead of "used value" for margin-right - // Safari 5.1.7 (at least) returns percentage for a larger set of values, but width seems to be reliably pixels - // this is against the CSSOM draft spec: http://dev.w3.org/csswg/cssom/#resolved-values - if ( rnumnonpx.test( ret ) && rmargin.test( name ) ) { - - // Remember the original values - width = style.width; - minWidth = style.minWidth; - maxWidth = style.maxWidth; - - // Put in the new values to get a computed value out - style.minWidth = style.maxWidth = style.width = ret; - ret = computed.width; - - // Revert the changed values - style.width = width; - style.minWidth = minWidth; - style.maxWidth = maxWidth; - } - } - - // Support: IE - // IE returns zIndex value as an integer. - return ret === undefined ? - ret : - ret + ""; - }; -} else if ( document.documentElement.currentStyle ) { - getStyles = function( elem ) { - return elem.currentStyle; - }; - - curCSS = function( elem, name, computed ) { - var left, rs, rsLeft, ret, - style = elem.style; - - computed = computed || getStyles( elem ); - ret = computed ? computed[ name ] : undefined; - - // Avoid setting ret to empty string here - // so we don't default to auto - if ( ret == null && style && style[ name ] ) { - ret = style[ name ]; - } - - // From the awesome hack by Dean Edwards - // http://erik.eae.net/archives/2007/07/27/18.54.15/#comment-102291 - - // If we're not dealing with a regular pixel number - // but a number that has a weird ending, we need to convert it to pixels - // but not position css attributes, as those are proportional to the parent element instead - // and we can't measure the parent instead because it might trigger a "stacking dolls" problem - if ( rnumnonpx.test( ret ) && !rposition.test( name ) ) { - - // Remember the original values - left = style.left; - rs = elem.runtimeStyle; - rsLeft = rs && rs.left; - - // Put in the new values to get a computed value out - if ( rsLeft ) { - rs.left = elem.currentStyle.left; - } - style.left = name === "fontSize" ? "1em" : ret; - ret = style.pixelLeft + "px"; - - // Revert the changed values - style.left = left; - if ( rsLeft ) { - rs.left = rsLeft; - } - } - - // Support: IE - // IE returns zIndex value as an integer. - return ret === undefined ? - ret : - ret + "" || "auto"; - }; -} - - - - -function addGetHookIf( conditionFn, hookFn ) { - // Define the hook, we'll check on the first run if it's really needed. - return { - get: function() { - var condition = conditionFn(); - - if ( condition == null ) { - // The test was not ready at this point; screw the hook this time - // but check again when needed next time. - return; - } - - if ( condition ) { - // Hook not needed (or it's not possible to use it due to missing dependency), - // remove it. - // Since there are no other hooks for marginRight, remove the whole object. - delete this.get; - return; - } - - // Hook needed; redefine it so that the support test is not executed again. - - return (this.get = hookFn).apply( this, arguments ); - } - }; -} - - -(function() { - // Minified: var b,c,d,e,f,g, h,i - var div, style, a, pixelPositionVal, boxSizingReliableVal, - reliableHiddenOffsetsVal, reliableMarginRightVal; - - // Setup - div = document.createElement( "div" ); - div.innerHTML = " <link/><table></table><a href='/a'>a</a><input type='checkbox'/>"; - a = div.getElementsByTagName( "a" )[ 0 ]; - style = a && a.style; - - // Finish early in limited (non-browser) environments - if ( !style ) { - return; - } - - style.cssText = "float:left;opacity:.5"; - - // Support: IE<9 - // Make sure that element opacity exists (as opposed to filter) - support.opacity = style.opacity === "0.5"; - - // Verify style float existence - // (IE uses styleFloat instead of cssFloat) - support.cssFloat = !!style.cssFloat; - - div.style.backgroundClip = "content-box"; - div.cloneNode( true ).style.backgroundClip = ""; - support.clearCloneStyle = div.style.backgroundClip === "content-box"; - - // Support: Firefox<29, Android 2.3 - // Vendor-prefix box-sizing - support.boxSizing = style.boxSizing === "" || style.MozBoxSizing === "" || - style.WebkitBoxSizing === ""; - - jQuery.extend(support, { - reliableHiddenOffsets: function() { - if ( reliableHiddenOffsetsVal == null ) { - computeStyleTests(); - } - return reliableHiddenOffsetsVal; - }, - - boxSizingReliable: function() { - if ( boxSizingReliableVal == null ) { - computeStyleTests(); - } - return boxSizingReliableVal; - }, - - pixelPosition: function() { - if ( pixelPositionVal == null ) { - computeStyleTests(); - } - return pixelPositionVal; - }, - - // Support: Android 2.3 - reliableMarginRight: function() { - if ( reliableMarginRightVal == null ) { - computeStyleTests(); - } - return reliableMarginRightVal; - } - }); - - function computeStyleTests() { - // Minified: var b,c,d,j - var div, body, container, contents; - - body = document.getElementsByTagName( "body" )[ 0 ]; - if ( !body || !body.style ) { - // Test fired too early or in an unsupported environment, exit. - return; - } - - // Setup - div = document.createElement( "div" ); - container = document.createElement( "div" ); - container.style.cssText = "position:absolute;border:0;width:0;height:0;top:0;left:-9999px"; - body.appendChild( container ).appendChild( div ); - - div.style.cssText = - // Support: Firefox<29, Android 2.3 - // Vendor-prefix box-sizing - "-webkit-box-sizing:border-box;-moz-box-sizing:border-box;" + - "box-sizing:border-box;display:block;margin-top:1%;top:1%;" + - "border:1px;padding:1px;width:4px;position:absolute"; - - // Support: IE<9 - // Assume reasonable values in the absence of getComputedStyle - pixelPositionVal = boxSizingReliableVal = false; - reliableMarginRightVal = true; - - // Check for getComputedStyle so that this code is not run in IE<9. - if ( window.getComputedStyle ) { - pixelPositionVal = ( window.getComputedStyle( div, null ) || {} ).top !== "1%"; - boxSizingReliableVal = - ( window.getComputedStyle( div, null ) || { width: "4px" } ).width === "4px"; - - // Support: Android 2.3 - // Div with explicit width and no margin-right incorrectly - // gets computed margin-right based on width of container (#3333) - // WebKit Bug 13343 - getComputedStyle returns wrong value for margin-right - contents = div.appendChild( document.createElement( "div" ) ); - - // Reset CSS: box-sizing; display; margin; border; padding - contents.style.cssText = div.style.cssText = - // Support: Firefox<29, Android 2.3 - // Vendor-prefix box-sizing - "-webkit-box-sizing:content-box;-moz-box-sizing:content-box;" + - "box-sizing:content-box;display:block;margin:0;border:0;padding:0"; - contents.style.marginRight = contents.style.width = "0"; - div.style.width = "1px"; - - reliableMarginRightVal = - !parseFloat( ( window.getComputedStyle( contents, null ) || {} ).marginRight ); - - div.removeChild( contents ); - } - - // Support: IE8 - // Check if table cells still have offsetWidth/Height when they are set - // to display:none and there are still other visible table cells in a - // table row; if so, offsetWidth/Height are not reliable for use when - // determining if an element has been hidden directly using - // display:none (it is still safe to use offsets if a parent element is - // hidden; don safety goggles and see bug #4512 for more information). - div.innerHTML = "<table><tr><td></td><td>t</td></tr></table>"; - contents = div.getElementsByTagName( "td" ); - contents[ 0 ].style.cssText = "margin:0;border:0;padding:0;display:none"; - reliableHiddenOffsetsVal = contents[ 0 ].offsetHeight === 0; - if ( reliableHiddenOffsetsVal ) { - contents[ 0 ].style.display = ""; - contents[ 1 ].style.display = "none"; - reliableHiddenOffsetsVal = contents[ 0 ].offsetHeight === 0; - } - - body.removeChild( container ); - } - -})(); - - -// A method for quickly swapping in/out CSS properties to get correct calculations. -jQuery.swap = function( elem, options, callback, args ) { - var ret, name, - old = {}; - - // Remember the old values, and insert the new ones - for ( name in options ) { - old[ name ] = elem.style[ name ]; - elem.style[ name ] = options[ name ]; - } - - ret = callback.apply( elem, args || [] ); - - // Revert the old values - for ( name in options ) { - elem.style[ name ] = old[ name ]; - } - - return ret; -}; - - -var - ralpha = /alpha\([^)]*\)/i, - ropacity = /opacity\s*=\s*([^)]*)/, - - // swappable if display is none or starts with table except "table", "table-cell", or "table-caption" - // see here for display values: https://developer.mozilla.org/en-US/docs/CSS/display - rdisplayswap = /^(none|table(?!-c[ea]).+)/, - rnumsplit = new RegExp( "^(" + pnum + ")(.*)$", "i" ), - rrelNum = new RegExp( "^([+-])=(" + pnum + ")", "i" ), - - cssShow = { position: "absolute", visibility: "hidden", display: "block" }, - cssNormalTransform = { - letterSpacing: "0", - fontWeight: "400" - }, - - cssPrefixes = [ "Webkit", "O", "Moz", "ms" ]; - - -// return a css property mapped to a potentially vendor prefixed property -function vendorPropName( style, name ) { - - // shortcut for names that are not vendor prefixed - if ( name in style ) { - return name; - } - - // check for vendor prefixed names - var capName = name.charAt(0).toUpperCase() + name.slice(1), - origName = name, - i = cssPrefixes.length; - - while ( i-- ) { - name = cssPrefixes[ i ] + capName; - if ( name in style ) { - return name; - } - } - - return origName; -} - -function showHide( elements, show ) { - var display, elem, hidden, - values = [], - index = 0, - length = elements.length; - - for ( ; index < length; index++ ) { - elem = elements[ index ]; - if ( !elem.style ) { - continue; - } - - values[ index ] = jQuery._data( elem, "olddisplay" ); - display = elem.style.display; - if ( show ) { - // Reset the inline display of this element to learn if it is - // being hidden by cascaded rules or not - if ( !values[ index ] && display === "none" ) { - elem.style.display = ""; - } - - // Set elements which have been overridden with display: none - // in a stylesheet to whatever the default browser style is - // for such an element - if ( elem.style.display === "" && isHidden( elem ) ) { - values[ index ] = jQuery._data( elem, "olddisplay", defaultDisplay(elem.nodeName) ); - } - } else { - hidden = isHidden( elem ); - - if ( display && display !== "none" || !hidden ) { - jQuery._data( elem, "olddisplay", hidden ? display : jQuery.css( elem, "display" ) ); - } - } - } - - // Set the display of most of the elements in a second loop - // to avoid the constant reflow - for ( index = 0; index < length; index++ ) { - elem = elements[ index ]; - if ( !elem.style ) { - continue; - } - if ( !show || elem.style.display === "none" || elem.style.display === "" ) { - elem.style.display = show ? values[ index ] || "" : "none"; - } - } - - return elements; -} - -function setPositiveNumber( elem, value, subtract ) { - var matches = rnumsplit.exec( value ); - return matches ? - // Guard against undefined "subtract", e.g., when used as in cssHooks - Math.max( 0, matches[ 1 ] - ( subtract || 0 ) ) + ( matches[ 2 ] || "px" ) : - value; -} - -function augmentWidthOrHeight( elem, name, extra, isBorderBox, styles ) { - var i = extra === ( isBorderBox ? "border" : "content" ) ? - // If we already have the right measurement, avoid augmentation - 4 : - // Otherwise initialize for horizontal or vertical properties - name === "width" ? 1 : 0, - - val = 0; - - for ( ; i < 4; i += 2 ) { - // both box models exclude margin, so add it if we want it - if ( extra === "margin" ) { - val += jQuery.css( elem, extra + cssExpand[ i ], true, styles ); - } - - if ( isBorderBox ) { - // border-box includes padding, so remove it if we want content - if ( extra === "content" ) { - val -= jQuery.css( elem, "padding" + cssExpand[ i ], true, styles ); - } - - // at this point, extra isn't border nor margin, so remove border - if ( extra !== "margin" ) { - val -= jQuery.css( elem, "border" + cssExpand[ i ] + "Width", true, styles ); - } - } else { - // at this point, extra isn't content, so add padding - val += jQuery.css( elem, "padding" + cssExpand[ i ], true, styles ); - - // at this point, extra isn't content nor padding, so add border - if ( extra !== "padding" ) { - val += jQuery.css( elem, "border" + cssExpand[ i ] + "Width", true, styles ); - } - } - } - - return val; -} - -function getWidthOrHeight( elem, name, extra ) { - - // Start with offset property, which is equivalent to the border-box value - var valueIsBorderBox = true, - val = name === "width" ? elem.offsetWidth : elem.offsetHeight, - styles = getStyles( elem ), - isBorderBox = support.boxSizing && jQuery.css( elem, "boxSizing", false, styles ) === "border-box"; - - // some non-html elements return undefined for offsetWidth, so check for null/undefined - // svg - https://bugzilla.mozilla.org/show_bug.cgi?id=649285 - // MathML - https://bugzilla.mozilla.org/show_bug.cgi?id=491668 - if ( val <= 0 || val == null ) { - // Fall back to computed then uncomputed css if necessary - val = curCSS( elem, name, styles ); - if ( val < 0 || val == null ) { - val = elem.style[ name ]; - } - - // Computed unit is not pixels. Stop here and return. - if ( rnumnonpx.test(val) ) { - return val; - } - - // we need the check for style in case a browser which returns unreliable values - // for getComputedStyle silently falls back to the reliable elem.style - valueIsBorderBox = isBorderBox && ( support.boxSizingReliable() || val === elem.style[ name ] ); - - // Normalize "", auto, and prepare for extra - val = parseFloat( val ) || 0; - } - - // use the active box-sizing model to add/subtract irrelevant styles - return ( val + - augmentWidthOrHeight( - elem, - name, - extra || ( isBorderBox ? "border" : "content" ), - valueIsBorderBox, - styles - ) - ) + "px"; -} - -jQuery.extend({ - // Add in style property hooks for overriding the default - // behavior of getting and setting a style property - cssHooks: { - opacity: { - get: function( elem, computed ) { - if ( computed ) { - // We should always get a number back from opacity - var ret = curCSS( elem, "opacity" ); - return ret === "" ? "1" : ret; - } - } - } - }, - - // Don't automatically add "px" to these possibly-unitless properties - cssNumber: { - "columnCount": true, - "fillOpacity": true, - "flexGrow": true, - "flexShrink": true, - "fontWeight": true, - "lineHeight": true, - "opacity": true, - "order": true, - "orphans": true, - "widows": true, - "zIndex": true, - "zoom": true - }, - - // Add in properties whose names you wish to fix before - // setting or getting the value - cssProps: { - // normalize float css property - "float": support.cssFloat ? "cssFloat" : "styleFloat" - }, - - // Get and set the style property on a DOM Node - style: function( elem, name, value, extra ) { - // Don't set styles on text and comment nodes - if ( !elem || elem.nodeType === 3 || elem.nodeType === 8 || !elem.style ) { - return; - } - - // Make sure that we're working with the right name - var ret, type, hooks, - origName = jQuery.camelCase( name ), - style = elem.style; - - name = jQuery.cssProps[ origName ] || ( jQuery.cssProps[ origName ] = vendorPropName( style, origName ) ); - - // gets hook for the prefixed version - // followed by the unprefixed version - hooks = jQuery.cssHooks[ name ] || jQuery.cssHooks[ origName ]; - - // Check if we're setting a value - if ( value !== undefined ) { - type = typeof value; - - // convert relative number strings (+= or -=) to relative numbers. #7345 - if ( type === "string" && (ret = rrelNum.exec( value )) ) { - value = ( ret[1] + 1 ) * ret[2] + parseFloat( jQuery.css( elem, name ) ); - // Fixes bug #9237 - type = "number"; - } - - // Make sure that null and NaN values aren't set. See: #7116 - if ( value == null || value !== value ) { - return; - } - - // If a number was passed in, add 'px' to the (except for certain CSS properties) - if ( type === "number" && !jQuery.cssNumber[ origName ] ) { - value += "px"; - } - - // Fixes #8908, it can be done more correctly by specifing setters in cssHooks, - // but it would mean to define eight (for every problematic property) identical functions - if ( !support.clearCloneStyle && value === "" && name.indexOf("background") === 0 ) { - style[ name ] = "inherit"; - } - - // If a hook was provided, use that value, otherwise just set the specified value - if ( !hooks || !("set" in hooks) || (value = hooks.set( elem, value, extra )) !== undefined ) { - - // Support: IE - // Swallow errors from 'invalid' CSS values (#5509) - try { - style[ name ] = value; - } catch(e) {} - } - - } else { - // If a hook was provided get the non-computed value from there - if ( hooks && "get" in hooks && (ret = hooks.get( elem, false, extra )) !== undefined ) { - return ret; - } - - // Otherwise just get the value from the style object - return style[ name ]; - } - }, - - css: function( elem, name, extra, styles ) { - var num, val, hooks, - origName = jQuery.camelCase( name ); - - // Make sure that we're working with the right name - name = jQuery.cssProps[ origName ] || ( jQuery.cssProps[ origName ] = vendorPropName( elem.style, origName ) ); - - // gets hook for the prefixed version - // followed by the unprefixed version - hooks = jQuery.cssHooks[ name ] || jQuery.cssHooks[ origName ]; - - // If a hook was provided get the computed value from there - if ( hooks && "get" in hooks ) { - val = hooks.get( elem, true, extra ); - } - - // Otherwise, if a way to get the computed value exists, use that - if ( val === undefined ) { - val = curCSS( elem, name, styles ); - } - - //convert "normal" to computed value - if ( val === "normal" && name in cssNormalTransform ) { - val = cssNormalTransform[ name ]; - } - - // Return, converting to number if forced or a qualifier was provided and val looks numeric - if ( extra === "" || extra ) { - num = parseFloat( val ); - return extra === true || jQuery.isNumeric( num ) ? num || 0 : val; - } - return val; - } -}); - -jQuery.each([ "height", "width" ], function( i, name ) { - jQuery.cssHooks[ name ] = { - get: function( elem, computed, extra ) { - if ( computed ) { - // certain elements can have dimension info if we invisibly show them - // however, it must have a current display style that would benefit from this - return rdisplayswap.test( jQuery.css( elem, "display" ) ) && elem.offsetWidth === 0 ? - jQuery.swap( elem, cssShow, function() { - return getWidthOrHeight( elem, name, extra ); - }) : - getWidthOrHeight( elem, name, extra ); - } - }, - - set: function( elem, value, extra ) { - var styles = extra && getStyles( elem ); - return setPositiveNumber( elem, value, extra ? - augmentWidthOrHeight( - elem, - name, - extra, - support.boxSizing && jQuery.css( elem, "boxSizing", false, styles ) === "border-box", - styles - ) : 0 - ); - } - }; -}); - -if ( !support.opacity ) { - jQuery.cssHooks.opacity = { - get: function( elem, computed ) { - // IE uses filters for opacity - return ropacity.test( (computed && elem.currentStyle ? elem.currentStyle.filter : elem.style.filter) || "" ) ? - ( 0.01 * parseFloat( RegExp.$1 ) ) + "" : - computed ? "1" : ""; - }, - - set: function( elem, value ) { - var style = elem.style, - currentStyle = elem.currentStyle, - opacity = jQuery.isNumeric( value ) ? "alpha(opacity=" + value * 100 + ")" : "", - filter = currentStyle && currentStyle.filter || style.filter || ""; - - // IE has trouble with opacity if it does not have layout - // Force it by setting the zoom level - style.zoom = 1; - - // if setting opacity to 1, and no other filters exist - attempt to remove filter attribute #6652 - // if value === "", then remove inline opacity #12685 - if ( ( value >= 1 || value === "" ) && - jQuery.trim( filter.replace( ralpha, "" ) ) === "" && - style.removeAttribute ) { - - // Setting style.filter to null, "" & " " still leave "filter:" in the cssText - // if "filter:" is present at all, clearType is disabled, we want to avoid this - // style.removeAttribute is IE Only, but so apparently is this code path... - style.removeAttribute( "filter" ); - - // if there is no filter style applied in a css rule or unset inline opacity, we are done - if ( value === "" || currentStyle && !currentStyle.filter ) { - return; - } - } - - // otherwise, set new filter values - style.filter = ralpha.test( filter ) ? - filter.replace( ralpha, opacity ) : - filter + " " + opacity; - } - }; -} - -jQuery.cssHooks.marginRight = addGetHookIf( support.reliableMarginRight, - function( elem, computed ) { - if ( computed ) { - // WebKit Bug 13343 - getComputedStyle returns wrong value for margin-right - // Work around by temporarily setting element display to inline-block - return jQuery.swap( elem, { "display": "inline-block" }, - curCSS, [ elem, "marginRight" ] ); - } - } -); - -// These hooks are used by animate to expand properties -jQuery.each({ - margin: "", - padding: "", - border: "Width" -}, function( prefix, suffix ) { - jQuery.cssHooks[ prefix + suffix ] = { - expand: function( value ) { - var i = 0, - expanded = {}, - - // assumes a single number if not a string - parts = typeof value === "string" ? value.split(" ") : [ value ]; - - for ( ; i < 4; i++ ) { - expanded[ prefix + cssExpand[ i ] + suffix ] = - parts[ i ] || parts[ i - 2 ] || parts[ 0 ]; - } - - return expanded; - } - }; - - if ( !rmargin.test( prefix ) ) { - jQuery.cssHooks[ prefix + suffix ].set = setPositiveNumber; - } -}); - -jQuery.fn.extend({ - css: function( name, value ) { - return access( this, function( elem, name, value ) { - var styles, len, - map = {}, - i = 0; - - if ( jQuery.isArray( name ) ) { - styles = getStyles( elem ); - len = name.length; - - for ( ; i < len; i++ ) { - map[ name[ i ] ] = jQuery.css( elem, name[ i ], false, styles ); - } - - return map; - } - - return value !== undefined ? - jQuery.style( elem, name, value ) : - jQuery.css( elem, name ); - }, name, value, arguments.length > 1 ); - }, - show: function() { - return showHide( this, true ); - }, - hide: function() { - return showHide( this ); - }, - toggle: function( state ) { - if ( typeof state === "boolean" ) { - return state ? this.show() : this.hide(); - } - - return this.each(function() { - if ( isHidden( this ) ) { - jQuery( this ).show(); - } else { - jQuery( this ).hide(); - } - }); - } -}); - - -function Tween( elem, options, prop, end, easing ) { - return new Tween.prototype.init( elem, options, prop, end, easing ); -} -jQuery.Tween = Tween; - -Tween.prototype = { - constructor: Tween, - init: function( elem, options, prop, end, easing, unit ) { - this.elem = elem; - this.prop = prop; - this.easing = easing || "swing"; - this.options = options; - this.start = this.now = this.cur(); - this.end = end; - this.unit = unit || ( jQuery.cssNumber[ prop ] ? "" : "px" ); - }, - cur: function() { - var hooks = Tween.propHooks[ this.prop ]; - - return hooks && hooks.get ? - hooks.get( this ) : - Tween.propHooks._default.get( this ); - }, - run: function( percent ) { - var eased, - hooks = Tween.propHooks[ this.prop ]; - - if ( this.options.duration ) { - this.pos = eased = jQuery.easing[ this.easing ]( - percent, this.options.duration * percent, 0, 1, this.options.duration - ); - } else { - this.pos = eased = percent; - } - this.now = ( this.end - this.start ) * eased + this.start; - - if ( this.options.step ) { - this.options.step.call( this.elem, this.now, this ); - } - - if ( hooks && hooks.set ) { - hooks.set( this ); - } else { - Tween.propHooks._default.set( this ); - } - return this; - } -}; - -Tween.prototype.init.prototype = Tween.prototype; - -Tween.propHooks = { - _default: { - get: function( tween ) { - var result; - - if ( tween.elem[ tween.prop ] != null && - (!tween.elem.style || tween.elem.style[ tween.prop ] == null) ) { - return tween.elem[ tween.prop ]; - } - - // passing an empty string as a 3rd parameter to .css will automatically - // attempt a parseFloat and fallback to a string if the parse fails - // so, simple values such as "10px" are parsed to Float. - // complex values such as "rotate(1rad)" are returned as is. - result = jQuery.css( tween.elem, tween.prop, "" ); - // Empty strings, null, undefined and "auto" are converted to 0. - return !result || result === "auto" ? 0 : result; - }, - set: function( tween ) { - // use step hook for back compat - use cssHook if its there - use .style if its - // available and use plain properties where available - if ( jQuery.fx.step[ tween.prop ] ) { - jQuery.fx.step[ tween.prop ]( tween ); - } else if ( tween.elem.style && ( tween.elem.style[ jQuery.cssProps[ tween.prop ] ] != null || jQuery.cssHooks[ tween.prop ] ) ) { - jQuery.style( tween.elem, tween.prop, tween.now + tween.unit ); - } else { - tween.elem[ tween.prop ] = tween.now; - } - } - } -}; - -// Support: IE <=9 -// Panic based approach to setting things on disconnected nodes - -Tween.propHooks.scrollTop = Tween.propHooks.scrollLeft = { - set: function( tween ) { - if ( tween.elem.nodeType && tween.elem.parentNode ) { - tween.elem[ tween.prop ] = tween.now; - } - } -}; - -jQuery.easing = { - linear: function( p ) { - return p; - }, - swing: function( p ) { - return 0.5 - Math.cos( p * Math.PI ) / 2; - } -}; - -jQuery.fx = Tween.prototype.init; - -// Back Compat <1.8 extension point -jQuery.fx.step = {}; - - - - -var - fxNow, timerId, - rfxtypes = /^(?:toggle|show|hide)$/, - rfxnum = new RegExp( "^(?:([+-])=|)(" + pnum + ")([a-z%]*)$", "i" ), - rrun = /queueHooks$/, - animationPrefilters = [ defaultPrefilter ], - tweeners = { - "*": [ function( prop, value ) { - var tween = this.createTween( prop, value ), - target = tween.cur(), - parts = rfxnum.exec( value ), - unit = parts && parts[ 3 ] || ( jQuery.cssNumber[ prop ] ? "" : "px" ), - - // Starting value computation is required for potential unit mismatches - start = ( jQuery.cssNumber[ prop ] || unit !== "px" && +target ) && - rfxnum.exec( jQuery.css( tween.elem, prop ) ), - scale = 1, - maxIterations = 20; - - if ( start && start[ 3 ] !== unit ) { - // Trust units reported by jQuery.css - unit = unit || start[ 3 ]; - - // Make sure we update the tween properties later on - parts = parts || []; - - // Iteratively approximate from a nonzero starting point - start = +target || 1; - - do { - // If previous iteration zeroed out, double until we get *something* - // Use a string for doubling factor so we don't accidentally see scale as unchanged below - scale = scale || ".5"; - - // Adjust and apply - start = start / scale; - jQuery.style( tween.elem, prop, start + unit ); - - // Update scale, tolerating zero or NaN from tween.cur() - // And breaking the loop if scale is unchanged or perfect, or if we've just had enough - } while ( scale !== (scale = tween.cur() / target) && scale !== 1 && --maxIterations ); - } - - // Update tween properties - if ( parts ) { - start = tween.start = +start || +target || 0; - tween.unit = unit; - // If a +=/-= token was provided, we're doing a relative animation - tween.end = parts[ 1 ] ? - start + ( parts[ 1 ] + 1 ) * parts[ 2 ] : - +parts[ 2 ]; - } - - return tween; - } ] - }; - -// Animations created synchronously will run synchronously -function createFxNow() { - setTimeout(function() { - fxNow = undefined; - }); - return ( fxNow = jQuery.now() ); -} - -// Generate parameters to create a standard animation -function genFx( type, includeWidth ) { - var which, - attrs = { height: type }, - i = 0; - - // if we include width, step value is 1 to do all cssExpand values, - // if we don't include width, step value is 2 to skip over Left and Right - includeWidth = includeWidth ? 1 : 0; - for ( ; i < 4 ; i += 2 - includeWidth ) { - which = cssExpand[ i ]; - attrs[ "margin" + which ] = attrs[ "padding" + which ] = type; - } - - if ( includeWidth ) { - attrs.opacity = attrs.width = type; - } - - return attrs; -} - -function createTween( value, prop, animation ) { - var tween, - collection = ( tweeners[ prop ] || [] ).concat( tweeners[ "*" ] ), - index = 0, - length = collection.length; - for ( ; index < length; index++ ) { - if ( (tween = collection[ index ].call( animation, prop, value )) ) { - - // we're done with this property - return tween; - } - } -} - -function defaultPrefilter( elem, props, opts ) { - /* jshint validthis: true */ - var prop, value, toggle, tween, hooks, oldfire, display, checkDisplay, - anim = this, - orig = {}, - style = elem.style, - hidden = elem.nodeType && isHidden( elem ), - dataShow = jQuery._data( elem, "fxshow" ); - - // handle queue: false promises - if ( !opts.queue ) { - hooks = jQuery._queueHooks( elem, "fx" ); - if ( hooks.unqueued == null ) { - hooks.unqueued = 0; - oldfire = hooks.empty.fire; - hooks.empty.fire = function() { - if ( !hooks.unqueued ) { - oldfire(); - } - }; - } - hooks.unqueued++; - - anim.always(function() { - // doing this makes sure that the complete handler will be called - // before this completes - anim.always(function() { - hooks.unqueued--; - if ( !jQuery.queue( elem, "fx" ).length ) { - hooks.empty.fire(); - } - }); - }); - } - - // height/width overflow pass - if ( elem.nodeType === 1 && ( "height" in props || "width" in props ) ) { - // Make sure that nothing sneaks out - // Record all 3 overflow attributes because IE does not - // change the overflow attribute when overflowX and - // overflowY are set to the same value - opts.overflow = [ style.overflow, style.overflowX, style.overflowY ]; - - // Set display property to inline-block for height/width - // animations on inline elements that are having width/height animated - display = jQuery.css( elem, "display" ); - - // Test default display if display is currently "none" - checkDisplay = display === "none" ? - jQuery._data( elem, "olddisplay" ) || defaultDisplay( elem.nodeName ) : display; - - if ( checkDisplay === "inline" && jQuery.css( elem, "float" ) === "none" ) { - - // inline-level elements accept inline-block; - // block-level elements need to be inline with layout - if ( !support.inlineBlockNeedsLayout || defaultDisplay( elem.nodeName ) === "inline" ) { - style.display = "inline-block"; - } else { - style.zoom = 1; - } - } - } - - if ( opts.overflow ) { - style.overflow = "hidden"; - if ( !support.shrinkWrapBlocks() ) { - anim.always(function() { - style.overflow = opts.overflow[ 0 ]; - style.overflowX = opts.overflow[ 1 ]; - style.overflowY = opts.overflow[ 2 ]; - }); - } - } - - // show/hide pass - for ( prop in props ) { - value = props[ prop ]; - if ( rfxtypes.exec( value ) ) { - delete props[ prop ]; - toggle = toggle || value === "toggle"; - if ( value === ( hidden ? "hide" : "show" ) ) { - - // If there is dataShow left over from a stopped hide or show and we are going to proceed with show, we should pretend to be hidden - if ( value === "show" && dataShow && dataShow[ prop ] !== undefined ) { - hidden = true; - } else { - continue; - } - } - orig[ prop ] = dataShow && dataShow[ prop ] || jQuery.style( elem, prop ); - - // Any non-fx value stops us from restoring the original display value - } else { - display = undefined; - } - } - - if ( !jQuery.isEmptyObject( orig ) ) { - if ( dataShow ) { - if ( "hidden" in dataShow ) { - hidden = dataShow.hidden; - } - } else { - dataShow = jQuery._data( elem, "fxshow", {} ); - } - - // store state if its toggle - enables .stop().toggle() to "reverse" - if ( toggle ) { - dataShow.hidden = !hidden; - } - if ( hidden ) { - jQuery( elem ).show(); - } else { - anim.done(function() { - jQuery( elem ).hide(); - }); - } - anim.done(function() { - var prop; - jQuery._removeData( elem, "fxshow" ); - for ( prop in orig ) { - jQuery.style( elem, prop, orig[ prop ] ); - } - }); - for ( prop in orig ) { - tween = createTween( hidden ? dataShow[ prop ] : 0, prop, anim ); - - if ( !( prop in dataShow ) ) { - dataShow[ prop ] = tween.start; - if ( hidden ) { - tween.end = tween.start; - tween.start = prop === "width" || prop === "height" ? 1 : 0; - } - } - } - - // If this is a noop like .hide().hide(), restore an overwritten display value - } else if ( (display === "none" ? defaultDisplay( elem.nodeName ) : display) === "inline" ) { - style.display = display; - } -} - -function propFilter( props, specialEasing ) { - var index, name, easing, value, hooks; - - // camelCase, specialEasing and expand cssHook pass - for ( index in props ) { - name = jQuery.camelCase( index ); - easing = specialEasing[ name ]; - value = props[ index ]; - if ( jQuery.isArray( value ) ) { - easing = value[ 1 ]; - value = props[ index ] = value[ 0 ]; - } - - if ( index !== name ) { - props[ name ] = value; - delete props[ index ]; - } - - hooks = jQuery.cssHooks[ name ]; - if ( hooks && "expand" in hooks ) { - value = hooks.expand( value ); - delete props[ name ]; - - // not quite $.extend, this wont overwrite keys already present. - // also - reusing 'index' from above because we have the correct "name" - for ( index in value ) { - if ( !( index in props ) ) { - props[ index ] = value[ index ]; - specialEasing[ index ] = easing; - } - } - } else { - specialEasing[ name ] = easing; - } - } -} - -function Animation( elem, properties, options ) { - var result, - stopped, - index = 0, - length = animationPrefilters.length, - deferred = jQuery.Deferred().always( function() { - // don't match elem in the :animated selector - delete tick.elem; - }), - tick = function() { - if ( stopped ) { - return false; - } - var currentTime = fxNow || createFxNow(), - remaining = Math.max( 0, animation.startTime + animation.duration - currentTime ), - // archaic crash bug won't allow us to use 1 - ( 0.5 || 0 ) (#12497) - temp = remaining / animation.duration || 0, - percent = 1 - temp, - index = 0, - length = animation.tweens.length; - - for ( ; index < length ; index++ ) { - animation.tweens[ index ].run( percent ); - } - - deferred.notifyWith( elem, [ animation, percent, remaining ]); - - if ( percent < 1 && length ) { - return remaining; - } else { - deferred.resolveWith( elem, [ animation ] ); - return false; - } - }, - animation = deferred.promise({ - elem: elem, - props: jQuery.extend( {}, properties ), - opts: jQuery.extend( true, { specialEasing: {} }, options ), - originalProperties: properties, - originalOptions: options, - startTime: fxNow || createFxNow(), - duration: options.duration, - tweens: [], - createTween: function( prop, end ) { - var tween = jQuery.Tween( elem, animation.opts, prop, end, - animation.opts.specialEasing[ prop ] || animation.opts.easing ); - animation.tweens.push( tween ); - return tween; - }, - stop: function( gotoEnd ) { - var index = 0, - // if we are going to the end, we want to run all the tweens - // otherwise we skip this part - length = gotoEnd ? animation.tweens.length : 0; - if ( stopped ) { - return this; - } - stopped = true; - for ( ; index < length ; index++ ) { - animation.tweens[ index ].run( 1 ); - } - - // resolve when we played the last frame - // otherwise, reject - if ( gotoEnd ) { - deferred.resolveWith( elem, [ animation, gotoEnd ] ); - } else { - deferred.rejectWith( elem, [ animation, gotoEnd ] ); - } - return this; - } - }), - props = animation.props; - - propFilter( props, animation.opts.specialEasing ); - - for ( ; index < length ; index++ ) { - result = animationPrefilters[ index ].call( animation, elem, props, animation.opts ); - if ( result ) { - return result; - } - } - - jQuery.map( props, createTween, animation ); - - if ( jQuery.isFunction( animation.opts.start ) ) { - animation.opts.start.call( elem, animation ); - } - - jQuery.fx.timer( - jQuery.extend( tick, { - elem: elem, - anim: animation, - queue: animation.opts.queue - }) - ); - - // attach callbacks from options - return animation.progress( animation.opts.progress ) - .done( animation.opts.done, animation.opts.complete ) - .fail( animation.opts.fail ) - .always( animation.opts.always ); -} - -jQuery.Animation = jQuery.extend( Animation, { - tweener: function( props, callback ) { - if ( jQuery.isFunction( props ) ) { - callback = props; - props = [ "*" ]; - } else { - props = props.split(" "); - } - - var prop, - index = 0, - length = props.length; - - for ( ; index < length ; index++ ) { - prop = props[ index ]; - tweeners[ prop ] = tweeners[ prop ] || []; - tweeners[ prop ].unshift( callback ); - } - }, - - prefilter: function( callback, prepend ) { - if ( prepend ) { - animationPrefilters.unshift( callback ); - } else { - animationPrefilters.push( callback ); - } - } -}); - -jQuery.speed = function( speed, easing, fn ) { - var opt = speed && typeof speed === "object" ? jQuery.extend( {}, speed ) : { - complete: fn || !fn && easing || - jQuery.isFunction( speed ) && speed, - duration: speed, - easing: fn && easing || easing && !jQuery.isFunction( easing ) && easing - }; - - opt.duration = jQuery.fx.off ? 0 : typeof opt.duration === "number" ? opt.duration : - opt.duration in jQuery.fx.speeds ? jQuery.fx.speeds[ opt.duration ] : jQuery.fx.speeds._default; - - // normalize opt.queue - true/undefined/null -> "fx" - if ( opt.queue == null || opt.queue === true ) { - opt.queue = "fx"; - } - - // Queueing - opt.old = opt.complete; - - opt.complete = function() { - if ( jQuery.isFunction( opt.old ) ) { - opt.old.call( this ); - } - - if ( opt.queue ) { - jQuery.dequeue( this, opt.queue ); - } - }; - - return opt; -}; - -jQuery.fn.extend({ - fadeTo: function( speed, to, easing, callback ) { - - // show any hidden elements after setting opacity to 0 - return this.filter( isHidden ).css( "opacity", 0 ).show() - - // animate to the value specified - .end().animate({ opacity: to }, speed, easing, callback ); - }, - animate: function( prop, speed, easing, callback ) { - var empty = jQuery.isEmptyObject( prop ), - optall = jQuery.speed( speed, easing, callback ), - doAnimation = function() { - // Operate on a copy of prop so per-property easing won't be lost - var anim = Animation( this, jQuery.extend( {}, prop ), optall ); - - // Empty animations, or finishing resolves immediately - if ( empty || jQuery._data( this, "finish" ) ) { - anim.stop( true ); - } - }; - doAnimation.finish = doAnimation; - - return empty || optall.queue === false ? - this.each( doAnimation ) : - this.queue( optall.queue, doAnimation ); - }, - stop: function( type, clearQueue, gotoEnd ) { - var stopQueue = function( hooks ) { - var stop = hooks.stop; - delete hooks.stop; - stop( gotoEnd ); - }; - - if ( typeof type !== "string" ) { - gotoEnd = clearQueue; - clearQueue = type; - type = undefined; - } - if ( clearQueue && type !== false ) { - this.queue( type || "fx", [] ); - } - - return this.each(function() { - var dequeue = true, - index = type != null && type + "queueHooks", - timers = jQuery.timers, - data = jQuery._data( this ); - - if ( index ) { - if ( data[ index ] && data[ index ].stop ) { - stopQueue( data[ index ] ); - } - } else { - for ( index in data ) { - if ( data[ index ] && data[ index ].stop && rrun.test( index ) ) { - stopQueue( data[ index ] ); - } - } - } - - for ( index = timers.length; index--; ) { - if ( timers[ index ].elem === this && (type == null || timers[ index ].queue === type) ) { - timers[ index ].anim.stop( gotoEnd ); - dequeue = false; - timers.splice( index, 1 ); - } - } - - // start the next in the queue if the last step wasn't forced - // timers currently will call their complete callbacks, which will dequeue - // but only if they were gotoEnd - if ( dequeue || !gotoEnd ) { - jQuery.dequeue( this, type ); - } - }); - }, - finish: function( type ) { - if ( type !== false ) { - type = type || "fx"; - } - return this.each(function() { - var index, - data = jQuery._data( this ), - queue = data[ type + "queue" ], - hooks = data[ type + "queueHooks" ], - timers = jQuery.timers, - length = queue ? queue.length : 0; - - // enable finishing flag on private data - data.finish = true; - - // empty the queue first - jQuery.queue( this, type, [] ); - - if ( hooks && hooks.stop ) { - hooks.stop.call( this, true ); - } - - // look for any active animations, and finish them - for ( index = timers.length; index--; ) { - if ( timers[ index ].elem === this && timers[ index ].queue === type ) { - timers[ index ].anim.stop( true ); - timers.splice( index, 1 ); - } - } - - // look for any animations in the old queue and finish them - for ( index = 0; index < length; index++ ) { - if ( queue[ index ] && queue[ index ].finish ) { - queue[ index ].finish.call( this ); - } - } - - // turn off finishing flag - delete data.finish; - }); - } -}); - -jQuery.each([ "toggle", "show", "hide" ], function( i, name ) { - var cssFn = jQuery.fn[ name ]; - jQuery.fn[ name ] = function( speed, easing, callback ) { - return speed == null || typeof speed === "boolean" ? - cssFn.apply( this, arguments ) : - this.animate( genFx( name, true ), speed, easing, callback ); - }; -}); - -// Generate shortcuts for custom animations -jQuery.each({ - slideDown: genFx("show"), - slideUp: genFx("hide"), - slideToggle: genFx("toggle"), - fadeIn: { opacity: "show" }, - fadeOut: { opacity: "hide" }, - fadeToggle: { opacity: "toggle" } -}, function( name, props ) { - jQuery.fn[ name ] = function( speed, easing, callback ) { - return this.animate( props, speed, easing, callback ); - }; -}); - -jQuery.timers = []; -jQuery.fx.tick = function() { - var timer, - timers = jQuery.timers, - i = 0; - - fxNow = jQuery.now(); - - for ( ; i < timers.length; i++ ) { - timer = timers[ i ]; - // Checks the timer has not already been removed - if ( !timer() && timers[ i ] === timer ) { - timers.splice( i--, 1 ); - } - } - - if ( !timers.length ) { - jQuery.fx.stop(); - } - fxNow = undefined; -}; - -jQuery.fx.timer = function( timer ) { - jQuery.timers.push( timer ); - if ( timer() ) { - jQuery.fx.start(); - } else { - jQuery.timers.pop(); - } -}; - -jQuery.fx.interval = 13; - -jQuery.fx.start = function() { - if ( !timerId ) { - timerId = setInterval( jQuery.fx.tick, jQuery.fx.interval ); - } -}; - -jQuery.fx.stop = function() { - clearInterval( timerId ); - timerId = null; -}; - -jQuery.fx.speeds = { - slow: 600, - fast: 200, - // Default speed - _default: 400 -}; - - -// Based off of the plugin by Clint Helfers, with permission. -// http://blindsignals.com/index.php/2009/07/jquery-delay/ -jQuery.fn.delay = function( time, type ) { - time = jQuery.fx ? jQuery.fx.speeds[ time ] || time : time; - type = type || "fx"; - - return this.queue( type, function( next, hooks ) { - var timeout = setTimeout( next, time ); - hooks.stop = function() { - clearTimeout( timeout ); - }; - }); -}; - - -(function() { - // Minified: var a,b,c,d,e - var input, div, select, a, opt; - - // Setup - div = document.createElement( "div" ); - div.setAttribute( "className", "t" ); - div.innerHTML = " <link/><table></table><a href='/a'>a</a><input type='checkbox'/>"; - a = div.getElementsByTagName("a")[ 0 ]; - - // First batch of tests. - select = document.createElement("select"); - opt = select.appendChild( document.createElement("option") ); - input = div.getElementsByTagName("input")[ 0 ]; - - a.style.cssText = "top:1px"; - - // Test setAttribute on camelCase class. If it works, we need attrFixes when doing get/setAttribute (ie6/7) - support.getSetAttribute = div.className !== "t"; - - // Get the style information from getAttribute - // (IE uses .cssText instead) - support.style = /top/.test( a.getAttribute("style") ); - - // Make sure that URLs aren't manipulated - // (IE normalizes it by default) - support.hrefNormalized = a.getAttribute("href") === "/a"; - - // Check the default checkbox/radio value ("" on WebKit; "on" elsewhere) - support.checkOn = !!input.value; - - // Make sure that a selected-by-default option has a working selected property. - // (WebKit defaults to false instead of true, IE too, if it's in an optgroup) - support.optSelected = opt.selected; - - // Tests for enctype support on a form (#6743) - support.enctype = !!document.createElement("form").enctype; - - // Make sure that the options inside disabled selects aren't marked as disabled - // (WebKit marks them as disabled) - select.disabled = true; - support.optDisabled = !opt.disabled; - - // Support: IE8 only - // Check if we can trust getAttribute("value") - input = document.createElement( "input" ); - input.setAttribute( "value", "" ); - support.input = input.getAttribute( "value" ) === ""; - - // Check if an input maintains its value after becoming a radio - input.value = "t"; - input.setAttribute( "type", "radio" ); - support.radioValue = input.value === "t"; -})(); - - -var rreturn = /\r/g; - -jQuery.fn.extend({ - val: function( value ) { - var hooks, ret, isFunction, - elem = this[0]; - - if ( !arguments.length ) { - if ( elem ) { - hooks = jQuery.valHooks[ elem.type ] || jQuery.valHooks[ elem.nodeName.toLowerCase() ]; - - if ( hooks && "get" in hooks && (ret = hooks.get( elem, "value" )) !== undefined ) { - return ret; - } - - ret = elem.value; - - return typeof ret === "string" ? - // handle most common string cases - ret.replace(rreturn, "") : - // handle cases where value is null/undef or number - ret == null ? "" : ret; - } - - return; - } - - isFunction = jQuery.isFunction( value ); - - return this.each(function( i ) { - var val; - - if ( this.nodeType !== 1 ) { - return; - } - - if ( isFunction ) { - val = value.call( this, i, jQuery( this ).val() ); - } else { - val = value; - } - - // Treat null/undefined as ""; convert numbers to string - if ( val == null ) { - val = ""; - } else if ( typeof val === "number" ) { - val += ""; - } else if ( jQuery.isArray( val ) ) { - val = jQuery.map( val, function( value ) { - return value == null ? "" : value + ""; - }); - } - - hooks = jQuery.valHooks[ this.type ] || jQuery.valHooks[ this.nodeName.toLowerCase() ]; - - // If set returns undefined, fall back to normal setting - if ( !hooks || !("set" in hooks) || hooks.set( this, val, "value" ) === undefined ) { - this.value = val; - } - }); - } -}); - -jQuery.extend({ - valHooks: { - option: { - get: function( elem ) { - var val = jQuery.find.attr( elem, "value" ); - return val != null ? - val : - // Support: IE10-11+ - // option.text throws exceptions (#14686, #14858) - jQuery.trim( jQuery.text( elem ) ); - } - }, - select: { - get: function( elem ) { - var value, option, - options = elem.options, - index = elem.selectedIndex, - one = elem.type === "select-one" || index < 0, - values = one ? null : [], - max = one ? index + 1 : options.length, - i = index < 0 ? - max : - one ? index : 0; - - // Loop through all the selected options - for ( ; i < max; i++ ) { - option = options[ i ]; - - // oldIE doesn't update selected after form reset (#2551) - if ( ( option.selected || i === index ) && - // Don't return options that are disabled or in a disabled optgroup - ( support.optDisabled ? !option.disabled : option.getAttribute("disabled") === null ) && - ( !option.parentNode.disabled || !jQuery.nodeName( option.parentNode, "optgroup" ) ) ) { - - // Get the specific value for the option - value = jQuery( option ).val(); - - // We don't need an array for one selects - if ( one ) { - return value; - } - - // Multi-Selects return an array - values.push( value ); - } - } - - return values; - }, - - set: function( elem, value ) { - var optionSet, option, - options = elem.options, - values = jQuery.makeArray( value ), - i = options.length; - - while ( i-- ) { - option = options[ i ]; - - if ( jQuery.inArray( jQuery.valHooks.option.get( option ), values ) >= 0 ) { - - // Support: IE6 - // When new option element is added to select box we need to - // force reflow of newly added node in order to workaround delay - // of initialization properties - try { - option.selected = optionSet = true; - - } catch ( _ ) { - - // Will be executed only in IE6 - option.scrollHeight; - } - - } else { - option.selected = false; - } - } - - // Force browsers to behave consistently when non-matching value is set - if ( !optionSet ) { - elem.selectedIndex = -1; - } - - return options; - } - } - } -}); - -// Radios and checkboxes getter/setter -jQuery.each([ "radio", "checkbox" ], function() { - jQuery.valHooks[ this ] = { - set: function( elem, value ) { - if ( jQuery.isArray( value ) ) { - return ( elem.checked = jQuery.inArray( jQuery(elem).val(), value ) >= 0 ); - } - } - }; - if ( !support.checkOn ) { - jQuery.valHooks[ this ].get = function( elem ) { - // Support: Webkit - // "" is returned instead of "on" if a value isn't specified - return elem.getAttribute("value") === null ? "on" : elem.value; - }; - } -}); - - - - -var nodeHook, boolHook, - attrHandle = jQuery.expr.attrHandle, - ruseDefault = /^(?:checked|selected)$/i, - getSetAttribute = support.getSetAttribute, - getSetInput = support.input; - -jQuery.fn.extend({ - attr: function( name, value ) { - return access( this, jQuery.attr, name, value, arguments.length > 1 ); - }, - - removeAttr: function( name ) { - return this.each(function() { - jQuery.removeAttr( this, name ); - }); - } -}); - -jQuery.extend({ - attr: function( elem, name, value ) { - var hooks, ret, - nType = elem.nodeType; - - // don't get/set attributes on text, comment and attribute nodes - if ( !elem || nType === 3 || nType === 8 || nType === 2 ) { - return; - } - - // Fallback to prop when attributes are not supported - if ( typeof elem.getAttribute === strundefined ) { - return jQuery.prop( elem, name, value ); - } - - // All attributes are lowercase - // Grab necessary hook if one is defined - if ( nType !== 1 || !jQuery.isXMLDoc( elem ) ) { - name = name.toLowerCase(); - hooks = jQuery.attrHooks[ name ] || - ( jQuery.expr.match.bool.test( name ) ? boolHook : nodeHook ); - } - - if ( value !== undefined ) { - - if ( value === null ) { - jQuery.removeAttr( elem, name ); - - } else if ( hooks && "set" in hooks && (ret = hooks.set( elem, value, name )) !== undefined ) { - return ret; - - } else { - elem.setAttribute( name, value + "" ); - return value; - } - - } else if ( hooks && "get" in hooks && (ret = hooks.get( elem, name )) !== null ) { - return ret; - - } else { - ret = jQuery.find.attr( elem, name ); - - // Non-existent attributes return null, we normalize to undefined - return ret == null ? - undefined : - ret; - } - }, - - removeAttr: function( elem, value ) { - var name, propName, - i = 0, - attrNames = value && value.match( rnotwhite ); - - if ( attrNames && elem.nodeType === 1 ) { - while ( (name = attrNames[i++]) ) { - propName = jQuery.propFix[ name ] || name; - - // Boolean attributes get special treatment (#10870) - if ( jQuery.expr.match.bool.test( name ) ) { - // Set corresponding property to false - if ( getSetInput && getSetAttribute || !ruseDefault.test( name ) ) { - elem[ propName ] = false; - // Support: IE<9 - // Also clear defaultChecked/defaultSelected (if appropriate) - } else { - elem[ jQuery.camelCase( "default-" + name ) ] = - elem[ propName ] = false; - } - - // See #9699 for explanation of this approach (setting first, then removal) - } else { - jQuery.attr( elem, name, "" ); - } - - elem.removeAttribute( getSetAttribute ? name : propName ); - } - } - }, - - attrHooks: { - type: { - set: function( elem, value ) { - if ( !support.radioValue && value === "radio" && jQuery.nodeName(elem, "input") ) { - // Setting the type on a radio button after the value resets the value in IE6-9 - // Reset value to default in case type is set after value during creation - var val = elem.value; - elem.setAttribute( "type", value ); - if ( val ) { - elem.value = val; - } - return value; - } - } - } - } -}); - -// Hook for boolean attributes -boolHook = { - set: function( elem, value, name ) { - if ( value === false ) { - // Remove boolean attributes when set to false - jQuery.removeAttr( elem, name ); - } else if ( getSetInput && getSetAttribute || !ruseDefault.test( name ) ) { - // IE<8 needs the *property* name - elem.setAttribute( !getSetAttribute && jQuery.propFix[ name ] || name, name ); - - // Use defaultChecked and defaultSelected for oldIE - } else { - elem[ jQuery.camelCase( "default-" + name ) ] = elem[ name ] = true; - } - - return name; - } -}; - -// Retrieve booleans specially -jQuery.each( jQuery.expr.match.bool.source.match( /\w+/g ), function( i, name ) { - - var getter = attrHandle[ name ] || jQuery.find.attr; - - attrHandle[ name ] = getSetInput && getSetAttribute || !ruseDefault.test( name ) ? - function( elem, name, isXML ) { - var ret, handle; - if ( !isXML ) { - // Avoid an infinite loop by temporarily removing this function from the getter - handle = attrHandle[ name ]; - attrHandle[ name ] = ret; - ret = getter( elem, name, isXML ) != null ? - name.toLowerCase() : - null; - attrHandle[ name ] = handle; - } - return ret; - } : - function( elem, name, isXML ) { - if ( !isXML ) { - return elem[ jQuery.camelCase( "default-" + name ) ] ? - name.toLowerCase() : - null; - } - }; -}); - -// fix oldIE attroperties -if ( !getSetInput || !getSetAttribute ) { - jQuery.attrHooks.value = { - set: function( elem, value, name ) { - if ( jQuery.nodeName( elem, "input" ) ) { - // Does not return so that setAttribute is also used - elem.defaultValue = value; - } else { - // Use nodeHook if defined (#1954); otherwise setAttribute is fine - return nodeHook && nodeHook.set( elem, value, name ); - } - } - }; -} - -// IE6/7 do not support getting/setting some attributes with get/setAttribute -if ( !getSetAttribute ) { - - // Use this for any attribute in IE6/7 - // This fixes almost every IE6/7 issue - nodeHook = { - set: function( elem, value, name ) { - // Set the existing or create a new attribute node - var ret = elem.getAttributeNode( name ); - if ( !ret ) { - elem.setAttributeNode( - (ret = elem.ownerDocument.createAttribute( name )) - ); - } - - ret.value = value += ""; - - // Break association with cloned elements by also using setAttribute (#9646) - if ( name === "value" || value === elem.getAttribute( name ) ) { - return value; - } - } - }; - - // Some attributes are constructed with empty-string values when not defined - attrHandle.id = attrHandle.name = attrHandle.coords = - function( elem, name, isXML ) { - var ret; - if ( !isXML ) { - return (ret = elem.getAttributeNode( name )) && ret.value !== "" ? - ret.value : - null; - } - }; - - // Fixing value retrieval on a button requires this module - jQuery.valHooks.button = { - get: function( elem, name ) { - var ret = elem.getAttributeNode( name ); - if ( ret && ret.specified ) { - return ret.value; - } - }, - set: nodeHook.set - }; - - // Set contenteditable to false on removals(#10429) - // Setting to empty string throws an error as an invalid value - jQuery.attrHooks.contenteditable = { - set: function( elem, value, name ) { - nodeHook.set( elem, value === "" ? false : value, name ); - } - }; - - // Set width and height to auto instead of 0 on empty string( Bug #8150 ) - // This is for removals - jQuery.each([ "width", "height" ], function( i, name ) { - jQuery.attrHooks[ name ] = { - set: function( elem, value ) { - if ( value === "" ) { - elem.setAttribute( name, "auto" ); - return value; - } - } - }; - }); -} - -if ( !support.style ) { - jQuery.attrHooks.style = { - get: function( elem ) { - // Return undefined in the case of empty string - // Note: IE uppercases css property names, but if we were to .toLowerCase() - // .cssText, that would destroy case senstitivity in URL's, like in "background" - return elem.style.cssText || undefined; - }, - set: function( elem, value ) { - return ( elem.style.cssText = value + "" ); - } - }; -} - - - - -var rfocusable = /^(?:input|select|textarea|button|object)$/i, - rclickable = /^(?:a|area)$/i; - -jQuery.fn.extend({ - prop: function( name, value ) { - return access( this, jQuery.prop, name, value, arguments.length > 1 ); - }, - - removeProp: function( name ) { - name = jQuery.propFix[ name ] || name; - return this.each(function() { - // try/catch handles cases where IE balks (such as removing a property on window) - try { - this[ name ] = undefined; - delete this[ name ]; - } catch( e ) {} - }); - } -}); - -jQuery.extend({ - propFix: { - "for": "htmlFor", - "class": "className" - }, - - prop: function( elem, name, value ) { - var ret, hooks, notxml, - nType = elem.nodeType; - - // don't get/set properties on text, comment and attribute nodes - if ( !elem || nType === 3 || nType === 8 || nType === 2 ) { - return; - } - - notxml = nType !== 1 || !jQuery.isXMLDoc( elem ); - - if ( notxml ) { - // Fix name and attach hooks - name = jQuery.propFix[ name ] || name; - hooks = jQuery.propHooks[ name ]; - } - - if ( value !== undefined ) { - return hooks && "set" in hooks && (ret = hooks.set( elem, value, name )) !== undefined ? - ret : - ( elem[ name ] = value ); - - } else { - return hooks && "get" in hooks && (ret = hooks.get( elem, name )) !== null ? - ret : - elem[ name ]; - } - }, - - propHooks: { - tabIndex: { - get: function( elem ) { - // elem.tabIndex doesn't always return the correct value when it hasn't been explicitly set - // http://fluidproject.org/blog/2008/01/09/getting-setting-and-removing-tabindex-values-with-javascript/ - // Use proper attribute retrieval(#12072) - var tabindex = jQuery.find.attr( elem, "tabindex" ); - - return tabindex ? - parseInt( tabindex, 10 ) : - rfocusable.test( elem.nodeName ) || rclickable.test( elem.nodeName ) && elem.href ? - 0 : - -1; - } - } - } -}); - -// Some attributes require a special call on IE -// http://msdn.microsoft.com/en-us/library/ms536429%28VS.85%29.aspx -if ( !support.hrefNormalized ) { - // href/src property should get the full normalized URL (#10299/#12915) - jQuery.each([ "href", "src" ], function( i, name ) { - jQuery.propHooks[ name ] = { - get: function( elem ) { - return elem.getAttribute( name, 4 ); - } - }; - }); -} - -// Support: Safari, IE9+ -// mis-reports the default selected property of an option -// Accessing the parent's selectedIndex property fixes it -if ( !support.optSelected ) { - jQuery.propHooks.selected = { - get: function( elem ) { - var parent = elem.parentNode; - - if ( parent ) { - parent.selectedIndex; - - // Make sure that it also works with optgroups, see #5701 - if ( parent.parentNode ) { - parent.parentNode.selectedIndex; - } - } - return null; - } - }; -} - -jQuery.each([ - "tabIndex", - "readOnly", - "maxLength", - "cellSpacing", - "cellPadding", - "rowSpan", - "colSpan", - "useMap", - "frameBorder", - "contentEditable" -], function() { - jQuery.propFix[ this.toLowerCase() ] = this; -}); - -// IE6/7 call enctype encoding -if ( !support.enctype ) { - jQuery.propFix.enctype = "encoding"; -} - - - - -var rclass = /[\t\r\n\f]/g; - -jQuery.fn.extend({ - addClass: function( value ) { - var classes, elem, cur, clazz, j, finalValue, - i = 0, - len = this.length, - proceed = typeof value === "string" && value; - - if ( jQuery.isFunction( value ) ) { - return this.each(function( j ) { - jQuery( this ).addClass( value.call( this, j, this.className ) ); - }); - } - - if ( proceed ) { - // The disjunction here is for better compressibility (see removeClass) - classes = ( value || "" ).match( rnotwhite ) || []; - - for ( ; i < len; i++ ) { - elem = this[ i ]; - cur = elem.nodeType === 1 && ( elem.className ? - ( " " + elem.className + " " ).replace( rclass, " " ) : - " " - ); - - if ( cur ) { - j = 0; - while ( (clazz = classes[j++]) ) { - if ( cur.indexOf( " " + clazz + " " ) < 0 ) { - cur += clazz + " "; - } - } - - // only assign if different to avoid unneeded rendering. - finalValue = jQuery.trim( cur ); - if ( elem.className !== finalValue ) { - elem.className = finalValue; - } - } - } - } - - return this; - }, - - removeClass: function( value ) { - var classes, elem, cur, clazz, j, finalValue, - i = 0, - len = this.length, - proceed = arguments.length === 0 || typeof value === "string" && value; - - if ( jQuery.isFunction( value ) ) { - return this.each(function( j ) { - jQuery( this ).removeClass( value.call( this, j, this.className ) ); - }); - } - if ( proceed ) { - classes = ( value || "" ).match( rnotwhite ) || []; - - for ( ; i < len; i++ ) { - elem = this[ i ]; - // This expression is here for better compressibility (see addClass) - cur = elem.nodeType === 1 && ( elem.className ? - ( " " + elem.className + " " ).replace( rclass, " " ) : - "" - ); - - if ( cur ) { - j = 0; - while ( (clazz = classes[j++]) ) { - // Remove *all* instances - while ( cur.indexOf( " " + clazz + " " ) >= 0 ) { - cur = cur.replace( " " + clazz + " ", " " ); - } - } - - // only assign if different to avoid unneeded rendering. - finalValue = value ? jQuery.trim( cur ) : ""; - if ( elem.className !== finalValue ) { - elem.className = finalValue; - } - } - } - } - - return this; - }, - - toggleClass: function( value, stateVal ) { - var type = typeof value; - - if ( typeof stateVal === "boolean" && type === "string" ) { - return stateVal ? this.addClass( value ) : this.removeClass( value ); - } - - if ( jQuery.isFunction( value ) ) { - return this.each(function( i ) { - jQuery( this ).toggleClass( value.call(this, i, this.className, stateVal), stateVal ); - }); - } - - return this.each(function() { - if ( type === "string" ) { - // toggle individual class names - var className, - i = 0, - self = jQuery( this ), - classNames = value.match( rnotwhite ) || []; - - while ( (className = classNames[ i++ ]) ) { - // check each className given, space separated list - if ( self.hasClass( className ) ) { - self.removeClass( className ); - } else { - self.addClass( className ); - } - } - - // Toggle whole class name - } else if ( type === strundefined || type === "boolean" ) { - if ( this.className ) { - // store className if set - jQuery._data( this, "__className__", this.className ); - } - - // If the element has a class name or if we're passed "false", - // then remove the whole classname (if there was one, the above saved it). - // Otherwise bring back whatever was previously saved (if anything), - // falling back to the empty string if nothing was stored. - this.className = this.className || value === false ? "" : jQuery._data( this, "__className__" ) || ""; - } - }); - }, - - hasClass: function( selector ) { - var className = " " + selector + " ", - i = 0, - l = this.length; - for ( ; i < l; i++ ) { - if ( this[i].nodeType === 1 && (" " + this[i].className + " ").replace(rclass, " ").indexOf( className ) >= 0 ) { - return true; - } - } - - return false; - } -}); - - - - -// Return jQuery for attributes-only inclusion - - -jQuery.each( ("blur focus focusin focusout load resize scroll unload click dblclick " + - "mousedown mouseup mousemove mouseover mouseout mouseenter mouseleave " + - "change select submit keydown keypress keyup error contextmenu").split(" "), function( i, name ) { - - // Handle event binding - jQuery.fn[ name ] = function( data, fn ) { - return arguments.length > 0 ? - this.on( name, null, data, fn ) : - this.trigger( name ); - }; -}); - -jQuery.fn.extend({ - hover: function( fnOver, fnOut ) { - return this.mouseenter( fnOver ).mouseleave( fnOut || fnOver ); - }, - - bind: function( types, data, fn ) { - return this.on( types, null, data, fn ); - }, - unbind: function( types, fn ) { - return this.off( types, null, fn ); - }, - - delegate: function( selector, types, data, fn ) { - return this.on( types, selector, data, fn ); - }, - undelegate: function( selector, types, fn ) { - // ( namespace ) or ( selector, types [, fn] ) - return arguments.length === 1 ? this.off( selector, "**" ) : this.off( types, selector || "**", fn ); - } -}); - - -var nonce = jQuery.now(); - -var rquery = (/\?/); - - - -var rvalidtokens = /(,)|(\[|{)|(}|])|"(?:[^"\\\r\n]|\\["\\\/bfnrt]|\\u[\da-fA-F]{4})*"\s*:?|true|false|null|-?(?!0\d)\d+(?:\.\d+|)(?:[eE][+-]?\d+|)/g; - -jQuery.parseJSON = function( data ) { - // Attempt to parse using the native JSON parser first - if ( window.JSON && window.JSON.parse ) { - // Support: Android 2.3 - // Workaround failure to string-cast null input - return window.JSON.parse( data + "" ); - } - - var requireNonComma, - depth = null, - str = jQuery.trim( data + "" ); - - // Guard against invalid (and possibly dangerous) input by ensuring that nothing remains - // after removing valid tokens - return str && !jQuery.trim( str.replace( rvalidtokens, function( token, comma, open, close ) { - - // Force termination if we see a misplaced comma - if ( requireNonComma && comma ) { - depth = 0; - } - - // Perform no more replacements after returning to outermost depth - if ( depth === 0 ) { - return token; - } - - // Commas must not follow "[", "{", or "," - requireNonComma = open || comma; - - // Determine new depth - // array/object open ("[" or "{"): depth += true - false (increment) - // array/object close ("]" or "}"): depth += false - true (decrement) - // other cases ("," or primitive): depth += true - true (numeric cast) - depth += !close - !open; - - // Remove this token - return ""; - }) ) ? - ( Function( "return " + str ) )() : - jQuery.error( "Invalid JSON: " + data ); -}; - - -// Cross-browser xml parsing -jQuery.parseXML = function( data ) { - var xml, tmp; - if ( !data || typeof data !== "string" ) { - return null; - } - try { - if ( window.DOMParser ) { // Standard - tmp = new DOMParser(); - xml = tmp.parseFromString( data, "text/xml" ); - } else { // IE - xml = new ActiveXObject( "Microsoft.XMLDOM" ); - xml.async = "false"; - xml.loadXML( data ); - } - } catch( e ) { - xml = undefined; - } - if ( !xml || !xml.documentElement || xml.getElementsByTagName( "parsererror" ).length ) { - jQuery.error( "Invalid XML: " + data ); - } - return xml; -}; - - -var - // Document location - ajaxLocParts, - ajaxLocation, - - rhash = /#.*$/, - rts = /([?&])_=[^&]*/, - rheaders = /^(.*?):[ \t]*([^\r\n]*)\r?$/mg, // IE leaves an \r character at EOL - // #7653, #8125, #8152: local protocol detection - rlocalProtocol = /^(?:about|app|app-storage|.+-extension|file|res|widget):$/, - rnoContent = /^(?:GET|HEAD)$/, - rprotocol = /^\/\//, - rurl = /^([\w.+-]+:)(?:\/\/(?:[^\/?#]*@|)([^\/?#:]*)(?::(\d+)|)|)/, - - /* Prefilters - * 1) They are useful to introduce custom dataTypes (see ajax/jsonp.js for an example) - * 2) These are called: - * - BEFORE asking for a transport - * - AFTER param serialization (s.data is a string if s.processData is true) - * 3) key is the dataType - * 4) the catchall symbol "*" can be used - * 5) execution will start with transport dataType and THEN continue down to "*" if needed - */ - prefilters = {}, - - /* Transports bindings - * 1) key is the dataType - * 2) the catchall symbol "*" can be used - * 3) selection will start with transport dataType and THEN go to "*" if needed - */ - transports = {}, - - // Avoid comment-prolog char sequence (#10098); must appease lint and evade compression - allTypes = "*/".concat("*"); - -// #8138, IE may throw an exception when accessing -// a field from window.location if document.domain has been set -try { - ajaxLocation = location.href; -} catch( e ) { - // Use the href attribute of an A element - // since IE will modify it given document.location - ajaxLocation = document.createElement( "a" ); - ajaxLocation.href = ""; - ajaxLocation = ajaxLocation.href; -} - -// Segment location into parts -ajaxLocParts = rurl.exec( ajaxLocation.toLowerCase() ) || []; - -// Base "constructor" for jQuery.ajaxPrefilter and jQuery.ajaxTransport -function addToPrefiltersOrTransports( structure ) { - - // dataTypeExpression is optional and defaults to "*" - return function( dataTypeExpression, func ) { - - if ( typeof dataTypeExpression !== "string" ) { - func = dataTypeExpression; - dataTypeExpression = "*"; - } - - var dataType, - i = 0, - dataTypes = dataTypeExpression.toLowerCase().match( rnotwhite ) || []; - - if ( jQuery.isFunction( func ) ) { - // For each dataType in the dataTypeExpression - while ( (dataType = dataTypes[i++]) ) { - // Prepend if requested - if ( dataType.charAt( 0 ) === "+" ) { - dataType = dataType.slice( 1 ) || "*"; - (structure[ dataType ] = structure[ dataType ] || []).unshift( func ); - - // Otherwise append - } else { - (structure[ dataType ] = structure[ dataType ] || []).push( func ); - } - } - } - }; -} - -// Base inspection function for prefilters and transports -function inspectPrefiltersOrTransports( structure, options, originalOptions, jqXHR ) { - - var inspected = {}, - seekingTransport = ( structure === transports ); - - function inspect( dataType ) { - var selected; - inspected[ dataType ] = true; - jQuery.each( structure[ dataType ] || [], function( _, prefilterOrFactory ) { - var dataTypeOrTransport = prefilterOrFactory( options, originalOptions, jqXHR ); - if ( typeof dataTypeOrTransport === "string" && !seekingTransport && !inspected[ dataTypeOrTransport ] ) { - options.dataTypes.unshift( dataTypeOrTransport ); - inspect( dataTypeOrTransport ); - return false; - } else if ( seekingTransport ) { - return !( selected = dataTypeOrTransport ); - } - }); - return selected; - } - - return inspect( options.dataTypes[ 0 ] ) || !inspected[ "*" ] && inspect( "*" ); -} - -// A special extend for ajax options -// that takes "flat" options (not to be deep extended) -// Fixes #9887 -function ajaxExtend( target, src ) { - var deep, key, - flatOptions = jQuery.ajaxSettings.flatOptions || {}; - - for ( key in src ) { - if ( src[ key ] !== undefined ) { - ( flatOptions[ key ] ? target : ( deep || (deep = {}) ) )[ key ] = src[ key ]; - } - } - if ( deep ) { - jQuery.extend( true, target, deep ); - } - - return target; -} - -/* Handles responses to an ajax request: - * - finds the right dataType (mediates between content-type and expected dataType) - * - returns the corresponding response - */ -function ajaxHandleResponses( s, jqXHR, responses ) { - var firstDataType, ct, finalDataType, type, - contents = s.contents, - dataTypes = s.dataTypes; - - // Remove auto dataType and get content-type in the process - while ( dataTypes[ 0 ] === "*" ) { - dataTypes.shift(); - if ( ct === undefined ) { - ct = s.mimeType || jqXHR.getResponseHeader("Content-Type"); - } - } - - // Check if we're dealing with a known content-type - if ( ct ) { - for ( type in contents ) { - if ( contents[ type ] && contents[ type ].test( ct ) ) { - dataTypes.unshift( type ); - break; - } - } - } - - // Check to see if we have a response for the expected dataType - if ( dataTypes[ 0 ] in responses ) { - finalDataType = dataTypes[ 0 ]; - } else { - // Try convertible dataTypes - for ( type in responses ) { - if ( !dataTypes[ 0 ] || s.converters[ type + " " + dataTypes[0] ] ) { - finalDataType = type; - break; - } - if ( !firstDataType ) { - firstDataType = type; - } - } - // Or just use first one - finalDataType = finalDataType || firstDataType; - } - - // If we found a dataType - // We add the dataType to the list if needed - // and return the corresponding response - if ( finalDataType ) { - if ( finalDataType !== dataTypes[ 0 ] ) { - dataTypes.unshift( finalDataType ); - } - return responses[ finalDataType ]; - } -} - -/* Chain conversions given the request and the original response - * Also sets the responseXXX fields on the jqXHR instance - */ -function ajaxConvert( s, response, jqXHR, isSuccess ) { - var conv2, current, conv, tmp, prev, - converters = {}, - // Work with a copy of dataTypes in case we need to modify it for conversion - dataTypes = s.dataTypes.slice(); - - // Create converters map with lowercased keys - if ( dataTypes[ 1 ] ) { - for ( conv in s.converters ) { - converters[ conv.toLowerCase() ] = s.converters[ conv ]; - } - } - - current = dataTypes.shift(); - - // Convert to each sequential dataType - while ( current ) { - - if ( s.responseFields[ current ] ) { - jqXHR[ s.responseFields[ current ] ] = response; - } - - // Apply the dataFilter if provided - if ( !prev && isSuccess && s.dataFilter ) { - response = s.dataFilter( response, s.dataType ); - } - - prev = current; - current = dataTypes.shift(); - - if ( current ) { - - // There's only work to do if current dataType is non-auto - if ( current === "*" ) { - - current = prev; - - // Convert response if prev dataType is non-auto and differs from current - } else if ( prev !== "*" && prev !== current ) { - - // Seek a direct converter - conv = converters[ prev + " " + current ] || converters[ "* " + current ]; - - // If none found, seek a pair - if ( !conv ) { - for ( conv2 in converters ) { - - // If conv2 outputs current - tmp = conv2.split( " " ); - if ( tmp[ 1 ] === current ) { - - // If prev can be converted to accepted input - conv = converters[ prev + " " + tmp[ 0 ] ] || - converters[ "* " + tmp[ 0 ] ]; - if ( conv ) { - // Condense equivalence converters - if ( conv === true ) { - conv = converters[ conv2 ]; - - // Otherwise, insert the intermediate dataType - } else if ( converters[ conv2 ] !== true ) { - current = tmp[ 0 ]; - dataTypes.unshift( tmp[ 1 ] ); - } - break; - } - } - } - } - - // Apply converter (if not an equivalence) - if ( conv !== true ) { - - // Unless errors are allowed to bubble, catch and return them - if ( conv && s[ "throws" ] ) { - response = conv( response ); - } else { - try { - response = conv( response ); - } catch ( e ) { - return { state: "parsererror", error: conv ? e : "No conversion from " + prev + " to " + current }; - } - } - } - } - } - } - - return { state: "success", data: response }; -} - -jQuery.extend({ - - // Counter for holding the number of active queries - active: 0, - - // Last-Modified header cache for next request - lastModified: {}, - etag: {}, - - ajaxSettings: { - url: ajaxLocation, - type: "GET", - isLocal: rlocalProtocol.test( ajaxLocParts[ 1 ] ), - global: true, - processData: true, - async: true, - contentType: "application/x-www-form-urlencoded; charset=UTF-8", - /* - timeout: 0, - data: null, - dataType: null, - username: null, - password: null, - cache: null, - throws: false, - traditional: false, - headers: {}, - */ - - accepts: { - "*": allTypes, - text: "text/plain", - html: "text/html", - xml: "application/xml, text/xml", - json: "application/json, text/javascript" - }, - - contents: { - xml: /xml/, - html: /html/, - json: /json/ - }, - - responseFields: { - xml: "responseXML", - text: "responseText", - json: "responseJSON" - }, - - // Data converters - // Keys separate source (or catchall "*") and destination types with a single space - converters: { - - // Convert anything to text - "* text": String, - - // Text to html (true = no transformation) - "text html": true, - - // Evaluate text as a json expression - "text json": jQuery.parseJSON, - - // Parse text as xml - "text xml": jQuery.parseXML - }, - - // For options that shouldn't be deep extended: - // you can add your own custom options here if - // and when you create one that shouldn't be - // deep extended (see ajaxExtend) - flatOptions: { - url: true, - context: true - } - }, - - // Creates a full fledged settings object into target - // with both ajaxSettings and settings fields. - // If target is omitted, writes into ajaxSettings. - ajaxSetup: function( target, settings ) { - return settings ? - - // Building a settings object - ajaxExtend( ajaxExtend( target, jQuery.ajaxSettings ), settings ) : - - // Extending ajaxSettings - ajaxExtend( jQuery.ajaxSettings, target ); - }, - - ajaxPrefilter: addToPrefiltersOrTransports( prefilters ), - ajaxTransport: addToPrefiltersOrTransports( transports ), - - // Main method - ajax: function( url, options ) { - - // If url is an object, simulate pre-1.5 signature - if ( typeof url === "object" ) { - options = url; - url = undefined; - } - - // Force options to be an object - options = options || {}; - - var // Cross-domain detection vars - parts, - // Loop variable - i, - // URL without anti-cache param - cacheURL, - // Response headers as string - responseHeadersString, - // timeout handle - timeoutTimer, - - // To know if global events are to be dispatched - fireGlobals, - - transport, - // Response headers - responseHeaders, - // Create the final options object - s = jQuery.ajaxSetup( {}, options ), - // Callbacks context - callbackContext = s.context || s, - // Context for global events is callbackContext if it is a DOM node or jQuery collection - globalEventContext = s.context && ( callbackContext.nodeType || callbackContext.jquery ) ? - jQuery( callbackContext ) : - jQuery.event, - // Deferreds - deferred = jQuery.Deferred(), - completeDeferred = jQuery.Callbacks("once memory"), - // Status-dependent callbacks - statusCode = s.statusCode || {}, - // Headers (they are sent all at once) - requestHeaders = {}, - requestHeadersNames = {}, - // The jqXHR state - state = 0, - // Default abort message - strAbort = "canceled", - // Fake xhr - jqXHR = { - readyState: 0, - - // Builds headers hashtable if needed - getResponseHeader: function( key ) { - var match; - if ( state === 2 ) { - if ( !responseHeaders ) { - responseHeaders = {}; - while ( (match = rheaders.exec( responseHeadersString )) ) { - responseHeaders[ match[1].toLowerCase() ] = match[ 2 ]; - } - } - match = responseHeaders[ key.toLowerCase() ]; - } - return match == null ? null : match; - }, - - // Raw string - getAllResponseHeaders: function() { - return state === 2 ? responseHeadersString : null; - }, - - // Caches the header - setRequestHeader: function( name, value ) { - var lname = name.toLowerCase(); - if ( !state ) { - name = requestHeadersNames[ lname ] = requestHeadersNames[ lname ] || name; - requestHeaders[ name ] = value; - } - return this; - }, - - // Overrides response content-type header - overrideMimeType: function( type ) { - if ( !state ) { - s.mimeType = type; - } - return this; - }, - - // Status-dependent callbacks - statusCode: function( map ) { - var code; - if ( map ) { - if ( state < 2 ) { - for ( code in map ) { - // Lazy-add the new callback in a way that preserves old ones - statusCode[ code ] = [ statusCode[ code ], map[ code ] ]; - } - } else { - // Execute the appropriate callbacks - jqXHR.always( map[ jqXHR.status ] ); - } - } - return this; - }, - - // Cancel the request - abort: function( statusText ) { - var finalText = statusText || strAbort; - if ( transport ) { - transport.abort( finalText ); - } - done( 0, finalText ); - return this; - } - }; - - // Attach deferreds - deferred.promise( jqXHR ).complete = completeDeferred.add; - jqXHR.success = jqXHR.done; - jqXHR.error = jqXHR.fail; - - // Remove hash character (#7531: and string promotion) - // Add protocol if not provided (#5866: IE7 issue with protocol-less urls) - // Handle falsy url in the settings object (#10093: consistency with old signature) - // We also use the url parameter if available - s.url = ( ( url || s.url || ajaxLocation ) + "" ).replace( rhash, "" ).replace( rprotocol, ajaxLocParts[ 1 ] + "//" ); - - // Alias method option to type as per ticket #12004 - s.type = options.method || options.type || s.method || s.type; - - // Extract dataTypes list - s.dataTypes = jQuery.trim( s.dataType || "*" ).toLowerCase().match( rnotwhite ) || [ "" ]; - - // A cross-domain request is in order when we have a protocol:host:port mismatch - if ( s.crossDomain == null ) { - parts = rurl.exec( s.url.toLowerCase() ); - s.crossDomain = !!( parts && - ( parts[ 1 ] !== ajaxLocParts[ 1 ] || parts[ 2 ] !== ajaxLocParts[ 2 ] || - ( parts[ 3 ] || ( parts[ 1 ] === "http:" ? "80" : "443" ) ) !== - ( ajaxLocParts[ 3 ] || ( ajaxLocParts[ 1 ] === "http:" ? "80" : "443" ) ) ) - ); - } - - // Convert data if not already a string - if ( s.data && s.processData && typeof s.data !== "string" ) { - s.data = jQuery.param( s.data, s.traditional ); - } - - // Apply prefilters - inspectPrefiltersOrTransports( prefilters, s, options, jqXHR ); - - // If request was aborted inside a prefilter, stop there - if ( state === 2 ) { - return jqXHR; - } - - // We can fire global events as of now if asked to - // Don't fire events if jQuery.event is undefined in an AMD-usage scenario (#15118) - fireGlobals = jQuery.event && s.global; - - // Watch for a new set of requests - if ( fireGlobals && jQuery.active++ === 0 ) { - jQuery.event.trigger("ajaxStart"); - } - - // Uppercase the type - s.type = s.type.toUpperCase(); - - // Determine if request has content - s.hasContent = !rnoContent.test( s.type ); - - // Save the URL in case we're toying with the If-Modified-Since - // and/or If-None-Match header later on - cacheURL = s.url; - - // More options handling for requests with no content - if ( !s.hasContent ) { - - // If data is available, append data to url - if ( s.data ) { - cacheURL = ( s.url += ( rquery.test( cacheURL ) ? "&" : "?" ) + s.data ); - // #9682: remove data so that it's not used in an eventual retry - delete s.data; - } - - // Add anti-cache in url if needed - if ( s.cache === false ) { - s.url = rts.test( cacheURL ) ? - - // If there is already a '_' parameter, set its value - cacheURL.replace( rts, "$1_=" + nonce++ ) : - - // Otherwise add one to the end - cacheURL + ( rquery.test( cacheURL ) ? "&" : "?" ) + "_=" + nonce++; - } - } - - // Set the If-Modified-Since and/or If-None-Match header, if in ifModified mode. - if ( s.ifModified ) { - if ( jQuery.lastModified[ cacheURL ] ) { - jqXHR.setRequestHeader( "If-Modified-Since", jQuery.lastModified[ cacheURL ] ); - } - if ( jQuery.etag[ cacheURL ] ) { - jqXHR.setRequestHeader( "If-None-Match", jQuery.etag[ cacheURL ] ); - } - } - - // Set the correct header, if data is being sent - if ( s.data && s.hasContent && s.contentType !== false || options.contentType ) { - jqXHR.setRequestHeader( "Content-Type", s.contentType ); - } - - // Set the Accepts header for the server, depending on the dataType - jqXHR.setRequestHeader( - "Accept", - s.dataTypes[ 0 ] && s.accepts[ s.dataTypes[0] ] ? - s.accepts[ s.dataTypes[0] ] + ( s.dataTypes[ 0 ] !== "*" ? ", " + allTypes + "; q=0.01" : "" ) : - s.accepts[ "*" ] - ); - - // Check for headers option - for ( i in s.headers ) { - jqXHR.setRequestHeader( i, s.headers[ i ] ); - } - - // Allow custom headers/mimetypes and early abort - if ( s.beforeSend && ( s.beforeSend.call( callbackContext, jqXHR, s ) === false || state === 2 ) ) { - // Abort if not done already and return - return jqXHR.abort(); - } - - // aborting is no longer a cancellation - strAbort = "abort"; - - // Install callbacks on deferreds - for ( i in { success: 1, error: 1, complete: 1 } ) { - jqXHR[ i ]( s[ i ] ); - } - - // Get transport - transport = inspectPrefiltersOrTransports( transports, s, options, jqXHR ); - - // If no transport, we auto-abort - if ( !transport ) { - done( -1, "No Transport" ); - } else { - jqXHR.readyState = 1; - - // Send global event - if ( fireGlobals ) { - globalEventContext.trigger( "ajaxSend", [ jqXHR, s ] ); - } - // Timeout - if ( s.async && s.timeout > 0 ) { - timeoutTimer = setTimeout(function() { - jqXHR.abort("timeout"); - }, s.timeout ); - } - - try { - state = 1; - transport.send( requestHeaders, done ); - } catch ( e ) { - // Propagate exception as error if not done - if ( state < 2 ) { - done( -1, e ); - // Simply rethrow otherwise - } else { - throw e; - } - } - } - - // Callback for when everything is done - function done( status, nativeStatusText, responses, headers ) { - var isSuccess, success, error, response, modified, - statusText = nativeStatusText; - - // Called once - if ( state === 2 ) { - return; - } - - // State is "done" now - state = 2; - - // Clear timeout if it exists - if ( timeoutTimer ) { - clearTimeout( timeoutTimer ); - } - - // Dereference transport for early garbage collection - // (no matter how long the jqXHR object will be used) - transport = undefined; - - // Cache response headers - responseHeadersString = headers || ""; - - // Set readyState - jqXHR.readyState = status > 0 ? 4 : 0; - - // Determine if successful - isSuccess = status >= 200 && status < 300 || status === 304; - - // Get response data - if ( responses ) { - response = ajaxHandleResponses( s, jqXHR, responses ); - } - - // Convert no matter what (that way responseXXX fields are always set) - response = ajaxConvert( s, response, jqXHR, isSuccess ); - - // If successful, handle type chaining - if ( isSuccess ) { - - // Set the If-Modified-Since and/or If-None-Match header, if in ifModified mode. - if ( s.ifModified ) { - modified = jqXHR.getResponseHeader("Last-Modified"); - if ( modified ) { - jQuery.lastModified[ cacheURL ] = modified; - } - modified = jqXHR.getResponseHeader("etag"); - if ( modified ) { - jQuery.etag[ cacheURL ] = modified; - } - } - - // if no content - if ( status === 204 || s.type === "HEAD" ) { - statusText = "nocontent"; - - // if not modified - } else if ( status === 304 ) { - statusText = "notmodified"; - - // If we have data, let's convert it - } else { - statusText = response.state; - success = response.data; - error = response.error; - isSuccess = !error; - } - } else { - // We extract error from statusText - // then normalize statusText and status for non-aborts - error = statusText; - if ( status || !statusText ) { - statusText = "error"; - if ( status < 0 ) { - status = 0; - } - } - } - - // Set data for the fake xhr object - jqXHR.status = status; - jqXHR.statusText = ( nativeStatusText || statusText ) + ""; - - // Success/Error - if ( isSuccess ) { - deferred.resolveWith( callbackContext, [ success, statusText, jqXHR ] ); - } else { - deferred.rejectWith( callbackContext, [ jqXHR, statusText, error ] ); - } - - // Status-dependent callbacks - jqXHR.statusCode( statusCode ); - statusCode = undefined; - - if ( fireGlobals ) { - globalEventContext.trigger( isSuccess ? "ajaxSuccess" : "ajaxError", - [ jqXHR, s, isSuccess ? success : error ] ); - } - - // Complete - completeDeferred.fireWith( callbackContext, [ jqXHR, statusText ] ); - - if ( fireGlobals ) { - globalEventContext.trigger( "ajaxComplete", [ jqXHR, s ] ); - // Handle the global AJAX counter - if ( !( --jQuery.active ) ) { - jQuery.event.trigger("ajaxStop"); - } - } - } - - return jqXHR; - }, - - getJSON: function( url, data, callback ) { - return jQuery.get( url, data, callback, "json" ); - }, - - getScript: function( url, callback ) { - return jQuery.get( url, undefined, callback, "script" ); - } -}); - -jQuery.each( [ "get", "post" ], function( i, method ) { - jQuery[ method ] = function( url, data, callback, type ) { - // shift arguments if data argument was omitted - if ( jQuery.isFunction( data ) ) { - type = type || callback; - callback = data; - data = undefined; - } - - return jQuery.ajax({ - url: url, - type: method, - dataType: type, - data: data, - success: callback - }); - }; -}); - - -jQuery._evalUrl = function( url ) { - return jQuery.ajax({ - url: url, - type: "GET", - dataType: "script", - async: false, - global: false, - "throws": true - }); -}; - - -jQuery.fn.extend({ - wrapAll: function( html ) { - if ( jQuery.isFunction( html ) ) { - return this.each(function(i) { - jQuery(this).wrapAll( html.call(this, i) ); - }); - } - - if ( this[0] ) { - // The elements to wrap the target around - var wrap = jQuery( html, this[0].ownerDocument ).eq(0).clone(true); - - if ( this[0].parentNode ) { - wrap.insertBefore( this[0] ); - } - - wrap.map(function() { - var elem = this; - - while ( elem.firstChild && elem.firstChild.nodeType === 1 ) { - elem = elem.firstChild; - } - - return elem; - }).append( this ); - } - - return this; - }, - - wrapInner: function( html ) { - if ( jQuery.isFunction( html ) ) { - return this.each(function(i) { - jQuery(this).wrapInner( html.call(this, i) ); - }); - } - - return this.each(function() { - var self = jQuery( this ), - contents = self.contents(); - - if ( contents.length ) { - contents.wrapAll( html ); - - } else { - self.append( html ); - } - }); - }, - - wrap: function( html ) { - var isFunction = jQuery.isFunction( html ); - - return this.each(function(i) { - jQuery( this ).wrapAll( isFunction ? html.call(this, i) : html ); - }); - }, - - unwrap: function() { - return this.parent().each(function() { - if ( !jQuery.nodeName( this, "body" ) ) { - jQuery( this ).replaceWith( this.childNodes ); - } - }).end(); - } -}); - - -jQuery.expr.filters.hidden = function( elem ) { - // Support: Opera <= 12.12 - // Opera reports offsetWidths and offsetHeights less than zero on some elements - return elem.offsetWidth <= 0 && elem.offsetHeight <= 0 || - (!support.reliableHiddenOffsets() && - ((elem.style && elem.style.display) || jQuery.css( elem, "display" )) === "none"); -}; - -jQuery.expr.filters.visible = function( elem ) { - return !jQuery.expr.filters.hidden( elem ); -}; - - - - -var r20 = /%20/g, - rbracket = /\[\]$/, - rCRLF = /\r?\n/g, - rsubmitterTypes = /^(?:submit|button|image|reset|file)$/i, - rsubmittable = /^(?:input|select|textarea|keygen)/i; - -function buildParams( prefix, obj, traditional, add ) { - var name; - - if ( jQuery.isArray( obj ) ) { - // Serialize array item. - jQuery.each( obj, function( i, v ) { - if ( traditional || rbracket.test( prefix ) ) { - // Treat each array item as a scalar. - add( prefix, v ); - - } else { - // Item is non-scalar (array or object), encode its numeric index. - buildParams( prefix + "[" + ( typeof v === "object" ? i : "" ) + "]", v, traditional, add ); - } - }); - - } else if ( !traditional && jQuery.type( obj ) === "object" ) { - // Serialize object item. - for ( name in obj ) { - buildParams( prefix + "[" + name + "]", obj[ name ], traditional, add ); - } - - } else { - // Serialize scalar item. - add( prefix, obj ); - } -} - -// Serialize an array of form elements or a set of -// key/values into a query string -jQuery.param = function( a, traditional ) { - var prefix, - s = [], - add = function( key, value ) { - // If value is a function, invoke it and return its value - value = jQuery.isFunction( value ) ? value() : ( value == null ? "" : value ); - s[ s.length ] = encodeURIComponent( key ) + "=" + encodeURIComponent( value ); - }; - - // Set traditional to true for jQuery <= 1.3.2 behavior. - if ( traditional === undefined ) { - traditional = jQuery.ajaxSettings && jQuery.ajaxSettings.traditional; - } - - // If an array was passed in, assume that it is an array of form elements. - if ( jQuery.isArray( a ) || ( a.jquery && !jQuery.isPlainObject( a ) ) ) { - // Serialize the form elements - jQuery.each( a, function() { - add( this.name, this.value ); - }); - - } else { - // If traditional, encode the "old" way (the way 1.3.2 or older - // did it), otherwise encode params recursively. - for ( prefix in a ) { - buildParams( prefix, a[ prefix ], traditional, add ); - } - } - - // Return the resulting serialization - return s.join( "&" ).replace( r20, "+" ); -}; - -jQuery.fn.extend({ - serialize: function() { - return jQuery.param( this.serializeArray() ); - }, - serializeArray: function() { - return this.map(function() { - // Can add propHook for "elements" to filter or add form elements - var elements = jQuery.prop( this, "elements" ); - return elements ? jQuery.makeArray( elements ) : this; - }) - .filter(function() { - var type = this.type; - // Use .is(":disabled") so that fieldset[disabled] works - return this.name && !jQuery( this ).is( ":disabled" ) && - rsubmittable.test( this.nodeName ) && !rsubmitterTypes.test( type ) && - ( this.checked || !rcheckableType.test( type ) ); - }) - .map(function( i, elem ) { - var val = jQuery( this ).val(); - - return val == null ? - null : - jQuery.isArray( val ) ? - jQuery.map( val, function( val ) { - return { name: elem.name, value: val.replace( rCRLF, "\r\n" ) }; - }) : - { name: elem.name, value: val.replace( rCRLF, "\r\n" ) }; - }).get(); - } -}); - - -// Create the request object -// (This is still attached to ajaxSettings for backward compatibility) -jQuery.ajaxSettings.xhr = window.ActiveXObject !== undefined ? - // Support: IE6+ - function() { - - // XHR cannot access local files, always use ActiveX for that case - return !this.isLocal && - - // Support: IE7-8 - // oldIE XHR does not support non-RFC2616 methods (#13240) - // See http://msdn.microsoft.com/en-us/library/ie/ms536648(v=vs.85).aspx - // and http://www.w3.org/Protocols/rfc2616/rfc2616-sec9.html#sec9 - // Although this check for six methods instead of eight - // since IE also does not support "trace" and "connect" - /^(get|post|head|put|delete|options)$/i.test( this.type ) && - - createStandardXHR() || createActiveXHR(); - } : - // For all other browsers, use the standard XMLHttpRequest object - createStandardXHR; - -var xhrId = 0, - xhrCallbacks = {}, - xhrSupported = jQuery.ajaxSettings.xhr(); - -// Support: IE<10 -// Open requests must be manually aborted on unload (#5280) -// See https://support.microsoft.com/kb/2856746 for more info -if ( window.attachEvent ) { - window.attachEvent( "onunload", function() { - for ( var key in xhrCallbacks ) { - xhrCallbacks[ key ]( undefined, true ); - } - }); -} - -// Determine support properties -support.cors = !!xhrSupported && ( "withCredentials" in xhrSupported ); -xhrSupported = support.ajax = !!xhrSupported; - -// Create transport if the browser can provide an xhr -if ( xhrSupported ) { - - jQuery.ajaxTransport(function( options ) { - // Cross domain only allowed if supported through XMLHttpRequest - if ( !options.crossDomain || support.cors ) { - - var callback; - - return { - send: function( headers, complete ) { - var i, - xhr = options.xhr(), - id = ++xhrId; - - // Open the socket - xhr.open( options.type, options.url, options.async, options.username, options.password ); - - // Apply custom fields if provided - if ( options.xhrFields ) { - for ( i in options.xhrFields ) { - xhr[ i ] = options.xhrFields[ i ]; - } - } - - // Override mime type if needed - if ( options.mimeType && xhr.overrideMimeType ) { - xhr.overrideMimeType( options.mimeType ); - } - - // X-Requested-With header - // For cross-domain requests, seeing as conditions for a preflight are - // akin to a jigsaw puzzle, we simply never set it to be sure. - // (it can always be set on a per-request basis or even using ajaxSetup) - // For same-domain requests, won't change header if already provided. - if ( !options.crossDomain && !headers["X-Requested-With"] ) { - headers["X-Requested-With"] = "XMLHttpRequest"; - } - - // Set headers - for ( i in headers ) { - // Support: IE<9 - // IE's ActiveXObject throws a 'Type Mismatch' exception when setting - // request header to a null-value. - // - // To keep consistent with other XHR implementations, cast the value - // to string and ignore `undefined`. - if ( headers[ i ] !== undefined ) { - xhr.setRequestHeader( i, headers[ i ] + "" ); - } - } - - // Do send the request - // This may raise an exception which is actually - // handled in jQuery.ajax (so no try/catch here) - xhr.send( ( options.hasContent && options.data ) || null ); - - // Listener - callback = function( _, isAbort ) { - var status, statusText, responses; - - // Was never called and is aborted or complete - if ( callback && ( isAbort || xhr.readyState === 4 ) ) { - // Clean up - delete xhrCallbacks[ id ]; - callback = undefined; - xhr.onreadystatechange = jQuery.noop; - - // Abort manually if needed - if ( isAbort ) { - if ( xhr.readyState !== 4 ) { - xhr.abort(); - } - } else { - responses = {}; - status = xhr.status; - - // Support: IE<10 - // Accessing binary-data responseText throws an exception - // (#11426) - if ( typeof xhr.responseText === "string" ) { - responses.text = xhr.responseText; - } - - // Firefox throws an exception when accessing - // statusText for faulty cross-domain requests - try { - statusText = xhr.statusText; - } catch( e ) { - // We normalize with Webkit giving an empty statusText - statusText = ""; - } - - // Filter status for non standard behaviors - - // If the request is local and we have data: assume a success - // (success with no data won't get notified, that's the best we - // can do given current implementations) - if ( !status && options.isLocal && !options.crossDomain ) { - status = responses.text ? 200 : 404; - // IE - #1450: sometimes returns 1223 when it should be 204 - } else if ( status === 1223 ) { - status = 204; - } - } - } - - // Call complete if needed - if ( responses ) { - complete( status, statusText, responses, xhr.getAllResponseHeaders() ); - } - }; - - if ( !options.async ) { - // if we're in sync mode we fire the callback - callback(); - } else if ( xhr.readyState === 4 ) { - // (IE6 & IE7) if it's in cache and has been - // retrieved directly we need to fire the callback - setTimeout( callback ); - } else { - // Add to the list of active xhr callbacks - xhr.onreadystatechange = xhrCallbacks[ id ] = callback; - } - }, - - abort: function() { - if ( callback ) { - callback( undefined, true ); - } - } - }; - } - }); -} - -// Functions to create xhrs -function createStandardXHR() { - try { - return new window.XMLHttpRequest(); - } catch( e ) {} -} - -function createActiveXHR() { - try { - return new window.ActiveXObject( "Microsoft.XMLHTTP" ); - } catch( e ) {} -} - - - - -// Install script dataType -jQuery.ajaxSetup({ - accepts: { - script: "text/javascript, application/javascript, application/ecmascript, application/x-ecmascript" - }, - contents: { - script: /(?:java|ecma)script/ - }, - converters: { - "text script": function( text ) { - jQuery.globalEval( text ); - return text; - } - } -}); - -// Handle cache's special case and global -jQuery.ajaxPrefilter( "script", function( s ) { - if ( s.cache === undefined ) { - s.cache = false; - } - if ( s.crossDomain ) { - s.type = "GET"; - s.global = false; - } -}); - -// Bind script tag hack transport -jQuery.ajaxTransport( "script", function(s) { - - // This transport only deals with cross domain requests - if ( s.crossDomain ) { - - var script, - head = document.head || jQuery("head")[0] || document.documentElement; - - return { - - send: function( _, callback ) { - - script = document.createElement("script"); - - script.async = true; - - if ( s.scriptCharset ) { - script.charset = s.scriptCharset; - } - - script.src = s.url; - - // Attach handlers for all browsers - script.onload = script.onreadystatechange = function( _, isAbort ) { - - if ( isAbort || !script.readyState || /loaded|complete/.test( script.readyState ) ) { - - // Handle memory leak in IE - script.onload = script.onreadystatechange = null; - - // Remove the script - if ( script.parentNode ) { - script.parentNode.removeChild( script ); - } - - // Dereference the script - script = null; - - // Callback if not abort - if ( !isAbort ) { - callback( 200, "success" ); - } - } - }; - - // Circumvent IE6 bugs with base elements (#2709 and #4378) by prepending - // Use native DOM manipulation to avoid our domManip AJAX trickery - head.insertBefore( script, head.firstChild ); - }, - - abort: function() { - if ( script ) { - script.onload( undefined, true ); - } - } - }; - } -}); - - - - -var oldCallbacks = [], - rjsonp = /(=)\?(?=&|$)|\?\?/; - -// Default jsonp settings -jQuery.ajaxSetup({ - jsonp: "callback", - jsonpCallback: function() { - var callback = oldCallbacks.pop() || ( jQuery.expando + "_" + ( nonce++ ) ); - this[ callback ] = true; - return callback; - } -}); - -// Detect, normalize options and install callbacks for jsonp requests -jQuery.ajaxPrefilter( "json jsonp", function( s, originalSettings, jqXHR ) { - - var callbackName, overwritten, responseContainer, - jsonProp = s.jsonp !== false && ( rjsonp.test( s.url ) ? - "url" : - typeof s.data === "string" && !( s.contentType || "" ).indexOf("application/x-www-form-urlencoded") && rjsonp.test( s.data ) && "data" - ); - - // Handle iff the expected data type is "jsonp" or we have a parameter to set - if ( jsonProp || s.dataTypes[ 0 ] === "jsonp" ) { - - // Get callback name, remembering preexisting value associated with it - callbackName = s.jsonpCallback = jQuery.isFunction( s.jsonpCallback ) ? - s.jsonpCallback() : - s.jsonpCallback; - - // Insert callback into url or form data - if ( jsonProp ) { - s[ jsonProp ] = s[ jsonProp ].replace( rjsonp, "$1" + callbackName ); - } else if ( s.jsonp !== false ) { - s.url += ( rquery.test( s.url ) ? "&" : "?" ) + s.jsonp + "=" + callbackName; - } - - // Use data converter to retrieve json after script execution - s.converters["script json"] = function() { - if ( !responseContainer ) { - jQuery.error( callbackName + " was not called" ); - } - return responseContainer[ 0 ]; - }; - - // force json dataType - s.dataTypes[ 0 ] = "json"; - - // Install callback - overwritten = window[ callbackName ]; - window[ callbackName ] = function() { - responseContainer = arguments; - }; - - // Clean-up function (fires after converters) - jqXHR.always(function() { - // Restore preexisting value - window[ callbackName ] = overwritten; - - // Save back as free - if ( s[ callbackName ] ) { - // make sure that re-using the options doesn't screw things around - s.jsonpCallback = originalSettings.jsonpCallback; - - // save the callback name for future use - oldCallbacks.push( callbackName ); - } - - // Call if it was a function and we have a response - if ( responseContainer && jQuery.isFunction( overwritten ) ) { - overwritten( responseContainer[ 0 ] ); - } - - responseContainer = overwritten = undefined; - }); - - // Delegate to script - return "script"; - } -}); - - - - -// data: string of html -// context (optional): If specified, the fragment will be created in this context, defaults to document -// keepScripts (optional): If true, will include scripts passed in the html string -jQuery.parseHTML = function( data, context, keepScripts ) { - if ( !data || typeof data !== "string" ) { - return null; - } - if ( typeof context === "boolean" ) { - keepScripts = context; - context = false; - } - context = context || document; - - var parsed = rsingleTag.exec( data ), - scripts = !keepScripts && []; - - // Single tag - if ( parsed ) { - return [ context.createElement( parsed[1] ) ]; - } - - parsed = jQuery.buildFragment( [ data ], context, scripts ); - - if ( scripts && scripts.length ) { - jQuery( scripts ).remove(); - } - - return jQuery.merge( [], parsed.childNodes ); -}; - - -// Keep a copy of the old load method -var _load = jQuery.fn.load; - -/** - * Load a url into a page - */ -jQuery.fn.load = function( url, params, callback ) { - if ( typeof url !== "string" && _load ) { - return _load.apply( this, arguments ); - } - - var selector, response, type, - self = this, - off = url.indexOf(" "); - - if ( off >= 0 ) { - selector = jQuery.trim( url.slice( off, url.length ) ); - url = url.slice( 0, off ); - } - - // If it's a function - if ( jQuery.isFunction( params ) ) { - - // We assume that it's the callback - callback = params; - params = undefined; - - // Otherwise, build a param string - } else if ( params && typeof params === "object" ) { - type = "POST"; - } - - // If we have elements to modify, make the request - if ( self.length > 0 ) { - jQuery.ajax({ - url: url, - - // if "type" variable is undefined, then "GET" method will be used - type: type, - dataType: "html", - data: params - }).done(function( responseText ) { - - // Save response for use in complete callback - response = arguments; - - self.html( selector ? - - // If a selector was specified, locate the right elements in a dummy div - // Exclude scripts to avoid IE 'Permission Denied' errors - jQuery("<div>").append( jQuery.parseHTML( responseText ) ).find( selector ) : - - // Otherwise use the full result - responseText ); - - }).complete( callback && function( jqXHR, status ) { - self.each( callback, response || [ jqXHR.responseText, status, jqXHR ] ); - }); - } - - return this; -}; - - - - -// Attach a bunch of functions for handling common AJAX events -jQuery.each( [ "ajaxStart", "ajaxStop", "ajaxComplete", "ajaxError", "ajaxSuccess", "ajaxSend" ], function( i, type ) { - jQuery.fn[ type ] = function( fn ) { - return this.on( type, fn ); - }; -}); - - - - -jQuery.expr.filters.animated = function( elem ) { - return jQuery.grep(jQuery.timers, function( fn ) { - return elem === fn.elem; - }).length; -}; - - - - - -var docElem = window.document.documentElement; - -/** - * Gets a window from an element - */ -function getWindow( elem ) { - return jQuery.isWindow( elem ) ? - elem : - elem.nodeType === 9 ? - elem.defaultView || elem.parentWindow : - false; -} - -jQuery.offset = { - setOffset: function( elem, options, i ) { - var curPosition, curLeft, curCSSTop, curTop, curOffset, curCSSLeft, calculatePosition, - position = jQuery.css( elem, "position" ), - curElem = jQuery( elem ), - props = {}; - - // set position first, in-case top/left are set even on static elem - if ( position === "static" ) { - elem.style.position = "relative"; - } - - curOffset = curElem.offset(); - curCSSTop = jQuery.css( elem, "top" ); - curCSSLeft = jQuery.css( elem, "left" ); - calculatePosition = ( position === "absolute" || position === "fixed" ) && - jQuery.inArray("auto", [ curCSSTop, curCSSLeft ] ) > -1; - - // need to be able to calculate position if either top or left is auto and position is either absolute or fixed - if ( calculatePosition ) { - curPosition = curElem.position(); - curTop = curPosition.top; - curLeft = curPosition.left; - } else { - curTop = parseFloat( curCSSTop ) || 0; - curLeft = parseFloat( curCSSLeft ) || 0; - } - - if ( jQuery.isFunction( options ) ) { - options = options.call( elem, i, curOffset ); - } - - if ( options.top != null ) { - props.top = ( options.top - curOffset.top ) + curTop; - } - if ( options.left != null ) { - props.left = ( options.left - curOffset.left ) + curLeft; - } - - if ( "using" in options ) { - options.using.call( elem, props ); - } else { - curElem.css( props ); - } - } -}; - -jQuery.fn.extend({ - offset: function( options ) { - if ( arguments.length ) { - return options === undefined ? - this : - this.each(function( i ) { - jQuery.offset.setOffset( this, options, i ); - }); - } - - var docElem, win, - box = { top: 0, left: 0 }, - elem = this[ 0 ], - doc = elem && elem.ownerDocument; - - if ( !doc ) { - return; - } - - docElem = doc.documentElement; - - // Make sure it's not a disconnected DOM node - if ( !jQuery.contains( docElem, elem ) ) { - return box; - } - - // If we don't have gBCR, just use 0,0 rather than error - // BlackBerry 5, iOS 3 (original iPhone) - if ( typeof elem.getBoundingClientRect !== strundefined ) { - box = elem.getBoundingClientRect(); - } - win = getWindow( doc ); - return { - top: box.top + ( win.pageYOffset || docElem.scrollTop ) - ( docElem.clientTop || 0 ), - left: box.left + ( win.pageXOffset || docElem.scrollLeft ) - ( docElem.clientLeft || 0 ) - }; - }, - - position: function() { - if ( !this[ 0 ] ) { - return; - } - - var offsetParent, offset, - parentOffset = { top: 0, left: 0 }, - elem = this[ 0 ]; - - // fixed elements are offset from window (parentOffset = {top:0, left: 0}, because it is its only offset parent - if ( jQuery.css( elem, "position" ) === "fixed" ) { - // we assume that getBoundingClientRect is available when computed position is fixed - offset = elem.getBoundingClientRect(); - } else { - // Get *real* offsetParent - offsetParent = this.offsetParent(); - - // Get correct offsets - offset = this.offset(); - if ( !jQuery.nodeName( offsetParent[ 0 ], "html" ) ) { - parentOffset = offsetParent.offset(); - } - - // Add offsetParent borders - parentOffset.top += jQuery.css( offsetParent[ 0 ], "borderTopWidth", true ); - parentOffset.left += jQuery.css( offsetParent[ 0 ], "borderLeftWidth", true ); - } - - // Subtract parent offsets and element margins - // note: when an element has margin: auto the offsetLeft and marginLeft - // are the same in Safari causing offset.left to incorrectly be 0 - return { - top: offset.top - parentOffset.top - jQuery.css( elem, "marginTop", true ), - left: offset.left - parentOffset.left - jQuery.css( elem, "marginLeft", true) - }; - }, - - offsetParent: function() { - return this.map(function() { - var offsetParent = this.offsetParent || docElem; - - while ( offsetParent && ( !jQuery.nodeName( offsetParent, "html" ) && jQuery.css( offsetParent, "position" ) === "static" ) ) { - offsetParent = offsetParent.offsetParent; - } - return offsetParent || docElem; - }); - } -}); - -// Create scrollLeft and scrollTop methods -jQuery.each( { scrollLeft: "pageXOffset", scrollTop: "pageYOffset" }, function( method, prop ) { - var top = /Y/.test( prop ); - - jQuery.fn[ method ] = function( val ) { - return access( this, function( elem, method, val ) { - var win = getWindow( elem ); - - if ( val === undefined ) { - return win ? (prop in win) ? win[ prop ] : - win.document.documentElement[ method ] : - elem[ method ]; - } - - if ( win ) { - win.scrollTo( - !top ? val : jQuery( win ).scrollLeft(), - top ? val : jQuery( win ).scrollTop() - ); - - } else { - elem[ method ] = val; - } - }, method, val, arguments.length, null ); - }; -}); - -// Add the top/left cssHooks using jQuery.fn.position -// Webkit bug: https://bugs.webkit.org/show_bug.cgi?id=29084 -// getComputedStyle returns percent when specified for top/left/bottom/right -// rather than make the css module depend on the offset module, we just check for it here -jQuery.each( [ "top", "left" ], function( i, prop ) { - jQuery.cssHooks[ prop ] = addGetHookIf( support.pixelPosition, - function( elem, computed ) { - if ( computed ) { - computed = curCSS( elem, prop ); - // if curCSS returns percentage, fallback to offset - return rnumnonpx.test( computed ) ? - jQuery( elem ).position()[ prop ] + "px" : - computed; - } - } - ); -}); - - -// Create innerHeight, innerWidth, height, width, outerHeight and outerWidth methods -jQuery.each( { Height: "height", Width: "width" }, function( name, type ) { - jQuery.each( { padding: "inner" + name, content: type, "": "outer" + name }, function( defaultExtra, funcName ) { - // margin is only for outerHeight, outerWidth - jQuery.fn[ funcName ] = function( margin, value ) { - var chainable = arguments.length && ( defaultExtra || typeof margin !== "boolean" ), - extra = defaultExtra || ( margin === true || value === true ? "margin" : "border" ); - - return access( this, function( elem, type, value ) { - var doc; - - if ( jQuery.isWindow( elem ) ) { - // As of 5/8/2012 this will yield incorrect results for Mobile Safari, but there - // isn't a whole lot we can do. See pull request at this URL for discussion: - // https://github.com/jquery/jquery/pull/764 - return elem.document.documentElement[ "client" + name ]; - } - - // Get document width or height - if ( elem.nodeType === 9 ) { - doc = elem.documentElement; - - // Either scroll[Width/Height] or offset[Width/Height] or client[Width/Height], whichever is greatest - // unfortunately, this causes bug #3838 in IE6/8 only, but there is currently no good, small way to fix it. - return Math.max( - elem.body[ "scroll" + name ], doc[ "scroll" + name ], - elem.body[ "offset" + name ], doc[ "offset" + name ], - doc[ "client" + name ] - ); - } - - return value === undefined ? - // Get width or height on the element, requesting but not forcing parseFloat - jQuery.css( elem, type, extra ) : - - // Set width or height on the element - jQuery.style( elem, type, value, extra ); - }, type, chainable ? margin : undefined, chainable, null ); - }; - }); -}); - - -// The number of elements contained in the matched element set -jQuery.fn.size = function() { - return this.length; -}; - -jQuery.fn.andSelf = jQuery.fn.addBack; - - - - -// Register as a named AMD module, since jQuery can be concatenated with other -// files that may use define, but not via a proper concatenation script that -// understands anonymous AMD modules. A named AMD is safest and most robust -// way to register. Lowercase jquery is used because AMD module names are -// derived from file names, and jQuery is normally delivered in a lowercase -// file name. Do this after creating the global so that if an AMD module wants -// to call noConflict to hide this version of jQuery, it will work. - -// Note that for maximum portability, libraries that are not jQuery should -// declare themselves as anonymous modules, and avoid setting a global if an -// AMD loader is present. jQuery is a special case. For more information, see -// https://github.com/jrburke/requirejs/wiki/Updating-existing-libraries#wiki-anon - -if ( typeof define === "function" && define.amd ) { - define( "jquery", [], function() { - return jQuery; - }); -} - - - - -var - // Map over jQuery in case of overwrite - _jQuery = window.jQuery, - - // Map over the $ in case of overwrite - _$ = window.$; - -jQuery.noConflict = function( deep ) { - if ( window.$ === jQuery ) { - window.$ = _$; - } - - if ( deep && window.jQuery === jQuery ) { - window.jQuery = _jQuery; - } - - return jQuery; -}; - -// Expose jQuery and $ identifiers, even in -// AMD (#7102#comment:10, https://github.com/jquery/jquery/pull/557) -// and CommonJS for browser emulators (#13566) -if ( typeof noGlobal === strundefined ) { - window.jQuery = window.$ = jQuery; -} - - - - -return jQuery; - - -})); +/*! jQuery v1.11.1 | (c) 2005, 2014 jQuery Foundation, Inc. | jquery.org/license */ +!function(a,b){"object"==typeof module&&"object"==typeof module.exports?module.exports=a.document?b(a,!0):function(a){if(!a.document)throw new Error("jQuery requires a window with a document");return b(a)}:b(a)}("undefined"!=typeof window?window:this,function(a,b){var c=[],d=c.slice,e=c.concat,f=c.push,g=c.indexOf,h={},i=h.toString,j=h.hasOwnProperty,k={},l="1.11.1",m=function(a,b){return new m.fn.init(a,b)},n=/^[\s\uFEFF\xA0]+|[\s\uFEFF\xA0]+$/g,o=/^-ms-/,p=/-([\da-z])/gi,q=function(a,b){return b.toUpperCase()};m.fn=m.prototype={jquery:l,constructor:m,selector:"",length:0,toArray:function(){return d.call(this)},get:function(a){return null!=a?0>a?this[a+this.length]:this[a]:d.call(this)},pushStack:function(a){var b=m.merge(this.constructor(),a);return b.prevObject=this,b.context=this.context,b},each:function(a,b){return m.each(this,a,b)},map:function(a){return this.pushStack(m.map(this,function(b,c){return a.call(b,c,b)}))},slice:function(){return this.pushStack(d.apply(this,arguments))},first:function(){return this.eq(0)},last:function(){return this.eq(-1)},eq:function(a){var b=this.length,c=+a+(0>a?b:0);return this.pushStack(c>=0&&b>c?[this[c]]:[])},end:function(){return this.prevObject||this.constructor(null)},push:f,sort:c.sort,splice:c.splice},m.extend=m.fn.extend=function(){var a,b,c,d,e,f,g=arguments[0]||{},h=1,i=arguments.length,j=!1;for("boolean"==typeof g&&(j=g,g=arguments[h]||{},h++),"object"==typeof g||m.isFunction(g)||(g={}),h===i&&(g=this,h--);i>h;h++)if(null!=(e=arguments[h]))for(d in e)a=g[d],c=e[d],g!==c&&(j&&c&&(m.isPlainObject(c)||(b=m.isArray(c)))?(b?(b=!1,f=a&&m.isArray(a)?a:[]):f=a&&m.isPlainObject(a)?a:{},g[d]=m.extend(j,f,c)):void 0!==c&&(g[d]=c));return g},m.extend({expando:"jQuery"+(l+Math.random()).replace(/\D/g,""),isReady:!0,error:function(a){throw new Error(a)},noop:function(){},isFunction:function(a){return"function"===m.type(a)},isArray:Array.isArray||function(a){return"array"===m.type(a)},isWindow:function(a){return null!=a&&a==a.window},isNumeric:function(a){return!m.isArray(a)&&a-parseFloat(a)>=0},isEmptyObject:function(a){var b;for(b in a)return!1;return!0},isPlainObject:function(a){var b;if(!a||"object"!==m.type(a)||a.nodeType||m.isWindow(a))return!1;try{if(a.constructor&&!j.call(a,"constructor")&&!j.call(a.constructor.prototype,"isPrototypeOf"))return!1}catch(c){return!1}if(k.ownLast)for(b in a)return j.call(a,b);for(b in a);return void 0===b||j.call(a,b)},type:function(a){return null==a?a+"":"object"==typeof a||"function"==typeof a?h[i.call(a)]||"object":typeof a},globalEval:function(b){b&&m.trim(b)&&(a.execScript||function(b){a.eval.call(a,b)})(b)},camelCase:function(a){return a.replace(o,"ms-").replace(p,q)},nodeName:function(a,b){return a.nodeName&&a.nodeName.toLowerCase()===b.toLowerCase()},each:function(a,b,c){var d,e=0,f=a.length,g=r(a);if(c){if(g){for(;f>e;e++)if(d=b.apply(a[e],c),d===!1)break}else for(e in a)if(d=b.apply(a[e],c),d===!1)break}else if(g){for(;f>e;e++)if(d=b.call(a[e],e,a[e]),d===!1)break}else for(e in a)if(d=b.call(a[e],e,a[e]),d===!1)break;return a},trim:function(a){return null==a?"":(a+"").replace(n,"")},makeArray:function(a,b){var c=b||[];return null!=a&&(r(Object(a))?m.merge(c,"string"==typeof a?[a]:a):f.call(c,a)),c},inArray:function(a,b,c){var d;if(b){if(g)return g.call(b,a,c);for(d=b.length,c=c?0>c?Math.max(0,d+c):c:0;d>c;c++)if(c in b&&b[c]===a)return c}return-1},merge:function(a,b){var c=+b.length,d=0,e=a.length;while(c>d)a[e++]=b[d++];if(c!==c)while(void 0!==b[d])a[e++]=b[d++];return a.length=e,a},grep:function(a,b,c){for(var d,e=[],f=0,g=a.length,h=!c;g>f;f++)d=!b(a[f],f),d!==h&&e.push(a[f]);return e},map:function(a,b,c){var d,f=0,g=a.length,h=r(a),i=[];if(h)for(;g>f;f++)d=b(a[f],f,c),null!=d&&i.push(d);else for(f in a)d=b(a[f],f,c),null!=d&&i.push(d);return e.apply([],i)},guid:1,proxy:function(a,b){var c,e,f;return"string"==typeof b&&(f=a[b],b=a,a=f),m.isFunction(a)?(c=d.call(arguments,2),e=function(){return a.apply(b||this,c.concat(d.call(arguments)))},e.guid=a.guid=a.guid||m.guid++,e):void 0},now:function(){return+new Date},support:k}),m.each("Boolean Number String Function Array Date RegExp Object Error".split(" "),function(a,b){h["[object "+b+"]"]=b.toLowerCase()});function r(a){var b=a.length,c=m.type(a);return"function"===c||m.isWindow(a)?!1:1===a.nodeType&&b?!0:"array"===c||0===b||"number"==typeof b&&b>0&&b-1 in a}var s=function(a){var b,c,d,e,f,g,h,i,j,k,l,m,n,o,p,q,r,s,t,u="sizzle"+-new Date,v=a.document,w=0,x=0,y=gb(),z=gb(),A=gb(),B=function(a,b){return a===b&&(l=!0),0},C="undefined",D=1<<31,E={}.hasOwnProperty,F=[],G=F.pop,H=F.push,I=F.push,J=F.slice,K=F.indexOf||function(a){for(var b=0,c=this.length;c>b;b++)if(this[b]===a)return b;return-1},L="checked|selected|async|autofocus|autoplay|controls|defer|disabled|hidden|ismap|loop|multiple|open|readonly|required|scoped",M="[\\x20\\t\\r\\n\\f]",N="(?:\\\\.|[\\w-]|[^\\x00-\\xa0])+",O=N.replace("w","w#"),P="\\["+M+"*("+N+")(?:"+M+"*([*^$|!~]?=)"+M+"*(?:'((?:\\\\.|[^\\\\'])*)'|\"((?:\\\\.|[^\\\\\"])*)\"|("+O+"))|)"+M+"*\\]",Q=":("+N+")(?:\\((('((?:\\\\.|[^\\\\'])*)'|\"((?:\\\\.|[^\\\\\"])*)\")|((?:\\\\.|[^\\\\()[\\]]|"+P+")*)|.*)\\)|)",R=new RegExp("^"+M+"+|((?:^|[^\\\\])(?:\\\\.)*)"+M+"+$","g"),S=new RegExp("^"+M+"*,"+M+"*"),T=new RegExp("^"+M+"*([>+~]|"+M+")"+M+"*"),U=new RegExp("="+M+"*([^\\]'\"]*?)"+M+"*\\]","g"),V=new RegExp(Q),W=new RegExp("^"+O+"$"),X={ID:new RegExp("^#("+N+")"),CLASS:new RegExp("^\\.("+N+")"),TAG:new RegExp("^("+N.replace("w","w*")+")"),ATTR:new RegExp("^"+P),PSEUDO:new RegExp("^"+Q),CHILD:new RegExp("^:(only|first|last|nth|nth-last)-(child|of-type)(?:\\("+M+"*(even|odd|(([+-]|)(\\d*)n|)"+M+"*(?:([+-]|)"+M+"*(\\d+)|))"+M+"*\\)|)","i"),bool:new RegExp("^(?:"+L+")$","i"),needsContext:new RegExp("^"+M+"*[>+~]|:(even|odd|eq|gt|lt|nth|first|last)(?:\\("+M+"*((?:-\\d)?\\d*)"+M+"*\\)|)(?=[^-]|$)","i")},Y=/^(?:input|select|textarea|button)$/i,Z=/^h\d$/i,$=/^[^{]+\{\s*\[native \w/,_=/^(?:#([\w-]+)|(\w+)|\.([\w-]+))$/,ab=/[+~]/,bb=/'|\\/g,cb=new RegExp("\\\\([\\da-f]{1,6}"+M+"?|("+M+")|.)","ig"),db=function(a,b,c){var d="0x"+b-65536;return d!==d||c?b:0>d?String.fromCharCode(d+65536):String.fromCharCode(d>>10|55296,1023&d|56320)};try{I.apply(F=J.call(v.childNodes),v.childNodes),F[v.childNodes.length].nodeType}catch(eb){I={apply:F.length?function(a,b){H.apply(a,J.call(b))}:function(a,b){var c=a.length,d=0;while(a[c++]=b[d++]);a.length=c-1}}}function fb(a,b,d,e){var f,h,j,k,l,o,r,s,w,x;if((b?b.ownerDocument||b:v)!==n&&m(b),b=b||n,d=d||[],!a||"string"!=typeof a)return d;if(1!==(k=b.nodeType)&&9!==k)return[];if(p&&!e){if(f=_.exec(a))if(j=f[1]){if(9===k){if(h=b.getElementById(j),!h||!h.parentNode)return d;if(h.id===j)return d.push(h),d}else if(b.ownerDocument&&(h=b.ownerDocument.getElementById(j))&&t(b,h)&&h.id===j)return d.push(h),d}else{if(f[2])return I.apply(d,b.getElementsByTagName(a)),d;if((j=f[3])&&c.getElementsByClassName&&b.getElementsByClassName)return I.apply(d,b.getElementsByClassName(j)),d}if(c.qsa&&(!q||!q.test(a))){if(s=r=u,w=b,x=9===k&&a,1===k&&"object"!==b.nodeName.toLowerCase()){o=g(a),(r=b.getAttribute("id"))?s=r.replace(bb,"\\$&"):b.setAttribute("id",s),s="[id='"+s+"'] ",l=o.length;while(l--)o[l]=s+qb(o[l]);w=ab.test(a)&&ob(b.parentNode)||b,x=o.join(",")}if(x)try{return I.apply(d,w.querySelectorAll(x)),d}catch(y){}finally{r||b.removeAttribute("id")}}}return i(a.replace(R,"$1"),b,d,e)}function gb(){var a=[];function b(c,e){return a.push(c+" ")>d.cacheLength&&delete b[a.shift()],b[c+" "]=e}return b}function hb(a){return a[u]=!0,a}function ib(a){var b=n.createElement("div");try{return!!a(b)}catch(c){return!1}finally{b.parentNode&&b.parentNode.removeChild(b),b=null}}function jb(a,b){var c=a.split("|"),e=a.length;while(e--)d.attrHandle[c[e]]=b}function kb(a,b){var c=b&&a,d=c&&1===a.nodeType&&1===b.nodeType&&(~b.sourceIndex||D)-(~a.sourceIndex||D);if(d)return d;if(c)while(c=c.nextSibling)if(c===b)return-1;return a?1:-1}function lb(a){return function(b){var c=b.nodeName.toLowerCase();return"input"===c&&b.type===a}}function mb(a){return function(b){var c=b.nodeName.toLowerCase();return("input"===c||"button"===c)&&b.type===a}}function nb(a){return hb(function(b){return b=+b,hb(function(c,d){var e,f=a([],c.length,b),g=f.length;while(g--)c[e=f[g]]&&(c[e]=!(d[e]=c[e]))})})}function ob(a){return a&&typeof a.getElementsByTagName!==C&&a}c=fb.support={},f=fb.isXML=function(a){var b=a&&(a.ownerDocument||a).documentElement;return b?"HTML"!==b.nodeName:!1},m=fb.setDocument=function(a){var b,e=a?a.ownerDocument||a:v,g=e.defaultView;return e!==n&&9===e.nodeType&&e.documentElement?(n=e,o=e.documentElement,p=!f(e),g&&g!==g.top&&(g.addEventListener?g.addEventListener("unload",function(){m()},!1):g.attachEvent&&g.attachEvent("onunload",function(){m()})),c.attributes=ib(function(a){return a.className="i",!a.getAttribute("className")}),c.getElementsByTagName=ib(function(a){return a.appendChild(e.createComment("")),!a.getElementsByTagName("*").length}),c.getElementsByClassName=$.test(e.getElementsByClassName)&&ib(function(a){return a.innerHTML="<div class='a'></div><div class='a i'></div>",a.firstChild.className="i",2===a.getElementsByClassName("i").length}),c.getById=ib(function(a){return o.appendChild(a).id=u,!e.getElementsByName||!e.getElementsByName(u).length}),c.getById?(d.find.ID=function(a,b){if(typeof b.getElementById!==C&&p){var c=b.getElementById(a);return c&&c.parentNode?[c]:[]}},d.filter.ID=function(a){var b=a.replace(cb,db);return function(a){return a.getAttribute("id")===b}}):(delete d.find.ID,d.filter.ID=function(a){var b=a.replace(cb,db);return function(a){var c=typeof a.getAttributeNode!==C&&a.getAttributeNode("id");return c&&c.value===b}}),d.find.TAG=c.getElementsByTagName?function(a,b){return typeof b.getElementsByTagName!==C?b.getElementsByTagName(a):void 0}:function(a,b){var c,d=[],e=0,f=b.getElementsByTagName(a);if("*"===a){while(c=f[e++])1===c.nodeType&&d.push(c);return d}return f},d.find.CLASS=c.getElementsByClassName&&function(a,b){return typeof b.getElementsByClassName!==C&&p?b.getElementsByClassName(a):void 0},r=[],q=[],(c.qsa=$.test(e.querySelectorAll))&&(ib(function(a){a.innerHTML="<select msallowclip=''><option selected=''></option></select>",a.querySelectorAll("[msallowclip^='']").length&&q.push("[*^$]="+M+"*(?:''|\"\")"),a.querySelectorAll("[selected]").length||q.push("\\["+M+"*(?:value|"+L+")"),a.querySelectorAll(":checked").length||q.push(":checked")}),ib(function(a){var b=e.createElement("input");b.setAttribute("type","hidden"),a.appendChild(b).setAttribute("name","D"),a.querySelectorAll("[name=d]").length&&q.push("name"+M+"*[*^$|!~]?="),a.querySelectorAll(":enabled").length||q.push(":enabled",":disabled"),a.querySelectorAll("*,:x"),q.push(",.*:")})),(c.matchesSelector=$.test(s=o.matches||o.webkitMatchesSelector||o.mozMatchesSelector||o.oMatchesSelector||o.msMatchesSelector))&&ib(function(a){c.disconnectedMatch=s.call(a,"div"),s.call(a,"[s!='']:x"),r.push("!=",Q)}),q=q.length&&new RegExp(q.join("|")),r=r.length&&new RegExp(r.join("|")),b=$.test(o.compareDocumentPosition),t=b||$.test(o.contains)?function(a,b){var c=9===a.nodeType?a.documentElement:a,d=b&&b.parentNode;return a===d||!(!d||1!==d.nodeType||!(c.contains?c.contains(d):a.compareDocumentPosition&&16&a.compareDocumentPosition(d)))}:function(a,b){if(b)while(b=b.parentNode)if(b===a)return!0;return!1},B=b?function(a,b){if(a===b)return l=!0,0;var d=!a.compareDocumentPosition-!b.compareDocumentPosition;return d?d:(d=(a.ownerDocument||a)===(b.ownerDocument||b)?a.compareDocumentPosition(b):1,1&d||!c.sortDetached&&b.compareDocumentPosition(a)===d?a===e||a.ownerDocument===v&&t(v,a)?-1:b===e||b.ownerDocument===v&&t(v,b)?1:k?K.call(k,a)-K.call(k,b):0:4&d?-1:1)}:function(a,b){if(a===b)return l=!0,0;var c,d=0,f=a.parentNode,g=b.parentNode,h=[a],i=[b];if(!f||!g)return a===e?-1:b===e?1:f?-1:g?1:k?K.call(k,a)-K.call(k,b):0;if(f===g)return kb(a,b);c=a;while(c=c.parentNode)h.unshift(c);c=b;while(c=c.parentNode)i.unshift(c);while(h[d]===i[d])d++;return d?kb(h[d],i[d]):h[d]===v?-1:i[d]===v?1:0},e):n},fb.matches=function(a,b){return fb(a,null,null,b)},fb.matchesSelector=function(a,b){if((a.ownerDocument||a)!==n&&m(a),b=b.replace(U,"='$1']"),!(!c.matchesSelector||!p||r&&r.test(b)||q&&q.test(b)))try{var d=s.call(a,b);if(d||c.disconnectedMatch||a.document&&11!==a.document.nodeType)return d}catch(e){}return fb(b,n,null,[a]).length>0},fb.contains=function(a,b){return(a.ownerDocument||a)!==n&&m(a),t(a,b)},fb.attr=function(a,b){(a.ownerDocument||a)!==n&&m(a);var e=d.attrHandle[b.toLowerCase()],f=e&&E.call(d.attrHandle,b.toLowerCase())?e(a,b,!p):void 0;return void 0!==f?f:c.attributes||!p?a.getAttribute(b):(f=a.getAttributeNode(b))&&f.specified?f.value:null},fb.error=function(a){throw new Error("Syntax error, unrecognized expression: "+a)},fb.uniqueSort=function(a){var b,d=[],e=0,f=0;if(l=!c.detectDuplicates,k=!c.sortStable&&a.slice(0),a.sort(B),l){while(b=a[f++])b===a[f]&&(e=d.push(f));while(e--)a.splice(d[e],1)}return k=null,a},e=fb.getText=function(a){var b,c="",d=0,f=a.nodeType;if(f){if(1===f||9===f||11===f){if("string"==typeof a.textContent)return a.textContent;for(a=a.firstChild;a;a=a.nextSibling)c+=e(a)}else if(3===f||4===f)return a.nodeValue}else while(b=a[d++])c+=e(b);return c},d=fb.selectors={cacheLength:50,createPseudo:hb,match:X,attrHandle:{},find:{},relative:{">":{dir:"parentNode",first:!0}," ":{dir:"parentNode"},"+":{dir:"previousSibling",first:!0},"~":{dir:"previousSibling"}},preFilter:{ATTR:function(a){return a[1]=a[1].replace(cb,db),a[3]=(a[3]||a[4]||a[5]||"").replace(cb,db),"~="===a[2]&&(a[3]=" "+a[3]+" "),a.slice(0,4)},CHILD:function(a){return a[1]=a[1].toLowerCase(),"nth"===a[1].slice(0,3)?(a[3]||fb.error(a[0]),a[4]=+(a[4]?a[5]+(a[6]||1):2*("even"===a[3]||"odd"===a[3])),a[5]=+(a[7]+a[8]||"odd"===a[3])):a[3]&&fb.error(a[0]),a},PSEUDO:function(a){var b,c=!a[6]&&a[2];return X.CHILD.test(a[0])?null:(a[3]?a[2]=a[4]||a[5]||"":c&&V.test(c)&&(b=g(c,!0))&&(b=c.indexOf(")",c.length-b)-c.length)&&(a[0]=a[0].slice(0,b),a[2]=c.slice(0,b)),a.slice(0,3))}},filter:{TAG:function(a){var b=a.replace(cb,db).toLowerCase();return"*"===a?function(){return!0}:function(a){return a.nodeName&&a.nodeName.toLowerCase()===b}},CLASS:function(a){var b=y[a+" "];return b||(b=new RegExp("(^|"+M+")"+a+"("+M+"|$)"))&&y(a,function(a){return b.test("string"==typeof a.className&&a.className||typeof a.getAttribute!==C&&a.getAttribute("class")||"")})},ATTR:function(a,b,c){return function(d){var e=fb.attr(d,a);return null==e?"!="===b:b?(e+="","="===b?e===c:"!="===b?e!==c:"^="===b?c&&0===e.indexOf(c):"*="===b?c&&e.indexOf(c)>-1:"$="===b?c&&e.slice(-c.length)===c:"~="===b?(" "+e+" ").indexOf(c)>-1:"|="===b?e===c||e.slice(0,c.length+1)===c+"-":!1):!0}},CHILD:function(a,b,c,d,e){var f="nth"!==a.slice(0,3),g="last"!==a.slice(-4),h="of-type"===b;return 1===d&&0===e?function(a){return!!a.parentNode}:function(b,c,i){var j,k,l,m,n,o,p=f!==g?"nextSibling":"previousSibling",q=b.parentNode,r=h&&b.nodeName.toLowerCase(),s=!i&&!h;if(q){if(f){while(p){l=b;while(l=l[p])if(h?l.nodeName.toLowerCase()===r:1===l.nodeType)return!1;o=p="only"===a&&!o&&"nextSibling"}return!0}if(o=[g?q.firstChild:q.lastChild],g&&s){k=q[u]||(q[u]={}),j=k[a]||[],n=j[0]===w&&j[1],m=j[0]===w&&j[2],l=n&&q.childNodes[n];while(l=++n&&l&&l[p]||(m=n=0)||o.pop())if(1===l.nodeType&&++m&&l===b){k[a]=[w,n,m];break}}else if(s&&(j=(b[u]||(b[u]={}))[a])&&j[0]===w)m=j[1];else while(l=++n&&l&&l[p]||(m=n=0)||o.pop())if((h?l.nodeName.toLowerCase()===r:1===l.nodeType)&&++m&&(s&&((l[u]||(l[u]={}))[a]=[w,m]),l===b))break;return m-=e,m===d||m%d===0&&m/d>=0}}},PSEUDO:function(a,b){var c,e=d.pseudos[a]||d.setFilters[a.toLowerCase()]||fb.error("unsupported pseudo: "+a);return e[u]?e(b):e.length>1?(c=[a,a,"",b],d.setFilters.hasOwnProperty(a.toLowerCase())?hb(function(a,c){var d,f=e(a,b),g=f.length;while(g--)d=K.call(a,f[g]),a[d]=!(c[d]=f[g])}):function(a){return e(a,0,c)}):e}},pseudos:{not:hb(function(a){var b=[],c=[],d=h(a.replace(R,"$1"));return d[u]?hb(function(a,b,c,e){var f,g=d(a,null,e,[]),h=a.length;while(h--)(f=g[h])&&(a[h]=!(b[h]=f))}):function(a,e,f){return b[0]=a,d(b,null,f,c),!c.pop()}}),has:hb(function(a){return function(b){return fb(a,b).length>0}}),contains:hb(function(a){return function(b){return(b.textContent||b.innerText||e(b)).indexOf(a)>-1}}),lang:hb(function(a){return W.test(a||"")||fb.error("unsupported lang: "+a),a=a.replace(cb,db).toLowerCase(),function(b){var c;do if(c=p?b.lang:b.getAttribute("xml:lang")||b.getAttribute("lang"))return c=c.toLowerCase(),c===a||0===c.indexOf(a+"-");while((b=b.parentNode)&&1===b.nodeType);return!1}}),target:function(b){var c=a.location&&a.location.hash;return c&&c.slice(1)===b.id},root:function(a){return a===o},focus:function(a){return a===n.activeElement&&(!n.hasFocus||n.hasFocus())&&!!(a.type||a.href||~a.tabIndex)},enabled:function(a){return a.disabled===!1},disabled:function(a){return a.disabled===!0},checked:function(a){var b=a.nodeName.toLowerCase();return"input"===b&&!!a.checked||"option"===b&&!!a.selected},selected:function(a){return a.parentNode&&a.parentNode.selectedIndex,a.selected===!0},empty:function(a){for(a=a.firstChild;a;a=a.nextSibling)if(a.nodeType<6)return!1;return!0},parent:function(a){return!d.pseudos.empty(a)},header:function(a){return Z.test(a.nodeName)},input:function(a){return Y.test(a.nodeName)},button:function(a){var b=a.nodeName.toLowerCase();return"input"===b&&"button"===a.type||"button"===b},text:function(a){var b;return"input"===a.nodeName.toLowerCase()&&"text"===a.type&&(null==(b=a.getAttribute("type"))||"text"===b.toLowerCase())},first:nb(function(){return[0]}),last:nb(function(a,b){return[b-1]}),eq:nb(function(a,b,c){return[0>c?c+b:c]}),even:nb(function(a,b){for(var c=0;b>c;c+=2)a.push(c);return a}),odd:nb(function(a,b){for(var c=1;b>c;c+=2)a.push(c);return a}),lt:nb(function(a,b,c){for(var d=0>c?c+b:c;--d>=0;)a.push(d);return a}),gt:nb(function(a,b,c){for(var d=0>c?c+b:c;++d<b;)a.push(d);return a})}},d.pseudos.nth=d.pseudos.eq;for(b in{radio:!0,checkbox:!0,file:!0,password:!0,image:!0})d.pseudos[b]=lb(b);for(b in{submit:!0,reset:!0})d.pseudos[b]=mb(b);function pb(){}pb.prototype=d.filters=d.pseudos,d.setFilters=new pb,g=fb.tokenize=function(a,b){var c,e,f,g,h,i,j,k=z[a+" "];if(k)return b?0:k.slice(0);h=a,i=[],j=d.preFilter;while(h){(!c||(e=S.exec(h)))&&(e&&(h=h.slice(e[0].length)||h),i.push(f=[])),c=!1,(e=T.exec(h))&&(c=e.shift(),f.push({value:c,type:e[0].replace(R," ")}),h=h.slice(c.length));for(g in d.filter)!(e=X[g].exec(h))||j[g]&&!(e=j[g](e))||(c=e.shift(),f.push({value:c,type:g,matches:e}),h=h.slice(c.length));if(!c)break}return b?h.length:h?fb.error(a):z(a,i).slice(0)};function qb(a){for(var b=0,c=a.length,d="";c>b;b++)d+=a[b].value;return d}function rb(a,b,c){var d=b.dir,e=c&&"parentNode"===d,f=x++;return b.first?function(b,c,f){while(b=b[d])if(1===b.nodeType||e)return a(b,c,f)}:function(b,c,g){var h,i,j=[w,f];if(g){while(b=b[d])if((1===b.nodeType||e)&&a(b,c,g))return!0}else while(b=b[d])if(1===b.nodeType||e){if(i=b[u]||(b[u]={}),(h=i[d])&&h[0]===w&&h[1]===f)return j[2]=h[2];if(i[d]=j,j[2]=a(b,c,g))return!0}}}function sb(a){return a.length>1?function(b,c,d){var e=a.length;while(e--)if(!a[e](b,c,d))return!1;return!0}:a[0]}function tb(a,b,c){for(var d=0,e=b.length;e>d;d++)fb(a,b[d],c);return c}function ub(a,b,c,d,e){for(var f,g=[],h=0,i=a.length,j=null!=b;i>h;h++)(f=a[h])&&(!c||c(f,d,e))&&(g.push(f),j&&b.push(h));return g}function vb(a,b,c,d,e,f){return d&&!d[u]&&(d=vb(d)),e&&!e[u]&&(e=vb(e,f)),hb(function(f,g,h,i){var j,k,l,m=[],n=[],o=g.length,p=f||tb(b||"*",h.nodeType?[h]:h,[]),q=!a||!f&&b?p:ub(p,m,a,h,i),r=c?e||(f?a:o||d)?[]:g:q;if(c&&c(q,r,h,i),d){j=ub(r,n),d(j,[],h,i),k=j.length;while(k--)(l=j[k])&&(r[n[k]]=!(q[n[k]]=l))}if(f){if(e||a){if(e){j=[],k=r.length;while(k--)(l=r[k])&&j.push(q[k]=l);e(null,r=[],j,i)}k=r.length;while(k--)(l=r[k])&&(j=e?K.call(f,l):m[k])>-1&&(f[j]=!(g[j]=l))}}else r=ub(r===g?r.splice(o,r.length):r),e?e(null,g,r,i):I.apply(g,r)})}function wb(a){for(var b,c,e,f=a.length,g=d.relative[a[0].type],h=g||d.relative[" "],i=g?1:0,k=rb(function(a){return a===b},h,!0),l=rb(function(a){return K.call(b,a)>-1},h,!0),m=[function(a,c,d){return!g&&(d||c!==j)||((b=c).nodeType?k(a,c,d):l(a,c,d))}];f>i;i++)if(c=d.relative[a[i].type])m=[rb(sb(m),c)];else{if(c=d.filter[a[i].type].apply(null,a[i].matches),c[u]){for(e=++i;f>e;e++)if(d.relative[a[e].type])break;return vb(i>1&&sb(m),i>1&&qb(a.slice(0,i-1).concat({value:" "===a[i-2].type?"*":""})).replace(R,"$1"),c,e>i&&wb(a.slice(i,e)),f>e&&wb(a=a.slice(e)),f>e&&qb(a))}m.push(c)}return sb(m)}function xb(a,b){var c=b.length>0,e=a.length>0,f=function(f,g,h,i,k){var l,m,o,p=0,q="0",r=f&&[],s=[],t=j,u=f||e&&d.find.TAG("*",k),v=w+=null==t?1:Math.random()||.1,x=u.length;for(k&&(j=g!==n&&g);q!==x&&null!=(l=u[q]);q++){if(e&&l){m=0;while(o=a[m++])if(o(l,g,h)){i.push(l);break}k&&(w=v)}c&&((l=!o&&l)&&p--,f&&r.push(l))}if(p+=q,c&&q!==p){m=0;while(o=b[m++])o(r,s,g,h);if(f){if(p>0)while(q--)r[q]||s[q]||(s[q]=G.call(i));s=ub(s)}I.apply(i,s),k&&!f&&s.length>0&&p+b.length>1&&fb.uniqueSort(i)}return k&&(w=v,j=t),r};return c?hb(f):f}return h=fb.compile=function(a,b){var c,d=[],e=[],f=A[a+" "];if(!f){b||(b=g(a)),c=b.length;while(c--)f=wb(b[c]),f[u]?d.push(f):e.push(f);f=A(a,xb(e,d)),f.selector=a}return f},i=fb.select=function(a,b,e,f){var i,j,k,l,m,n="function"==typeof a&&a,o=!f&&g(a=n.selector||a);if(e=e||[],1===o.length){if(j=o[0]=o[0].slice(0),j.length>2&&"ID"===(k=j[0]).type&&c.getById&&9===b.nodeType&&p&&d.relative[j[1].type]){if(b=(d.find.ID(k.matches[0].replace(cb,db),b)||[])[0],!b)return e;n&&(b=b.parentNode),a=a.slice(j.shift().value.length)}i=X.needsContext.test(a)?0:j.length;while(i--){if(k=j[i],d.relative[l=k.type])break;if((m=d.find[l])&&(f=m(k.matches[0].replace(cb,db),ab.test(j[0].type)&&ob(b.parentNode)||b))){if(j.splice(i,1),a=f.length&&qb(j),!a)return I.apply(e,f),e;break}}}return(n||h(a,o))(f,b,!p,e,ab.test(a)&&ob(b.parentNode)||b),e},c.sortStable=u.split("").sort(B).join("")===u,c.detectDuplicates=!!l,m(),c.sortDetached=ib(function(a){return 1&a.compareDocumentPosition(n.createElement("div"))}),ib(function(a){return a.innerHTML="<a href='#'></a>","#"===a.firstChild.getAttribute("href")})||jb("type|href|height|width",function(a,b,c){return c?void 0:a.getAttribute(b,"type"===b.toLowerCase()?1:2)}),c.attributes&&ib(function(a){return a.innerHTML="<input/>",a.firstChild.setAttribute("value",""),""===a.firstChild.getAttribute("value")})||jb("value",function(a,b,c){return c||"input"!==a.nodeName.toLowerCase()?void 0:a.defaultValue}),ib(function(a){return null==a.getAttribute("disabled")})||jb(L,function(a,b,c){var d;return c?void 0:a[b]===!0?b.toLowerCase():(d=a.getAttributeNode(b))&&d.specified?d.value:null}),fb}(a);m.find=s,m.expr=s.selectors,m.expr[":"]=m.expr.pseudos,m.unique=s.uniqueSort,m.text=s.getText,m.isXMLDoc=s.isXML,m.contains=s.contains;var t=m.expr.match.needsContext,u=/^<(\w+)\s*\/?>(?:<\/\1>|)$/,v=/^.[^:#\[\.,]*$/;function w(a,b,c){if(m.isFunction(b))return m.grep(a,function(a,d){return!!b.call(a,d,a)!==c});if(b.nodeType)return m.grep(a,function(a){return a===b!==c});if("string"==typeof b){if(v.test(b))return m.filter(b,a,c);b=m.filter(b,a)}return m.grep(a,function(a){return m.inArray(a,b)>=0!==c})}m.filter=function(a,b,c){var d=b[0];return c&&(a=":not("+a+")"),1===b.length&&1===d.nodeType?m.find.matchesSelector(d,a)?[d]:[]:m.find.matches(a,m.grep(b,function(a){return 1===a.nodeType}))},m.fn.extend({find:function(a){var b,c=[],d=this,e=d.length;if("string"!=typeof a)return this.pushStack(m(a).filter(function(){for(b=0;e>b;b++)if(m.contains(d[b],this))return!0}));for(b=0;e>b;b++)m.find(a,d[b],c);return c=this.pushStack(e>1?m.unique(c):c),c.selector=this.selector?this.selector+" "+a:a,c},filter:function(a){return this.pushStack(w(this,a||[],!1))},not:function(a){return this.pushStack(w(this,a||[],!0))},is:function(a){return!!w(this,"string"==typeof a&&t.test(a)?m(a):a||[],!1).length}});var x,y=a.document,z=/^(?:\s*(<[\w\W]+>)[^>]*|#([\w-]*))$/,A=m.fn.init=function(a,b){var c,d;if(!a)return this;if("string"==typeof a){if(c="<"===a.charAt(0)&&">"===a.charAt(a.length-1)&&a.length>=3?[null,a,null]:z.exec(a),!c||!c[1]&&b)return!b||b.jquery?(b||x).find(a):this.constructor(b).find(a);if(c[1]){if(b=b instanceof m?b[0]:b,m.merge(this,m.parseHTML(c[1],b&&b.nodeType?b.ownerDocument||b:y,!0)),u.test(c[1])&&m.isPlainObject(b))for(c in b)m.isFunction(this[c])?this[c](b[c]):this.attr(c,b[c]);return this}if(d=y.getElementById(c[2]),d&&d.parentNode){if(d.id!==c[2])return x.find(a);this.length=1,this[0]=d}return this.context=y,this.selector=a,this}return a.nodeType?(this.context=this[0]=a,this.length=1,this):m.isFunction(a)?"undefined"!=typeof x.ready?x.ready(a):a(m):(void 0!==a.selector&&(this.selector=a.selector,this.context=a.context),m.makeArray(a,this))};A.prototype=m.fn,x=m(y);var B=/^(?:parents|prev(?:Until|All))/,C={children:!0,contents:!0,next:!0,prev:!0};m.extend({dir:function(a,b,c){var d=[],e=a[b];while(e&&9!==e.nodeType&&(void 0===c||1!==e.nodeType||!m(e).is(c)))1===e.nodeType&&d.push(e),e=e[b];return d},sibling:function(a,b){for(var c=[];a;a=a.nextSibling)1===a.nodeType&&a!==b&&c.push(a);return c}}),m.fn.extend({has:function(a){var b,c=m(a,this),d=c.length;return this.filter(function(){for(b=0;d>b;b++)if(m.contains(this,c[b]))return!0})},closest:function(a,b){for(var c,d=0,e=this.length,f=[],g=t.test(a)||"string"!=typeof a?m(a,b||this.context):0;e>d;d++)for(c=this[d];c&&c!==b;c=c.parentNode)if(c.nodeType<11&&(g?g.index(c)>-1:1===c.nodeType&&m.find.matchesSelector(c,a))){f.push(c);break}return this.pushStack(f.length>1?m.unique(f):f)},index:function(a){return a?"string"==typeof a?m.inArray(this[0],m(a)):m.inArray(a.jquery?a[0]:a,this):this[0]&&this[0].parentNode?this.first().prevAll().length:-1},add:function(a,b){return this.pushStack(m.unique(m.merge(this.get(),m(a,b))))},addBack:function(a){return this.add(null==a?this.prevObject:this.prevObject.filter(a))}});function D(a,b){do a=a[b];while(a&&1!==a.nodeType);return a}m.each({parent:function(a){var b=a.parentNode;return b&&11!==b.nodeType?b:null},parents:function(a){return m.dir(a,"parentNode")},parentsUntil:function(a,b,c){return m.dir(a,"parentNode",c)},next:function(a){return D(a,"nextSibling")},prev:function(a){return D(a,"previousSibling")},nextAll:function(a){return m.dir(a,"nextSibling")},prevAll:function(a){return m.dir(a,"previousSibling")},nextUntil:function(a,b,c){return m.dir(a,"nextSibling",c)},prevUntil:function(a,b,c){return m.dir(a,"previousSibling",c)},siblings:function(a){return m.sibling((a.parentNode||{}).firstChild,a)},children:function(a){return m.sibling(a.firstChild)},contents:function(a){return m.nodeName(a,"iframe")?a.contentDocument||a.contentWindow.document:m.merge([],a.childNodes)}},function(a,b){m.fn[a]=function(c,d){var e=m.map(this,b,c);return"Until"!==a.slice(-5)&&(d=c),d&&"string"==typeof d&&(e=m.filter(d,e)),this.length>1&&(C[a]||(e=m.unique(e)),B.test(a)&&(e=e.reverse())),this.pushStack(e)}});var E=/\S+/g,F={};function G(a){var b=F[a]={};return m.each(a.match(E)||[],function(a,c){b[c]=!0}),b}m.Callbacks=function(a){a="string"==typeof a?F[a]||G(a):m.extend({},a);var b,c,d,e,f,g,h=[],i=!a.once&&[],j=function(l){for(c=a.memory&&l,d=!0,f=g||0,g=0,e=h.length,b=!0;h&&e>f;f++)if(h[f].apply(l[0],l[1])===!1&&a.stopOnFalse){c=!1;break}b=!1,h&&(i?i.length&&j(i.shift()):c?h=[]:k.disable())},k={add:function(){if(h){var d=h.length;!function f(b){m.each(b,function(b,c){var d=m.type(c);"function"===d?a.unique&&k.has(c)||h.push(c):c&&c.length&&"string"!==d&&f(c)})}(arguments),b?e=h.length:c&&(g=d,j(c))}return this},remove:function(){return h&&m.each(arguments,function(a,c){var d;while((d=m.inArray(c,h,d))>-1)h.splice(d,1),b&&(e>=d&&e--,f>=d&&f--)}),this},has:function(a){return a?m.inArray(a,h)>-1:!(!h||!h.length)},empty:function(){return h=[],e=0,this},disable:function(){return h=i=c=void 0,this},disabled:function(){return!h},lock:function(){return i=void 0,c||k.disable(),this},locked:function(){return!i},fireWith:function(a,c){return!h||d&&!i||(c=c||[],c=[a,c.slice?c.slice():c],b?i.push(c):j(c)),this},fire:function(){return k.fireWith(this,arguments),this},fired:function(){return!!d}};return k},m.extend({Deferred:function(a){var b=[["resolve","done",m.Callbacks("once memory"),"resolved"],["reject","fail",m.Callbacks("once memory"),"rejected"],["notify","progress",m.Callbacks("memory")]],c="pending",d={state:function(){return c},always:function(){return e.done(arguments).fail(arguments),this},then:function(){var a=arguments;return m.Deferred(function(c){m.each(b,function(b,f){var g=m.isFunction(a[b])&&a[b];e[f[1]](function(){var a=g&&g.apply(this,arguments);a&&m.isFunction(a.promise)?a.promise().done(c.resolve).fail(c.reject).progress(c.notify):c[f[0]+"With"](this===d?c.promise():this,g?[a]:arguments)})}),a=null}).promise()},promise:function(a){return null!=a?m.extend(a,d):d}},e={};return d.pipe=d.then,m.each(b,function(a,f){var g=f[2],h=f[3];d[f[1]]=g.add,h&&g.add(function(){c=h},b[1^a][2].disable,b[2][2].lock),e[f[0]]=function(){return e[f[0]+"With"](this===e?d:this,arguments),this},e[f[0]+"With"]=g.fireWith}),d.promise(e),a&&a.call(e,e),e},when:function(a){var b=0,c=d.call(arguments),e=c.length,f=1!==e||a&&m.isFunction(a.promise)?e:0,g=1===f?a:m.Deferred(),h=function(a,b,c){return function(e){b[a]=this,c[a]=arguments.length>1?d.call(arguments):e,c===i?g.notifyWith(b,c):--f||g.resolveWith(b,c)}},i,j,k;if(e>1)for(i=new Array(e),j=new Array(e),k=new Array(e);e>b;b++)c[b]&&m.isFunction(c[b].promise)?c[b].promise().done(h(b,k,c)).fail(g.reject).progress(h(b,j,i)):--f;return f||g.resolveWith(k,c),g.promise()}});var H;m.fn.ready=function(a){return m.ready.promise().done(a),this},m.extend({isReady:!1,readyWait:1,holdReady:function(a){a?m.readyWait++:m.ready(!0)},ready:function(a){if(a===!0?!--m.readyWait:!m.isReady){if(!y.body)return setTimeout(m.ready);m.isReady=!0,a!==!0&&--m.readyWait>0||(H.resolveWith(y,[m]),m.fn.triggerHandler&&(m(y).triggerHandler("ready"),m(y).off("ready")))}}});function I(){y.addEventListener?(y.removeEventListener("DOMContentLoaded",J,!1),a.removeEventListener("load",J,!1)):(y.detachEvent("onreadystatechange",J),a.detachEvent("onload",J))}function J(){(y.addEventListener||"load"===event.type||"complete"===y.readyState)&&(I(),m.ready())}m.ready.promise=function(b){if(!H)if(H=m.Deferred(),"complete"===y.readyState)setTimeout(m.ready);else if(y.addEventListener)y.addEventListener("DOMContentLoaded",J,!1),a.addEventListener("load",J,!1);else{y.attachEvent("onreadystatechange",J),a.attachEvent("onload",J);var c=!1;try{c=null==a.frameElement&&y.documentElement}catch(d){}c&&c.doScroll&&!function e(){if(!m.isReady){try{c.doScroll("left")}catch(a){return setTimeout(e,50)}I(),m.ready()}}()}return H.promise(b)};var K="undefined",L;for(L in m(k))break;k.ownLast="0"!==L,k.inlineBlockNeedsLayout=!1,m(function(){var a,b,c,d;c=y.getElementsByTagName("body")[0],c&&c.style&&(b=y.createElement("div"),d=y.createElement("div"),d.style.cssText="position:absolute;border:0;width:0;height:0;top:0;left:-9999px",c.appendChild(d).appendChild(b),typeof b.style.zoom!==K&&(b.style.cssText="display:inline;margin:0;border:0;padding:1px;width:1px;zoom:1",k.inlineBlockNeedsLayout=a=3===b.offsetWidth,a&&(c.style.zoom=1)),c.removeChild(d))}),function(){var a=y.createElement("div");if(null==k.deleteExpando){k.deleteExpando=!0;try{delete a.test}catch(b){k.deleteExpando=!1}}a=null}(),m.acceptData=function(a){var b=m.noData[(a.nodeName+" ").toLowerCase()],c=+a.nodeType||1;return 1!==c&&9!==c?!1:!b||b!==!0&&a.getAttribute("classid")===b};var M=/^(?:\{[\w\W]*\}|\[[\w\W]*\])$/,N=/([A-Z])/g;function O(a,b,c){if(void 0===c&&1===a.nodeType){var d="data-"+b.replace(N,"-$1").toLowerCase();if(c=a.getAttribute(d),"string"==typeof c){try{c="true"===c?!0:"false"===c?!1:"null"===c?null:+c+""===c?+c:M.test(c)?m.parseJSON(c):c}catch(e){}m.data(a,b,c)}else c=void 0}return c}function P(a){var b;for(b in a)if(("data"!==b||!m.isEmptyObject(a[b]))&&"toJSON"!==b)return!1;return!0}function Q(a,b,d,e){if(m.acceptData(a)){var f,g,h=m.expando,i=a.nodeType,j=i?m.cache:a,k=i?a[h]:a[h]&&h; +if(k&&j[k]&&(e||j[k].data)||void 0!==d||"string"!=typeof b)return k||(k=i?a[h]=c.pop()||m.guid++:h),j[k]||(j[k]=i?{}:{toJSON:m.noop}),("object"==typeof b||"function"==typeof b)&&(e?j[k]=m.extend(j[k],b):j[k].data=m.extend(j[k].data,b)),g=j[k],e||(g.data||(g.data={}),g=g.data),void 0!==d&&(g[m.camelCase(b)]=d),"string"==typeof b?(f=g[b],null==f&&(f=g[m.camelCase(b)])):f=g,f}}function R(a,b,c){if(m.acceptData(a)){var d,e,f=a.nodeType,g=f?m.cache:a,h=f?a[m.expando]:m.expando;if(g[h]){if(b&&(d=c?g[h]:g[h].data)){m.isArray(b)?b=b.concat(m.map(b,m.camelCase)):b in d?b=[b]:(b=m.camelCase(b),b=b in d?[b]:b.split(" ")),e=b.length;while(e--)delete d[b[e]];if(c?!P(d):!m.isEmptyObject(d))return}(c||(delete g[h].data,P(g[h])))&&(f?m.cleanData([a],!0):k.deleteExpando||g!=g.window?delete g[h]:g[h]=null)}}}m.extend({cache:{},noData:{"applet ":!0,"embed ":!0,"object ":"clsid:D27CDB6E-AE6D-11cf-96B8-444553540000"},hasData:function(a){return a=a.nodeType?m.cache[a[m.expando]]:a[m.expando],!!a&&!P(a)},data:function(a,b,c){return Q(a,b,c)},removeData:function(a,b){return R(a,b)},_data:function(a,b,c){return Q(a,b,c,!0)},_removeData:function(a,b){return R(a,b,!0)}}),m.fn.extend({data:function(a,b){var c,d,e,f=this[0],g=f&&f.attributes;if(void 0===a){if(this.length&&(e=m.data(f),1===f.nodeType&&!m._data(f,"parsedAttrs"))){c=g.length;while(c--)g[c]&&(d=g[c].name,0===d.indexOf("data-")&&(d=m.camelCase(d.slice(5)),O(f,d,e[d])));m._data(f,"parsedAttrs",!0)}return e}return"object"==typeof a?this.each(function(){m.data(this,a)}):arguments.length>1?this.each(function(){m.data(this,a,b)}):f?O(f,a,m.data(f,a)):void 0},removeData:function(a){return this.each(function(){m.removeData(this,a)})}}),m.extend({queue:function(a,b,c){var d;return a?(b=(b||"fx")+"queue",d=m._data(a,b),c&&(!d||m.isArray(c)?d=m._data(a,b,m.makeArray(c)):d.push(c)),d||[]):void 0},dequeue:function(a,b){b=b||"fx";var c=m.queue(a,b),d=c.length,e=c.shift(),f=m._queueHooks(a,b),g=function(){m.dequeue(a,b)};"inprogress"===e&&(e=c.shift(),d--),e&&("fx"===b&&c.unshift("inprogress"),delete f.stop,e.call(a,g,f)),!d&&f&&f.empty.fire()},_queueHooks:function(a,b){var c=b+"queueHooks";return m._data(a,c)||m._data(a,c,{empty:m.Callbacks("once memory").add(function(){m._removeData(a,b+"queue"),m._removeData(a,c)})})}}),m.fn.extend({queue:function(a,b){var c=2;return"string"!=typeof a&&(b=a,a="fx",c--),arguments.length<c?m.queue(this[0],a):void 0===b?this:this.each(function(){var c=m.queue(this,a,b);m._queueHooks(this,a),"fx"===a&&"inprogress"!==c[0]&&m.dequeue(this,a)})},dequeue:function(a){return this.each(function(){m.dequeue(this,a)})},clearQueue:function(a){return this.queue(a||"fx",[])},promise:function(a,b){var c,d=1,e=m.Deferred(),f=this,g=this.length,h=function(){--d||e.resolveWith(f,[f])};"string"!=typeof a&&(b=a,a=void 0),a=a||"fx";while(g--)c=m._data(f[g],a+"queueHooks"),c&&c.empty&&(d++,c.empty.add(h));return h(),e.promise(b)}});var S=/[+-]?(?:\d*\.|)\d+(?:[eE][+-]?\d+|)/.source,T=["Top","Right","Bottom","Left"],U=function(a,b){return a=b||a,"none"===m.css(a,"display")||!m.contains(a.ownerDocument,a)},V=m.access=function(a,b,c,d,e,f,g){var h=0,i=a.length,j=null==c;if("object"===m.type(c)){e=!0;for(h in c)m.access(a,b,h,c[h],!0,f,g)}else if(void 0!==d&&(e=!0,m.isFunction(d)||(g=!0),j&&(g?(b.call(a,d),b=null):(j=b,b=function(a,b,c){return j.call(m(a),c)})),b))for(;i>h;h++)b(a[h],c,g?d:d.call(a[h],h,b(a[h],c)));return e?a:j?b.call(a):i?b(a[0],c):f},W=/^(?:checkbox|radio)$/i;!function(){var a=y.createElement("input"),b=y.createElement("div"),c=y.createDocumentFragment();if(b.innerHTML=" <link/><table></table><a href='/a'>a</a><input type='checkbox'/>",k.leadingWhitespace=3===b.firstChild.nodeType,k.tbody=!b.getElementsByTagName("tbody").length,k.htmlSerialize=!!b.getElementsByTagName("link").length,k.html5Clone="<:nav></:nav>"!==y.createElement("nav").cloneNode(!0).outerHTML,a.type="checkbox",a.checked=!0,c.appendChild(a),k.appendChecked=a.checked,b.innerHTML="<textarea>x</textarea>",k.noCloneChecked=!!b.cloneNode(!0).lastChild.defaultValue,c.appendChild(b),b.innerHTML="<input type='radio' checked='checked' name='t'/>",k.checkClone=b.cloneNode(!0).cloneNode(!0).lastChild.checked,k.noCloneEvent=!0,b.attachEvent&&(b.attachEvent("onclick",function(){k.noCloneEvent=!1}),b.cloneNode(!0).click()),null==k.deleteExpando){k.deleteExpando=!0;try{delete b.test}catch(d){k.deleteExpando=!1}}}(),function(){var b,c,d=y.createElement("div");for(b in{submit:!0,change:!0,focusin:!0})c="on"+b,(k[b+"Bubbles"]=c in a)||(d.setAttribute(c,"t"),k[b+"Bubbles"]=d.attributes[c].expando===!1);d=null}();var X=/^(?:input|select|textarea)$/i,Y=/^key/,Z=/^(?:mouse|pointer|contextmenu)|click/,$=/^(?:focusinfocus|focusoutblur)$/,_=/^([^.]*)(?:\.(.+)|)$/;function ab(){return!0}function bb(){return!1}function cb(){try{return y.activeElement}catch(a){}}m.event={global:{},add:function(a,b,c,d,e){var f,g,h,i,j,k,l,n,o,p,q,r=m._data(a);if(r){c.handler&&(i=c,c=i.handler,e=i.selector),c.guid||(c.guid=m.guid++),(g=r.events)||(g=r.events={}),(k=r.handle)||(k=r.handle=function(a){return typeof m===K||a&&m.event.triggered===a.type?void 0:m.event.dispatch.apply(k.elem,arguments)},k.elem=a),b=(b||"").match(E)||[""],h=b.length;while(h--)f=_.exec(b[h])||[],o=q=f[1],p=(f[2]||"").split(".").sort(),o&&(j=m.event.special[o]||{},o=(e?j.delegateType:j.bindType)||o,j=m.event.special[o]||{},l=m.extend({type:o,origType:q,data:d,handler:c,guid:c.guid,selector:e,needsContext:e&&m.expr.match.needsContext.test(e),namespace:p.join(".")},i),(n=g[o])||(n=g[o]=[],n.delegateCount=0,j.setup&&j.setup.call(a,d,p,k)!==!1||(a.addEventListener?a.addEventListener(o,k,!1):a.attachEvent&&a.attachEvent("on"+o,k))),j.add&&(j.add.call(a,l),l.handler.guid||(l.handler.guid=c.guid)),e?n.splice(n.delegateCount++,0,l):n.push(l),m.event.global[o]=!0);a=null}},remove:function(a,b,c,d,e){var f,g,h,i,j,k,l,n,o,p,q,r=m.hasData(a)&&m._data(a);if(r&&(k=r.events)){b=(b||"").match(E)||[""],j=b.length;while(j--)if(h=_.exec(b[j])||[],o=q=h[1],p=(h[2]||"").split(".").sort(),o){l=m.event.special[o]||{},o=(d?l.delegateType:l.bindType)||o,n=k[o]||[],h=h[2]&&new RegExp("(^|\\.)"+p.join("\\.(?:.*\\.|)")+"(\\.|$)"),i=f=n.length;while(f--)g=n[f],!e&&q!==g.origType||c&&c.guid!==g.guid||h&&!h.test(g.namespace)||d&&d!==g.selector&&("**"!==d||!g.selector)||(n.splice(f,1),g.selector&&n.delegateCount--,l.remove&&l.remove.call(a,g));i&&!n.length&&(l.teardown&&l.teardown.call(a,p,r.handle)!==!1||m.removeEvent(a,o,r.handle),delete k[o])}else for(o in k)m.event.remove(a,o+b[j],c,d,!0);m.isEmptyObject(k)&&(delete r.handle,m._removeData(a,"events"))}},trigger:function(b,c,d,e){var f,g,h,i,k,l,n,o=[d||y],p=j.call(b,"type")?b.type:b,q=j.call(b,"namespace")?b.namespace.split("."):[];if(h=l=d=d||y,3!==d.nodeType&&8!==d.nodeType&&!$.test(p+m.event.triggered)&&(p.indexOf(".")>=0&&(q=p.split("."),p=q.shift(),q.sort()),g=p.indexOf(":")<0&&"on"+p,b=b[m.expando]?b:new m.Event(p,"object"==typeof b&&b),b.isTrigger=e?2:3,b.namespace=q.join("."),b.namespace_re=b.namespace?new RegExp("(^|\\.)"+q.join("\\.(?:.*\\.|)")+"(\\.|$)"):null,b.result=void 0,b.target||(b.target=d),c=null==c?[b]:m.makeArray(c,[b]),k=m.event.special[p]||{},e||!k.trigger||k.trigger.apply(d,c)!==!1)){if(!e&&!k.noBubble&&!m.isWindow(d)){for(i=k.delegateType||p,$.test(i+p)||(h=h.parentNode);h;h=h.parentNode)o.push(h),l=h;l===(d.ownerDocument||y)&&o.push(l.defaultView||l.parentWindow||a)}n=0;while((h=o[n++])&&!b.isPropagationStopped())b.type=n>1?i:k.bindType||p,f=(m._data(h,"events")||{})[b.type]&&m._data(h,"handle"),f&&f.apply(h,c),f=g&&h[g],f&&f.apply&&m.acceptData(h)&&(b.result=f.apply(h,c),b.result===!1&&b.preventDefault());if(b.type=p,!e&&!b.isDefaultPrevented()&&(!k._default||k._default.apply(o.pop(),c)===!1)&&m.acceptData(d)&&g&&d[p]&&!m.isWindow(d)){l=d[g],l&&(d[g]=null),m.event.triggered=p;try{d[p]()}catch(r){}m.event.triggered=void 0,l&&(d[g]=l)}return b.result}},dispatch:function(a){a=m.event.fix(a);var b,c,e,f,g,h=[],i=d.call(arguments),j=(m._data(this,"events")||{})[a.type]||[],k=m.event.special[a.type]||{};if(i[0]=a,a.delegateTarget=this,!k.preDispatch||k.preDispatch.call(this,a)!==!1){h=m.event.handlers.call(this,a,j),b=0;while((f=h[b++])&&!a.isPropagationStopped()){a.currentTarget=f.elem,g=0;while((e=f.handlers[g++])&&!a.isImmediatePropagationStopped())(!a.namespace_re||a.namespace_re.test(e.namespace))&&(a.handleObj=e,a.data=e.data,c=((m.event.special[e.origType]||{}).handle||e.handler).apply(f.elem,i),void 0!==c&&(a.result=c)===!1&&(a.preventDefault(),a.stopPropagation()))}return k.postDispatch&&k.postDispatch.call(this,a),a.result}},handlers:function(a,b){var c,d,e,f,g=[],h=b.delegateCount,i=a.target;if(h&&i.nodeType&&(!a.button||"click"!==a.type))for(;i!=this;i=i.parentNode||this)if(1===i.nodeType&&(i.disabled!==!0||"click"!==a.type)){for(e=[],f=0;h>f;f++)d=b[f],c=d.selector+" ",void 0===e[c]&&(e[c]=d.needsContext?m(c,this).index(i)>=0:m.find(c,this,null,[i]).length),e[c]&&e.push(d);e.length&&g.push({elem:i,handlers:e})}return h<b.length&&g.push({elem:this,handlers:b.slice(h)}),g},fix:function(a){if(a[m.expando])return a;var b,c,d,e=a.type,f=a,g=this.fixHooks[e];g||(this.fixHooks[e]=g=Z.test(e)?this.mouseHooks:Y.test(e)?this.keyHooks:{}),d=g.props?this.props.concat(g.props):this.props,a=new m.Event(f),b=d.length;while(b--)c=d[b],a[c]=f[c];return a.target||(a.target=f.srcElement||y),3===a.target.nodeType&&(a.target=a.target.parentNode),a.metaKey=!!a.metaKey,g.filter?g.filter(a,f):a},props:"altKey bubbles cancelable ctrlKey currentTarget eventPhase metaKey relatedTarget shiftKey target timeStamp view which".split(" "),fixHooks:{},keyHooks:{props:"char charCode key keyCode".split(" "),filter:function(a,b){return null==a.which&&(a.which=null!=b.charCode?b.charCode:b.keyCode),a}},mouseHooks:{props:"button buttons clientX clientY fromElement offsetX offsetY pageX pageY screenX screenY toElement".split(" "),filter:function(a,b){var c,d,e,f=b.button,g=b.fromElement;return null==a.pageX&&null!=b.clientX&&(d=a.target.ownerDocument||y,e=d.documentElement,c=d.body,a.pageX=b.clientX+(e&&e.scrollLeft||c&&c.scrollLeft||0)-(e&&e.clientLeft||c&&c.clientLeft||0),a.pageY=b.clientY+(e&&e.scrollTop||c&&c.scrollTop||0)-(e&&e.clientTop||c&&c.clientTop||0)),!a.relatedTarget&&g&&(a.relatedTarget=g===a.target?b.toElement:g),a.which||void 0===f||(a.which=1&f?1:2&f?3:4&f?2:0),a}},special:{load:{noBubble:!0},focus:{trigger:function(){if(this!==cb()&&this.focus)try{return this.focus(),!1}catch(a){}},delegateType:"focusin"},blur:{trigger:function(){return this===cb()&&this.blur?(this.blur(),!1):void 0},delegateType:"focusout"},click:{trigger:function(){return m.nodeName(this,"input")&&"checkbox"===this.type&&this.click?(this.click(),!1):void 0},_default:function(a){return m.nodeName(a.target,"a")}},beforeunload:{postDispatch:function(a){void 0!==a.result&&a.originalEvent&&(a.originalEvent.returnValue=a.result)}}},simulate:function(a,b,c,d){var e=m.extend(new m.Event,c,{type:a,isSimulated:!0,originalEvent:{}});d?m.event.trigger(e,null,b):m.event.dispatch.call(b,e),e.isDefaultPrevented()&&c.preventDefault()}},m.removeEvent=y.removeEventListener?function(a,b,c){a.removeEventListener&&a.removeEventListener(b,c,!1)}:function(a,b,c){var d="on"+b;a.detachEvent&&(typeof a[d]===K&&(a[d]=null),a.detachEvent(d,c))},m.Event=function(a,b){return this instanceof m.Event?(a&&a.type?(this.originalEvent=a,this.type=a.type,this.isDefaultPrevented=a.defaultPrevented||void 0===a.defaultPrevented&&a.returnValue===!1?ab:bb):this.type=a,b&&m.extend(this,b),this.timeStamp=a&&a.timeStamp||m.now(),void(this[m.expando]=!0)):new m.Event(a,b)},m.Event.prototype={isDefaultPrevented:bb,isPropagationStopped:bb,isImmediatePropagationStopped:bb,preventDefault:function(){var a=this.originalEvent;this.isDefaultPrevented=ab,a&&(a.preventDefault?a.preventDefault():a.returnValue=!1)},stopPropagation:function(){var a=this.originalEvent;this.isPropagationStopped=ab,a&&(a.stopPropagation&&a.stopPropagation(),a.cancelBubble=!0)},stopImmediatePropagation:function(){var a=this.originalEvent;this.isImmediatePropagationStopped=ab,a&&a.stopImmediatePropagation&&a.stopImmediatePropagation(),this.stopPropagation()}},m.each({mouseenter:"mouseover",mouseleave:"mouseout",pointerenter:"pointerover",pointerleave:"pointerout"},function(a,b){m.event.special[a]={delegateType:b,bindType:b,handle:function(a){var c,d=this,e=a.relatedTarget,f=a.handleObj;return(!e||e!==d&&!m.contains(d,e))&&(a.type=f.origType,c=f.handler.apply(this,arguments),a.type=b),c}}}),k.submitBubbles||(m.event.special.submit={setup:function(){return m.nodeName(this,"form")?!1:void m.event.add(this,"click._submit keypress._submit",function(a){var b=a.target,c=m.nodeName(b,"input")||m.nodeName(b,"button")?b.form:void 0;c&&!m._data(c,"submitBubbles")&&(m.event.add(c,"submit._submit",function(a){a._submit_bubble=!0}),m._data(c,"submitBubbles",!0))})},postDispatch:function(a){a._submit_bubble&&(delete a._submit_bubble,this.parentNode&&!a.isTrigger&&m.event.simulate("submit",this.parentNode,a,!0))},teardown:function(){return m.nodeName(this,"form")?!1:void m.event.remove(this,"._submit")}}),k.changeBubbles||(m.event.special.change={setup:function(){return X.test(this.nodeName)?(("checkbox"===this.type||"radio"===this.type)&&(m.event.add(this,"propertychange._change",function(a){"checked"===a.originalEvent.propertyName&&(this._just_changed=!0)}),m.event.add(this,"click._change",function(a){this._just_changed&&!a.isTrigger&&(this._just_changed=!1),m.event.simulate("change",this,a,!0)})),!1):void m.event.add(this,"beforeactivate._change",function(a){var b=a.target;X.test(b.nodeName)&&!m._data(b,"changeBubbles")&&(m.event.add(b,"change._change",function(a){!this.parentNode||a.isSimulated||a.isTrigger||m.event.simulate("change",this.parentNode,a,!0)}),m._data(b,"changeBubbles",!0))})},handle:function(a){var b=a.target;return this!==b||a.isSimulated||a.isTrigger||"radio"!==b.type&&"checkbox"!==b.type?a.handleObj.handler.apply(this,arguments):void 0},teardown:function(){return m.event.remove(this,"._change"),!X.test(this.nodeName)}}),k.focusinBubbles||m.each({focus:"focusin",blur:"focusout"},function(a,b){var c=function(a){m.event.simulate(b,a.target,m.event.fix(a),!0)};m.event.special[b]={setup:function(){var d=this.ownerDocument||this,e=m._data(d,b);e||d.addEventListener(a,c,!0),m._data(d,b,(e||0)+1)},teardown:function(){var d=this.ownerDocument||this,e=m._data(d,b)-1;e?m._data(d,b,e):(d.removeEventListener(a,c,!0),m._removeData(d,b))}}}),m.fn.extend({on:function(a,b,c,d,e){var f,g;if("object"==typeof a){"string"!=typeof b&&(c=c||b,b=void 0);for(f in a)this.on(f,b,c,a[f],e);return this}if(null==c&&null==d?(d=b,c=b=void 0):null==d&&("string"==typeof b?(d=c,c=void 0):(d=c,c=b,b=void 0)),d===!1)d=bb;else if(!d)return this;return 1===e&&(g=d,d=function(a){return m().off(a),g.apply(this,arguments)},d.guid=g.guid||(g.guid=m.guid++)),this.each(function(){m.event.add(this,a,d,c,b)})},one:function(a,b,c,d){return this.on(a,b,c,d,1)},off:function(a,b,c){var d,e;if(a&&a.preventDefault&&a.handleObj)return d=a.handleObj,m(a.delegateTarget).off(d.namespace?d.origType+"."+d.namespace:d.origType,d.selector,d.handler),this;if("object"==typeof a){for(e in a)this.off(e,b,a[e]);return this}return(b===!1||"function"==typeof b)&&(c=b,b=void 0),c===!1&&(c=bb),this.each(function(){m.event.remove(this,a,c,b)})},trigger:function(a,b){return this.each(function(){m.event.trigger(a,b,this)})},triggerHandler:function(a,b){var c=this[0];return c?m.event.trigger(a,b,c,!0):void 0}});function db(a){var b=eb.split("|"),c=a.createDocumentFragment();if(c.createElement)while(b.length)c.createElement(b.pop());return c}var eb="abbr|article|aside|audio|bdi|canvas|data|datalist|details|figcaption|figure|footer|header|hgroup|mark|meter|nav|output|progress|section|summary|time|video",fb=/ jQuery\d+="(?:null|\d+)"/g,gb=new RegExp("<(?:"+eb+")[\\s/>]","i"),hb=/^\s+/,ib=/<(?!area|br|col|embed|hr|img|input|link|meta|param)(([\w:]+)[^>]*)\/>/gi,jb=/<([\w:]+)/,kb=/<tbody/i,lb=/<|&#?\w+;/,mb=/<(?:script|style|link)/i,nb=/checked\s*(?:[^=]|=\s*.checked.)/i,ob=/^$|\/(?:java|ecma)script/i,pb=/^true\/(.*)/,qb=/^\s*<!(?:\[CDATA\[|--)|(?:\]\]|--)>\s*$/g,rb={option:[1,"<select multiple='multiple'>","</select>"],legend:[1,"<fieldset>","</fieldset>"],area:[1,"<map>","</map>"],param:[1,"<object>","</object>"],thead:[1,"<table>","</table>"],tr:[2,"<table><tbody>","</tbody></table>"],col:[2,"<table><tbody></tbody><colgroup>","</colgroup></table>"],td:[3,"<table><tbody><tr>","</tr></tbody></table>"],_default:k.htmlSerialize?[0,"",""]:[1,"X<div>","</div>"]},sb=db(y),tb=sb.appendChild(y.createElement("div"));rb.optgroup=rb.option,rb.tbody=rb.tfoot=rb.colgroup=rb.caption=rb.thead,rb.th=rb.td;function ub(a,b){var c,d,e=0,f=typeof a.getElementsByTagName!==K?a.getElementsByTagName(b||"*"):typeof a.querySelectorAll!==K?a.querySelectorAll(b||"*"):void 0;if(!f)for(f=[],c=a.childNodes||a;null!=(d=c[e]);e++)!b||m.nodeName(d,b)?f.push(d):m.merge(f,ub(d,b));return void 0===b||b&&m.nodeName(a,b)?m.merge([a],f):f}function vb(a){W.test(a.type)&&(a.defaultChecked=a.checked)}function wb(a,b){return m.nodeName(a,"table")&&m.nodeName(11!==b.nodeType?b:b.firstChild,"tr")?a.getElementsByTagName("tbody")[0]||a.appendChild(a.ownerDocument.createElement("tbody")):a}function xb(a){return a.type=(null!==m.find.attr(a,"type"))+"/"+a.type,a}function yb(a){var b=pb.exec(a.type);return b?a.type=b[1]:a.removeAttribute("type"),a}function zb(a,b){for(var c,d=0;null!=(c=a[d]);d++)m._data(c,"globalEval",!b||m._data(b[d],"globalEval"))}function Ab(a,b){if(1===b.nodeType&&m.hasData(a)){var c,d,e,f=m._data(a),g=m._data(b,f),h=f.events;if(h){delete g.handle,g.events={};for(c in h)for(d=0,e=h[c].length;e>d;d++)m.event.add(b,c,h[c][d])}g.data&&(g.data=m.extend({},g.data))}}function Bb(a,b){var c,d,e;if(1===b.nodeType){if(c=b.nodeName.toLowerCase(),!k.noCloneEvent&&b[m.expando]){e=m._data(b);for(d in e.events)m.removeEvent(b,d,e.handle);b.removeAttribute(m.expando)}"script"===c&&b.text!==a.text?(xb(b).text=a.text,yb(b)):"object"===c?(b.parentNode&&(b.outerHTML=a.outerHTML),k.html5Clone&&a.innerHTML&&!m.trim(b.innerHTML)&&(b.innerHTML=a.innerHTML)):"input"===c&&W.test(a.type)?(b.defaultChecked=b.checked=a.checked,b.value!==a.value&&(b.value=a.value)):"option"===c?b.defaultSelected=b.selected=a.defaultSelected:("input"===c||"textarea"===c)&&(b.defaultValue=a.defaultValue)}}m.extend({clone:function(a,b,c){var d,e,f,g,h,i=m.contains(a.ownerDocument,a);if(k.html5Clone||m.isXMLDoc(a)||!gb.test("<"+a.nodeName+">")?f=a.cloneNode(!0):(tb.innerHTML=a.outerHTML,tb.removeChild(f=tb.firstChild)),!(k.noCloneEvent&&k.noCloneChecked||1!==a.nodeType&&11!==a.nodeType||m.isXMLDoc(a)))for(d=ub(f),h=ub(a),g=0;null!=(e=h[g]);++g)d[g]&&Bb(e,d[g]);if(b)if(c)for(h=h||ub(a),d=d||ub(f),g=0;null!=(e=h[g]);g++)Ab(e,d[g]);else Ab(a,f);return d=ub(f,"script"),d.length>0&&zb(d,!i&&ub(a,"script")),d=h=e=null,f},buildFragment:function(a,b,c,d){for(var e,f,g,h,i,j,l,n=a.length,o=db(b),p=[],q=0;n>q;q++)if(f=a[q],f||0===f)if("object"===m.type(f))m.merge(p,f.nodeType?[f]:f);else if(lb.test(f)){h=h||o.appendChild(b.createElement("div")),i=(jb.exec(f)||["",""])[1].toLowerCase(),l=rb[i]||rb._default,h.innerHTML=l[1]+f.replace(ib,"<$1></$2>")+l[2],e=l[0];while(e--)h=h.lastChild;if(!k.leadingWhitespace&&hb.test(f)&&p.push(b.createTextNode(hb.exec(f)[0])),!k.tbody){f="table"!==i||kb.test(f)?"<table>"!==l[1]||kb.test(f)?0:h:h.firstChild,e=f&&f.childNodes.length;while(e--)m.nodeName(j=f.childNodes[e],"tbody")&&!j.childNodes.length&&f.removeChild(j)}m.merge(p,h.childNodes),h.textContent="";while(h.firstChild)h.removeChild(h.firstChild);h=o.lastChild}else p.push(b.createTextNode(f));h&&o.removeChild(h),k.appendChecked||m.grep(ub(p,"input"),vb),q=0;while(f=p[q++])if((!d||-1===m.inArray(f,d))&&(g=m.contains(f.ownerDocument,f),h=ub(o.appendChild(f),"script"),g&&zb(h),c)){e=0;while(f=h[e++])ob.test(f.type||"")&&c.push(f)}return h=null,o},cleanData:function(a,b){for(var d,e,f,g,h=0,i=m.expando,j=m.cache,l=k.deleteExpando,n=m.event.special;null!=(d=a[h]);h++)if((b||m.acceptData(d))&&(f=d[i],g=f&&j[f])){if(g.events)for(e in g.events)n[e]?m.event.remove(d,e):m.removeEvent(d,e,g.handle);j[f]&&(delete j[f],l?delete d[i]:typeof d.removeAttribute!==K?d.removeAttribute(i):d[i]=null,c.push(f))}}}),m.fn.extend({text:function(a){return V(this,function(a){return void 0===a?m.text(this):this.empty().append((this[0]&&this[0].ownerDocument||y).createTextNode(a))},null,a,arguments.length)},append:function(){return this.domManip(arguments,function(a){if(1===this.nodeType||11===this.nodeType||9===this.nodeType){var b=wb(this,a);b.appendChild(a)}})},prepend:function(){return this.domManip(arguments,function(a){if(1===this.nodeType||11===this.nodeType||9===this.nodeType){var b=wb(this,a);b.insertBefore(a,b.firstChild)}})},before:function(){return this.domManip(arguments,function(a){this.parentNode&&this.parentNode.insertBefore(a,this)})},after:function(){return this.domManip(arguments,function(a){this.parentNode&&this.parentNode.insertBefore(a,this.nextSibling)})},remove:function(a,b){for(var c,d=a?m.filter(a,this):this,e=0;null!=(c=d[e]);e++)b||1!==c.nodeType||m.cleanData(ub(c)),c.parentNode&&(b&&m.contains(c.ownerDocument,c)&&zb(ub(c,"script")),c.parentNode.removeChild(c));return this},empty:function(){for(var a,b=0;null!=(a=this[b]);b++){1===a.nodeType&&m.cleanData(ub(a,!1));while(a.firstChild)a.removeChild(a.firstChild);a.options&&m.nodeName(a,"select")&&(a.options.length=0)}return this},clone:function(a,b){return a=null==a?!1:a,b=null==b?a:b,this.map(function(){return m.clone(this,a,b)})},html:function(a){return V(this,function(a){var b=this[0]||{},c=0,d=this.length;if(void 0===a)return 1===b.nodeType?b.innerHTML.replace(fb,""):void 0;if(!("string"!=typeof a||mb.test(a)||!k.htmlSerialize&&gb.test(a)||!k.leadingWhitespace&&hb.test(a)||rb[(jb.exec(a)||["",""])[1].toLowerCase()])){a=a.replace(ib,"<$1></$2>");try{for(;d>c;c++)b=this[c]||{},1===b.nodeType&&(m.cleanData(ub(b,!1)),b.innerHTML=a);b=0}catch(e){}}b&&this.empty().append(a)},null,a,arguments.length)},replaceWith:function(){var a=arguments[0];return this.domManip(arguments,function(b){a=this.parentNode,m.cleanData(ub(this)),a&&a.replaceChild(b,this)}),a&&(a.length||a.nodeType)?this:this.remove()},detach:function(a){return this.remove(a,!0)},domManip:function(a,b){a=e.apply([],a);var c,d,f,g,h,i,j=0,l=this.length,n=this,o=l-1,p=a[0],q=m.isFunction(p);if(q||l>1&&"string"==typeof p&&!k.checkClone&&nb.test(p))return this.each(function(c){var d=n.eq(c);q&&(a[0]=p.call(this,c,d.html())),d.domManip(a,b)});if(l&&(i=m.buildFragment(a,this[0].ownerDocument,!1,this),c=i.firstChild,1===i.childNodes.length&&(i=c),c)){for(g=m.map(ub(i,"script"),xb),f=g.length;l>j;j++)d=i,j!==o&&(d=m.clone(d,!0,!0),f&&m.merge(g,ub(d,"script"))),b.call(this[j],d,j);if(f)for(h=g[g.length-1].ownerDocument,m.map(g,yb),j=0;f>j;j++)d=g[j],ob.test(d.type||"")&&!m._data(d,"globalEval")&&m.contains(h,d)&&(d.src?m._evalUrl&&m._evalUrl(d.src):m.globalEval((d.text||d.textContent||d.innerHTML||"").replace(qb,"")));i=c=null}return this}}),m.each({appendTo:"append",prependTo:"prepend",insertBefore:"before",insertAfter:"after",replaceAll:"replaceWith"},function(a,b){m.fn[a]=function(a){for(var c,d=0,e=[],g=m(a),h=g.length-1;h>=d;d++)c=d===h?this:this.clone(!0),m(g[d])[b](c),f.apply(e,c.get());return this.pushStack(e)}});var Cb,Db={};function Eb(b,c){var d,e=m(c.createElement(b)).appendTo(c.body),f=a.getDefaultComputedStyle&&(d=a.getDefaultComputedStyle(e[0]))?d.display:m.css(e[0],"display");return e.detach(),f}function Fb(a){var b=y,c=Db[a];return c||(c=Eb(a,b),"none"!==c&&c||(Cb=(Cb||m("<iframe frameborder='0' width='0' height='0'/>")).appendTo(b.documentElement),b=(Cb[0].contentWindow||Cb[0].contentDocument).document,b.write(),b.close(),c=Eb(a,b),Cb.detach()),Db[a]=c),c}!function(){var a;k.shrinkWrapBlocks=function(){if(null!=a)return a;a=!1;var b,c,d;return c=y.getElementsByTagName("body")[0],c&&c.style?(b=y.createElement("div"),d=y.createElement("div"),d.style.cssText="position:absolute;border:0;width:0;height:0;top:0;left:-9999px",c.appendChild(d).appendChild(b),typeof b.style.zoom!==K&&(b.style.cssText="-webkit-box-sizing:content-box;-moz-box-sizing:content-box;box-sizing:content-box;display:block;margin:0;border:0;padding:1px;width:1px;zoom:1",b.appendChild(y.createElement("div")).style.width="5px",a=3!==b.offsetWidth),c.removeChild(d),a):void 0}}();var Gb=/^margin/,Hb=new RegExp("^("+S+")(?!px)[a-z%]+$","i"),Ib,Jb,Kb=/^(top|right|bottom|left)$/;a.getComputedStyle?(Ib=function(a){return a.ownerDocument.defaultView.getComputedStyle(a,null)},Jb=function(a,b,c){var d,e,f,g,h=a.style;return c=c||Ib(a),g=c?c.getPropertyValue(b)||c[b]:void 0,c&&(""!==g||m.contains(a.ownerDocument,a)||(g=m.style(a,b)),Hb.test(g)&&Gb.test(b)&&(d=h.width,e=h.minWidth,f=h.maxWidth,h.minWidth=h.maxWidth=h.width=g,g=c.width,h.width=d,h.minWidth=e,h.maxWidth=f)),void 0===g?g:g+""}):y.documentElement.currentStyle&&(Ib=function(a){return a.currentStyle},Jb=function(a,b,c){var d,e,f,g,h=a.style;return c=c||Ib(a),g=c?c[b]:void 0,null==g&&h&&h[b]&&(g=h[b]),Hb.test(g)&&!Kb.test(b)&&(d=h.left,e=a.runtimeStyle,f=e&&e.left,f&&(e.left=a.currentStyle.left),h.left="fontSize"===b?"1em":g,g=h.pixelLeft+"px",h.left=d,f&&(e.left=f)),void 0===g?g:g+""||"auto"});function Lb(a,b){return{get:function(){var c=a();if(null!=c)return c?void delete this.get:(this.get=b).apply(this,arguments)}}}!function(){var b,c,d,e,f,g,h;if(b=y.createElement("div"),b.innerHTML=" <link/><table></table><a href='/a'>a</a><input type='checkbox'/>",d=b.getElementsByTagName("a")[0],c=d&&d.style){c.cssText="float:left;opacity:.5",k.opacity="0.5"===c.opacity,k.cssFloat=!!c.cssFloat,b.style.backgroundClip="content-box",b.cloneNode(!0).style.backgroundClip="",k.clearCloneStyle="content-box"===b.style.backgroundClip,k.boxSizing=""===c.boxSizing||""===c.MozBoxSizing||""===c.WebkitBoxSizing,m.extend(k,{reliableHiddenOffsets:function(){return null==g&&i(),g},boxSizingReliable:function(){return null==f&&i(),f},pixelPosition:function(){return null==e&&i(),e},reliableMarginRight:function(){return null==h&&i(),h}});function i(){var b,c,d,i;c=y.getElementsByTagName("body")[0],c&&c.style&&(b=y.createElement("div"),d=y.createElement("div"),d.style.cssText="position:absolute;border:0;width:0;height:0;top:0;left:-9999px",c.appendChild(d).appendChild(b),b.style.cssText="-webkit-box-sizing:border-box;-moz-box-sizing:border-box;box-sizing:border-box;display:block;margin-top:1%;top:1%;border:1px;padding:1px;width:4px;position:absolute",e=f=!1,h=!0,a.getComputedStyle&&(e="1%"!==(a.getComputedStyle(b,null)||{}).top,f="4px"===(a.getComputedStyle(b,null)||{width:"4px"}).width,i=b.appendChild(y.createElement("div")),i.style.cssText=b.style.cssText="-webkit-box-sizing:content-box;-moz-box-sizing:content-box;box-sizing:content-box;display:block;margin:0;border:0;padding:0",i.style.marginRight=i.style.width="0",b.style.width="1px",h=!parseFloat((a.getComputedStyle(i,null)||{}).marginRight)),b.innerHTML="<table><tr><td></td><td>t</td></tr></table>",i=b.getElementsByTagName("td"),i[0].style.cssText="margin:0;border:0;padding:0;display:none",g=0===i[0].offsetHeight,g&&(i[0].style.display="",i[1].style.display="none",g=0===i[0].offsetHeight),c.removeChild(d))}}}(),m.swap=function(a,b,c,d){var e,f,g={};for(f in b)g[f]=a.style[f],a.style[f]=b[f];e=c.apply(a,d||[]);for(f in b)a.style[f]=g[f];return e};var Mb=/alpha\([^)]*\)/i,Nb=/opacity\s*=\s*([^)]*)/,Ob=/^(none|table(?!-c[ea]).+)/,Pb=new RegExp("^("+S+")(.*)$","i"),Qb=new RegExp("^([+-])=("+S+")","i"),Rb={position:"absolute",visibility:"hidden",display:"block"},Sb={letterSpacing:"0",fontWeight:"400"},Tb=["Webkit","O","Moz","ms"];function Ub(a,b){if(b in a)return b;var c=b.charAt(0).toUpperCase()+b.slice(1),d=b,e=Tb.length;while(e--)if(b=Tb[e]+c,b in a)return b;return d}function Vb(a,b){for(var c,d,e,f=[],g=0,h=a.length;h>g;g++)d=a[g],d.style&&(f[g]=m._data(d,"olddisplay"),c=d.style.display,b?(f[g]||"none"!==c||(d.style.display=""),""===d.style.display&&U(d)&&(f[g]=m._data(d,"olddisplay",Fb(d.nodeName)))):(e=U(d),(c&&"none"!==c||!e)&&m._data(d,"olddisplay",e?c:m.css(d,"display"))));for(g=0;h>g;g++)d=a[g],d.style&&(b&&"none"!==d.style.display&&""!==d.style.display||(d.style.display=b?f[g]||"":"none"));return a}function Wb(a,b,c){var d=Pb.exec(b);return d?Math.max(0,d[1]-(c||0))+(d[2]||"px"):b}function Xb(a,b,c,d,e){for(var f=c===(d?"border":"content")?4:"width"===b?1:0,g=0;4>f;f+=2)"margin"===c&&(g+=m.css(a,c+T[f],!0,e)),d?("content"===c&&(g-=m.css(a,"padding"+T[f],!0,e)),"margin"!==c&&(g-=m.css(a,"border"+T[f]+"Width",!0,e))):(g+=m.css(a,"padding"+T[f],!0,e),"padding"!==c&&(g+=m.css(a,"border"+T[f]+"Width",!0,e)));return g}function Yb(a,b,c){var d=!0,e="width"===b?a.offsetWidth:a.offsetHeight,f=Ib(a),g=k.boxSizing&&"border-box"===m.css(a,"boxSizing",!1,f);if(0>=e||null==e){if(e=Jb(a,b,f),(0>e||null==e)&&(e=a.style[b]),Hb.test(e))return e;d=g&&(k.boxSizingReliable()||e===a.style[b]),e=parseFloat(e)||0}return e+Xb(a,b,c||(g?"border":"content"),d,f)+"px"}m.extend({cssHooks:{opacity:{get:function(a,b){if(b){var c=Jb(a,"opacity");return""===c?"1":c}}}},cssNumber:{columnCount:!0,fillOpacity:!0,flexGrow:!0,flexShrink:!0,fontWeight:!0,lineHeight:!0,opacity:!0,order:!0,orphans:!0,widows:!0,zIndex:!0,zoom:!0},cssProps:{"float":k.cssFloat?"cssFloat":"styleFloat"},style:function(a,b,c,d){if(a&&3!==a.nodeType&&8!==a.nodeType&&a.style){var e,f,g,h=m.camelCase(b),i=a.style;if(b=m.cssProps[h]||(m.cssProps[h]=Ub(i,h)),g=m.cssHooks[b]||m.cssHooks[h],void 0===c)return g&&"get"in g&&void 0!==(e=g.get(a,!1,d))?e:i[b];if(f=typeof c,"string"===f&&(e=Qb.exec(c))&&(c=(e[1]+1)*e[2]+parseFloat(m.css(a,b)),f="number"),null!=c&&c===c&&("number"!==f||m.cssNumber[h]||(c+="px"),k.clearCloneStyle||""!==c||0!==b.indexOf("background")||(i[b]="inherit"),!(g&&"set"in g&&void 0===(c=g.set(a,c,d)))))try{i[b]=c}catch(j){}}},css:function(a,b,c,d){var e,f,g,h=m.camelCase(b);return b=m.cssProps[h]||(m.cssProps[h]=Ub(a.style,h)),g=m.cssHooks[b]||m.cssHooks[h],g&&"get"in g&&(f=g.get(a,!0,c)),void 0===f&&(f=Jb(a,b,d)),"normal"===f&&b in Sb&&(f=Sb[b]),""===c||c?(e=parseFloat(f),c===!0||m.isNumeric(e)?e||0:f):f}}),m.each(["height","width"],function(a,b){m.cssHooks[b]={get:function(a,c,d){return c?Ob.test(m.css(a,"display"))&&0===a.offsetWidth?m.swap(a,Rb,function(){return Yb(a,b,d)}):Yb(a,b,d):void 0},set:function(a,c,d){var e=d&&Ib(a);return Wb(a,c,d?Xb(a,b,d,k.boxSizing&&"border-box"===m.css(a,"boxSizing",!1,e),e):0)}}}),k.opacity||(m.cssHooks.opacity={get:function(a,b){return Nb.test((b&&a.currentStyle?a.currentStyle.filter:a.style.filter)||"")?.01*parseFloat(RegExp.$1)+"":b?"1":""},set:function(a,b){var c=a.style,d=a.currentStyle,e=m.isNumeric(b)?"alpha(opacity="+100*b+")":"",f=d&&d.filter||c.filter||"";c.zoom=1,(b>=1||""===b)&&""===m.trim(f.replace(Mb,""))&&c.removeAttribute&&(c.removeAttribute("filter"),""===b||d&&!d.filter)||(c.filter=Mb.test(f)?f.replace(Mb,e):f+" "+e)}}),m.cssHooks.marginRight=Lb(k.reliableMarginRight,function(a,b){return b?m.swap(a,{display:"inline-block"},Jb,[a,"marginRight"]):void 0}),m.each({margin:"",padding:"",border:"Width"},function(a,b){m.cssHooks[a+b]={expand:function(c){for(var d=0,e={},f="string"==typeof c?c.split(" "):[c];4>d;d++)e[a+T[d]+b]=f[d]||f[d-2]||f[0];return e}},Gb.test(a)||(m.cssHooks[a+b].set=Wb)}),m.fn.extend({css:function(a,b){return V(this,function(a,b,c){var d,e,f={},g=0;if(m.isArray(b)){for(d=Ib(a),e=b.length;e>g;g++)f[b[g]]=m.css(a,b[g],!1,d);return f}return void 0!==c?m.style(a,b,c):m.css(a,b)},a,b,arguments.length>1)},show:function(){return Vb(this,!0)},hide:function(){return Vb(this)},toggle:function(a){return"boolean"==typeof a?a?this.show():this.hide():this.each(function(){U(this)?m(this).show():m(this).hide()})}});function Zb(a,b,c,d,e){return new Zb.prototype.init(a,b,c,d,e)}m.Tween=Zb,Zb.prototype={constructor:Zb,init:function(a,b,c,d,e,f){this.elem=a,this.prop=c,this.easing=e||"swing",this.options=b,this.start=this.now=this.cur(),this.end=d,this.unit=f||(m.cssNumber[c]?"":"px") +},cur:function(){var a=Zb.propHooks[this.prop];return a&&a.get?a.get(this):Zb.propHooks._default.get(this)},run:function(a){var b,c=Zb.propHooks[this.prop];return this.pos=b=this.options.duration?m.easing[this.easing](a,this.options.duration*a,0,1,this.options.duration):a,this.now=(this.end-this.start)*b+this.start,this.options.step&&this.options.step.call(this.elem,this.now,this),c&&c.set?c.set(this):Zb.propHooks._default.set(this),this}},Zb.prototype.init.prototype=Zb.prototype,Zb.propHooks={_default:{get:function(a){var b;return null==a.elem[a.prop]||a.elem.style&&null!=a.elem.style[a.prop]?(b=m.css(a.elem,a.prop,""),b&&"auto"!==b?b:0):a.elem[a.prop]},set:function(a){m.fx.step[a.prop]?m.fx.step[a.prop](a):a.elem.style&&(null!=a.elem.style[m.cssProps[a.prop]]||m.cssHooks[a.prop])?m.style(a.elem,a.prop,a.now+a.unit):a.elem[a.prop]=a.now}}},Zb.propHooks.scrollTop=Zb.propHooks.scrollLeft={set:function(a){a.elem.nodeType&&a.elem.parentNode&&(a.elem[a.prop]=a.now)}},m.easing={linear:function(a){return a},swing:function(a){return.5-Math.cos(a*Math.PI)/2}},m.fx=Zb.prototype.init,m.fx.step={};var $b,_b,ac=/^(?:toggle|show|hide)$/,bc=new RegExp("^(?:([+-])=|)("+S+")([a-z%]*)$","i"),cc=/queueHooks$/,dc=[ic],ec={"*":[function(a,b){var c=this.createTween(a,b),d=c.cur(),e=bc.exec(b),f=e&&e[3]||(m.cssNumber[a]?"":"px"),g=(m.cssNumber[a]||"px"!==f&&+d)&&bc.exec(m.css(c.elem,a)),h=1,i=20;if(g&&g[3]!==f){f=f||g[3],e=e||[],g=+d||1;do h=h||".5",g/=h,m.style(c.elem,a,g+f);while(h!==(h=c.cur()/d)&&1!==h&&--i)}return e&&(g=c.start=+g||+d||0,c.unit=f,c.end=e[1]?g+(e[1]+1)*e[2]:+e[2]),c}]};function fc(){return setTimeout(function(){$b=void 0}),$b=m.now()}function gc(a,b){var c,d={height:a},e=0;for(b=b?1:0;4>e;e+=2-b)c=T[e],d["margin"+c]=d["padding"+c]=a;return b&&(d.opacity=d.width=a),d}function hc(a,b,c){for(var d,e=(ec[b]||[]).concat(ec["*"]),f=0,g=e.length;g>f;f++)if(d=e[f].call(c,b,a))return d}function ic(a,b,c){var d,e,f,g,h,i,j,l,n=this,o={},p=a.style,q=a.nodeType&&U(a),r=m._data(a,"fxshow");c.queue||(h=m._queueHooks(a,"fx"),null==h.unqueued&&(h.unqueued=0,i=h.empty.fire,h.empty.fire=function(){h.unqueued||i()}),h.unqueued++,n.always(function(){n.always(function(){h.unqueued--,m.queue(a,"fx").length||h.empty.fire()})})),1===a.nodeType&&("height"in b||"width"in b)&&(c.overflow=[p.overflow,p.overflowX,p.overflowY],j=m.css(a,"display"),l="none"===j?m._data(a,"olddisplay")||Fb(a.nodeName):j,"inline"===l&&"none"===m.css(a,"float")&&(k.inlineBlockNeedsLayout&&"inline"!==Fb(a.nodeName)?p.zoom=1:p.display="inline-block")),c.overflow&&(p.overflow="hidden",k.shrinkWrapBlocks()||n.always(function(){p.overflow=c.overflow[0],p.overflowX=c.overflow[1],p.overflowY=c.overflow[2]}));for(d in b)if(e=b[d],ac.exec(e)){if(delete b[d],f=f||"toggle"===e,e===(q?"hide":"show")){if("show"!==e||!r||void 0===r[d])continue;q=!0}o[d]=r&&r[d]||m.style(a,d)}else j=void 0;if(m.isEmptyObject(o))"inline"===("none"===j?Fb(a.nodeName):j)&&(p.display=j);else{r?"hidden"in r&&(q=r.hidden):r=m._data(a,"fxshow",{}),f&&(r.hidden=!q),q?m(a).show():n.done(function(){m(a).hide()}),n.done(function(){var b;m._removeData(a,"fxshow");for(b in o)m.style(a,b,o[b])});for(d in o)g=hc(q?r[d]:0,d,n),d in r||(r[d]=g.start,q&&(g.end=g.start,g.start="width"===d||"height"===d?1:0))}}function jc(a,b){var c,d,e,f,g;for(c in a)if(d=m.camelCase(c),e=b[d],f=a[c],m.isArray(f)&&(e=f[1],f=a[c]=f[0]),c!==d&&(a[d]=f,delete a[c]),g=m.cssHooks[d],g&&"expand"in g){f=g.expand(f),delete a[d];for(c in f)c in a||(a[c]=f[c],b[c]=e)}else b[d]=e}function kc(a,b,c){var d,e,f=0,g=dc.length,h=m.Deferred().always(function(){delete i.elem}),i=function(){if(e)return!1;for(var b=$b||fc(),c=Math.max(0,j.startTime+j.duration-b),d=c/j.duration||0,f=1-d,g=0,i=j.tweens.length;i>g;g++)j.tweens[g].run(f);return h.notifyWith(a,[j,f,c]),1>f&&i?c:(h.resolveWith(a,[j]),!1)},j=h.promise({elem:a,props:m.extend({},b),opts:m.extend(!0,{specialEasing:{}},c),originalProperties:b,originalOptions:c,startTime:$b||fc(),duration:c.duration,tweens:[],createTween:function(b,c){var d=m.Tween(a,j.opts,b,c,j.opts.specialEasing[b]||j.opts.easing);return j.tweens.push(d),d},stop:function(b){var c=0,d=b?j.tweens.length:0;if(e)return this;for(e=!0;d>c;c++)j.tweens[c].run(1);return b?h.resolveWith(a,[j,b]):h.rejectWith(a,[j,b]),this}}),k=j.props;for(jc(k,j.opts.specialEasing);g>f;f++)if(d=dc[f].call(j,a,k,j.opts))return d;return m.map(k,hc,j),m.isFunction(j.opts.start)&&j.opts.start.call(a,j),m.fx.timer(m.extend(i,{elem:a,anim:j,queue:j.opts.queue})),j.progress(j.opts.progress).done(j.opts.done,j.opts.complete).fail(j.opts.fail).always(j.opts.always)}m.Animation=m.extend(kc,{tweener:function(a,b){m.isFunction(a)?(b=a,a=["*"]):a=a.split(" ");for(var c,d=0,e=a.length;e>d;d++)c=a[d],ec[c]=ec[c]||[],ec[c].unshift(b)},prefilter:function(a,b){b?dc.unshift(a):dc.push(a)}}),m.speed=function(a,b,c){var d=a&&"object"==typeof a?m.extend({},a):{complete:c||!c&&b||m.isFunction(a)&&a,duration:a,easing:c&&b||b&&!m.isFunction(b)&&b};return d.duration=m.fx.off?0:"number"==typeof d.duration?d.duration:d.duration in m.fx.speeds?m.fx.speeds[d.duration]:m.fx.speeds._default,(null==d.queue||d.queue===!0)&&(d.queue="fx"),d.old=d.complete,d.complete=function(){m.isFunction(d.old)&&d.old.call(this),d.queue&&m.dequeue(this,d.queue)},d},m.fn.extend({fadeTo:function(a,b,c,d){return this.filter(U).css("opacity",0).show().end().animate({opacity:b},a,c,d)},animate:function(a,b,c,d){var e=m.isEmptyObject(a),f=m.speed(b,c,d),g=function(){var b=kc(this,m.extend({},a),f);(e||m._data(this,"finish"))&&b.stop(!0)};return g.finish=g,e||f.queue===!1?this.each(g):this.queue(f.queue,g)},stop:function(a,b,c){var d=function(a){var b=a.stop;delete a.stop,b(c)};return"string"!=typeof a&&(c=b,b=a,a=void 0),b&&a!==!1&&this.queue(a||"fx",[]),this.each(function(){var b=!0,e=null!=a&&a+"queueHooks",f=m.timers,g=m._data(this);if(e)g[e]&&g[e].stop&&d(g[e]);else for(e in g)g[e]&&g[e].stop&&cc.test(e)&&d(g[e]);for(e=f.length;e--;)f[e].elem!==this||null!=a&&f[e].queue!==a||(f[e].anim.stop(c),b=!1,f.splice(e,1));(b||!c)&&m.dequeue(this,a)})},finish:function(a){return a!==!1&&(a=a||"fx"),this.each(function(){var b,c=m._data(this),d=c[a+"queue"],e=c[a+"queueHooks"],f=m.timers,g=d?d.length:0;for(c.finish=!0,m.queue(this,a,[]),e&&e.stop&&e.stop.call(this,!0),b=f.length;b--;)f[b].elem===this&&f[b].queue===a&&(f[b].anim.stop(!0),f.splice(b,1));for(b=0;g>b;b++)d[b]&&d[b].finish&&d[b].finish.call(this);delete c.finish})}}),m.each(["toggle","show","hide"],function(a,b){var c=m.fn[b];m.fn[b]=function(a,d,e){return null==a||"boolean"==typeof a?c.apply(this,arguments):this.animate(gc(b,!0),a,d,e)}}),m.each({slideDown:gc("show"),slideUp:gc("hide"),slideToggle:gc("toggle"),fadeIn:{opacity:"show"},fadeOut:{opacity:"hide"},fadeToggle:{opacity:"toggle"}},function(a,b){m.fn[a]=function(a,c,d){return this.animate(b,a,c,d)}}),m.timers=[],m.fx.tick=function(){var a,b=m.timers,c=0;for($b=m.now();c<b.length;c++)a=b[c],a()||b[c]!==a||b.splice(c--,1);b.length||m.fx.stop(),$b=void 0},m.fx.timer=function(a){m.timers.push(a),a()?m.fx.start():m.timers.pop()},m.fx.interval=13,m.fx.start=function(){_b||(_b=setInterval(m.fx.tick,m.fx.interval))},m.fx.stop=function(){clearInterval(_b),_b=null},m.fx.speeds={slow:600,fast:200,_default:400},m.fn.delay=function(a,b){return a=m.fx?m.fx.speeds[a]||a:a,b=b||"fx",this.queue(b,function(b,c){var d=setTimeout(b,a);c.stop=function(){clearTimeout(d)}})},function(){var a,b,c,d,e;b=y.createElement("div"),b.setAttribute("className","t"),b.innerHTML=" <link/><table></table><a href='/a'>a</a><input type='checkbox'/>",d=b.getElementsByTagName("a")[0],c=y.createElement("select"),e=c.appendChild(y.createElement("option")),a=b.getElementsByTagName("input")[0],d.style.cssText="top:1px",k.getSetAttribute="t"!==b.className,k.style=/top/.test(d.getAttribute("style")),k.hrefNormalized="/a"===d.getAttribute("href"),k.checkOn=!!a.value,k.optSelected=e.selected,k.enctype=!!y.createElement("form").enctype,c.disabled=!0,k.optDisabled=!e.disabled,a=y.createElement("input"),a.setAttribute("value",""),k.input=""===a.getAttribute("value"),a.value="t",a.setAttribute("type","radio"),k.radioValue="t"===a.value}();var lc=/\r/g;m.fn.extend({val:function(a){var b,c,d,e=this[0];{if(arguments.length)return d=m.isFunction(a),this.each(function(c){var e;1===this.nodeType&&(e=d?a.call(this,c,m(this).val()):a,null==e?e="":"number"==typeof e?e+="":m.isArray(e)&&(e=m.map(e,function(a){return null==a?"":a+""})),b=m.valHooks[this.type]||m.valHooks[this.nodeName.toLowerCase()],b&&"set"in b&&void 0!==b.set(this,e,"value")||(this.value=e))});if(e)return b=m.valHooks[e.type]||m.valHooks[e.nodeName.toLowerCase()],b&&"get"in b&&void 0!==(c=b.get(e,"value"))?c:(c=e.value,"string"==typeof c?c.replace(lc,""):null==c?"":c)}}}),m.extend({valHooks:{option:{get:function(a){var b=m.find.attr(a,"value");return null!=b?b:m.trim(m.text(a))}},select:{get:function(a){for(var b,c,d=a.options,e=a.selectedIndex,f="select-one"===a.type||0>e,g=f?null:[],h=f?e+1:d.length,i=0>e?h:f?e:0;h>i;i++)if(c=d[i],!(!c.selected&&i!==e||(k.optDisabled?c.disabled:null!==c.getAttribute("disabled"))||c.parentNode.disabled&&m.nodeName(c.parentNode,"optgroup"))){if(b=m(c).val(),f)return b;g.push(b)}return g},set:function(a,b){var c,d,e=a.options,f=m.makeArray(b),g=e.length;while(g--)if(d=e[g],m.inArray(m.valHooks.option.get(d),f)>=0)try{d.selected=c=!0}catch(h){d.scrollHeight}else d.selected=!1;return c||(a.selectedIndex=-1),e}}}}),m.each(["radio","checkbox"],function(){m.valHooks[this]={set:function(a,b){return m.isArray(b)?a.checked=m.inArray(m(a).val(),b)>=0:void 0}},k.checkOn||(m.valHooks[this].get=function(a){return null===a.getAttribute("value")?"on":a.value})});var mc,nc,oc=m.expr.attrHandle,pc=/^(?:checked|selected)$/i,qc=k.getSetAttribute,rc=k.input;m.fn.extend({attr:function(a,b){return V(this,m.attr,a,b,arguments.length>1)},removeAttr:function(a){return this.each(function(){m.removeAttr(this,a)})}}),m.extend({attr:function(a,b,c){var d,e,f=a.nodeType;if(a&&3!==f&&8!==f&&2!==f)return typeof a.getAttribute===K?m.prop(a,b,c):(1===f&&m.isXMLDoc(a)||(b=b.toLowerCase(),d=m.attrHooks[b]||(m.expr.match.bool.test(b)?nc:mc)),void 0===c?d&&"get"in d&&null!==(e=d.get(a,b))?e:(e=m.find.attr(a,b),null==e?void 0:e):null!==c?d&&"set"in d&&void 0!==(e=d.set(a,c,b))?e:(a.setAttribute(b,c+""),c):void m.removeAttr(a,b))},removeAttr:function(a,b){var c,d,e=0,f=b&&b.match(E);if(f&&1===a.nodeType)while(c=f[e++])d=m.propFix[c]||c,m.expr.match.bool.test(c)?rc&&qc||!pc.test(c)?a[d]=!1:a[m.camelCase("default-"+c)]=a[d]=!1:m.attr(a,c,""),a.removeAttribute(qc?c:d)},attrHooks:{type:{set:function(a,b){if(!k.radioValue&&"radio"===b&&m.nodeName(a,"input")){var c=a.value;return a.setAttribute("type",b),c&&(a.value=c),b}}}}}),nc={set:function(a,b,c){return b===!1?m.removeAttr(a,c):rc&&qc||!pc.test(c)?a.setAttribute(!qc&&m.propFix[c]||c,c):a[m.camelCase("default-"+c)]=a[c]=!0,c}},m.each(m.expr.match.bool.source.match(/\w+/g),function(a,b){var c=oc[b]||m.find.attr;oc[b]=rc&&qc||!pc.test(b)?function(a,b,d){var e,f;return d||(f=oc[b],oc[b]=e,e=null!=c(a,b,d)?b.toLowerCase():null,oc[b]=f),e}:function(a,b,c){return c?void 0:a[m.camelCase("default-"+b)]?b.toLowerCase():null}}),rc&&qc||(m.attrHooks.value={set:function(a,b,c){return m.nodeName(a,"input")?void(a.defaultValue=b):mc&&mc.set(a,b,c)}}),qc||(mc={set:function(a,b,c){var d=a.getAttributeNode(c);return d||a.setAttributeNode(d=a.ownerDocument.createAttribute(c)),d.value=b+="","value"===c||b===a.getAttribute(c)?b:void 0}},oc.id=oc.name=oc.coords=function(a,b,c){var d;return c?void 0:(d=a.getAttributeNode(b))&&""!==d.value?d.value:null},m.valHooks.button={get:function(a,b){var c=a.getAttributeNode(b);return c&&c.specified?c.value:void 0},set:mc.set},m.attrHooks.contenteditable={set:function(a,b,c){mc.set(a,""===b?!1:b,c)}},m.each(["width","height"],function(a,b){m.attrHooks[b]={set:function(a,c){return""===c?(a.setAttribute(b,"auto"),c):void 0}}})),k.style||(m.attrHooks.style={get:function(a){return a.style.cssText||void 0},set:function(a,b){return a.style.cssText=b+""}});var sc=/^(?:input|select|textarea|button|object)$/i,tc=/^(?:a|area)$/i;m.fn.extend({prop:function(a,b){return V(this,m.prop,a,b,arguments.length>1)},removeProp:function(a){return a=m.propFix[a]||a,this.each(function(){try{this[a]=void 0,delete this[a]}catch(b){}})}}),m.extend({propFix:{"for":"htmlFor","class":"className"},prop:function(a,b,c){var d,e,f,g=a.nodeType;if(a&&3!==g&&8!==g&&2!==g)return f=1!==g||!m.isXMLDoc(a),f&&(b=m.propFix[b]||b,e=m.propHooks[b]),void 0!==c?e&&"set"in e&&void 0!==(d=e.set(a,c,b))?d:a[b]=c:e&&"get"in e&&null!==(d=e.get(a,b))?d:a[b]},propHooks:{tabIndex:{get:function(a){var b=m.find.attr(a,"tabindex");return b?parseInt(b,10):sc.test(a.nodeName)||tc.test(a.nodeName)&&a.href?0:-1}}}}),k.hrefNormalized||m.each(["href","src"],function(a,b){m.propHooks[b]={get:function(a){return a.getAttribute(b,4)}}}),k.optSelected||(m.propHooks.selected={get:function(a){var b=a.parentNode;return b&&(b.selectedIndex,b.parentNode&&b.parentNode.selectedIndex),null}}),m.each(["tabIndex","readOnly","maxLength","cellSpacing","cellPadding","rowSpan","colSpan","useMap","frameBorder","contentEditable"],function(){m.propFix[this.toLowerCase()]=this}),k.enctype||(m.propFix.enctype="encoding");var uc=/[\t\r\n\f]/g;m.fn.extend({addClass:function(a){var b,c,d,e,f,g,h=0,i=this.length,j="string"==typeof a&&a;if(m.isFunction(a))return this.each(function(b){m(this).addClass(a.call(this,b,this.className))});if(j)for(b=(a||"").match(E)||[];i>h;h++)if(c=this[h],d=1===c.nodeType&&(c.className?(" "+c.className+" ").replace(uc," "):" ")){f=0;while(e=b[f++])d.indexOf(" "+e+" ")<0&&(d+=e+" ");g=m.trim(d),c.className!==g&&(c.className=g)}return this},removeClass:function(a){var b,c,d,e,f,g,h=0,i=this.length,j=0===arguments.length||"string"==typeof a&&a;if(m.isFunction(a))return this.each(function(b){m(this).removeClass(a.call(this,b,this.className))});if(j)for(b=(a||"").match(E)||[];i>h;h++)if(c=this[h],d=1===c.nodeType&&(c.className?(" "+c.className+" ").replace(uc," "):"")){f=0;while(e=b[f++])while(d.indexOf(" "+e+" ")>=0)d=d.replace(" "+e+" "," ");g=a?m.trim(d):"",c.className!==g&&(c.className=g)}return this},toggleClass:function(a,b){var c=typeof a;return"boolean"==typeof b&&"string"===c?b?this.addClass(a):this.removeClass(a):this.each(m.isFunction(a)?function(c){m(this).toggleClass(a.call(this,c,this.className,b),b)}:function(){if("string"===c){var b,d=0,e=m(this),f=a.match(E)||[];while(b=f[d++])e.hasClass(b)?e.removeClass(b):e.addClass(b)}else(c===K||"boolean"===c)&&(this.className&&m._data(this,"__className__",this.className),this.className=this.className||a===!1?"":m._data(this,"__className__")||"")})},hasClass:function(a){for(var b=" "+a+" ",c=0,d=this.length;d>c;c++)if(1===this[c].nodeType&&(" "+this[c].className+" ").replace(uc," ").indexOf(b)>=0)return!0;return!1}}),m.each("blur focus focusin focusout load resize scroll unload click dblclick mousedown mouseup mousemove mouseover mouseout mouseenter mouseleave change select submit keydown keypress keyup error contextmenu".split(" "),function(a,b){m.fn[b]=function(a,c){return arguments.length>0?this.on(b,null,a,c):this.trigger(b)}}),m.fn.extend({hover:function(a,b){return this.mouseenter(a).mouseleave(b||a)},bind:function(a,b,c){return this.on(a,null,b,c)},unbind:function(a,b){return this.off(a,null,b)},delegate:function(a,b,c,d){return this.on(b,a,c,d)},undelegate:function(a,b,c){return 1===arguments.length?this.off(a,"**"):this.off(b,a||"**",c)}});var vc=m.now(),wc=/\?/,xc=/(,)|(\[|{)|(}|])|"(?:[^"\\\r\n]|\\["\\\/bfnrt]|\\u[\da-fA-F]{4})*"\s*:?|true|false|null|-?(?!0\d)\d+(?:\.\d+|)(?:[eE][+-]?\d+|)/g;m.parseJSON=function(b){if(a.JSON&&a.JSON.parse)return a.JSON.parse(b+"");var c,d=null,e=m.trim(b+"");return e&&!m.trim(e.replace(xc,function(a,b,e,f){return c&&b&&(d=0),0===d?a:(c=e||b,d+=!f-!e,"")}))?Function("return "+e)():m.error("Invalid JSON: "+b)},m.parseXML=function(b){var c,d;if(!b||"string"!=typeof b)return null;try{a.DOMParser?(d=new DOMParser,c=d.parseFromString(b,"text/xml")):(c=new ActiveXObject("Microsoft.XMLDOM"),c.async="false",c.loadXML(b))}catch(e){c=void 0}return c&&c.documentElement&&!c.getElementsByTagName("parsererror").length||m.error("Invalid XML: "+b),c};var yc,zc,Ac=/#.*$/,Bc=/([?&])_=[^&]*/,Cc=/^(.*?):[ \t]*([^\r\n]*)\r?$/gm,Dc=/^(?:about|app|app-storage|.+-extension|file|res|widget):$/,Ec=/^(?:GET|HEAD)$/,Fc=/^\/\//,Gc=/^([\w.+-]+:)(?:\/\/(?:[^\/?#]*@|)([^\/?#:]*)(?::(\d+)|)|)/,Hc={},Ic={},Jc="*/".concat("*");try{zc=location.href}catch(Kc){zc=y.createElement("a"),zc.href="",zc=zc.href}yc=Gc.exec(zc.toLowerCase())||[];function Lc(a){return function(b,c){"string"!=typeof b&&(c=b,b="*");var d,e=0,f=b.toLowerCase().match(E)||[];if(m.isFunction(c))while(d=f[e++])"+"===d.charAt(0)?(d=d.slice(1)||"*",(a[d]=a[d]||[]).unshift(c)):(a[d]=a[d]||[]).push(c)}}function Mc(a,b,c,d){var e={},f=a===Ic;function g(h){var i;return e[h]=!0,m.each(a[h]||[],function(a,h){var j=h(b,c,d);return"string"!=typeof j||f||e[j]?f?!(i=j):void 0:(b.dataTypes.unshift(j),g(j),!1)}),i}return g(b.dataTypes[0])||!e["*"]&&g("*")}function Nc(a,b){var c,d,e=m.ajaxSettings.flatOptions||{};for(d in b)void 0!==b[d]&&((e[d]?a:c||(c={}))[d]=b[d]);return c&&m.extend(!0,a,c),a}function Oc(a,b,c){var d,e,f,g,h=a.contents,i=a.dataTypes;while("*"===i[0])i.shift(),void 0===e&&(e=a.mimeType||b.getResponseHeader("Content-Type"));if(e)for(g in h)if(h[g]&&h[g].test(e)){i.unshift(g);break}if(i[0]in c)f=i[0];else{for(g in c){if(!i[0]||a.converters[g+" "+i[0]]){f=g;break}d||(d=g)}f=f||d}return f?(f!==i[0]&&i.unshift(f),c[f]):void 0}function Pc(a,b,c,d){var e,f,g,h,i,j={},k=a.dataTypes.slice();if(k[1])for(g in a.converters)j[g.toLowerCase()]=a.converters[g];f=k.shift();while(f)if(a.responseFields[f]&&(c[a.responseFields[f]]=b),!i&&d&&a.dataFilter&&(b=a.dataFilter(b,a.dataType)),i=f,f=k.shift())if("*"===f)f=i;else if("*"!==i&&i!==f){if(g=j[i+" "+f]||j["* "+f],!g)for(e in j)if(h=e.split(" "),h[1]===f&&(g=j[i+" "+h[0]]||j["* "+h[0]])){g===!0?g=j[e]:j[e]!==!0&&(f=h[0],k.unshift(h[1]));break}if(g!==!0)if(g&&a["throws"])b=g(b);else try{b=g(b)}catch(l){return{state:"parsererror",error:g?l:"No conversion from "+i+" to "+f}}}return{state:"success",data:b}}m.extend({active:0,lastModified:{},etag:{},ajaxSettings:{url:zc,type:"GET",isLocal:Dc.test(yc[1]),global:!0,processData:!0,async:!0,contentType:"application/x-www-form-urlencoded; charset=UTF-8",accepts:{"*":Jc,text:"text/plain",html:"text/html",xml:"application/xml, text/xml",json:"application/json, text/javascript"},contents:{xml:/xml/,html:/html/,json:/json/},responseFields:{xml:"responseXML",text:"responseText",json:"responseJSON"},converters:{"* text":String,"text html":!0,"text json":m.parseJSON,"text xml":m.parseXML},flatOptions:{url:!0,context:!0}},ajaxSetup:function(a,b){return b?Nc(Nc(a,m.ajaxSettings),b):Nc(m.ajaxSettings,a)},ajaxPrefilter:Lc(Hc),ajaxTransport:Lc(Ic),ajax:function(a,b){"object"==typeof a&&(b=a,a=void 0),b=b||{};var c,d,e,f,g,h,i,j,k=m.ajaxSetup({},b),l=k.context||k,n=k.context&&(l.nodeType||l.jquery)?m(l):m.event,o=m.Deferred(),p=m.Callbacks("once memory"),q=k.statusCode||{},r={},s={},t=0,u="canceled",v={readyState:0,getResponseHeader:function(a){var b;if(2===t){if(!j){j={};while(b=Cc.exec(f))j[b[1].toLowerCase()]=b[2]}b=j[a.toLowerCase()]}return null==b?null:b},getAllResponseHeaders:function(){return 2===t?f:null},setRequestHeader:function(a,b){var c=a.toLowerCase();return t||(a=s[c]=s[c]||a,r[a]=b),this},overrideMimeType:function(a){return t||(k.mimeType=a),this},statusCode:function(a){var b;if(a)if(2>t)for(b in a)q[b]=[q[b],a[b]];else v.always(a[v.status]);return this},abort:function(a){var b=a||u;return i&&i.abort(b),x(0,b),this}};if(o.promise(v).complete=p.add,v.success=v.done,v.error=v.fail,k.url=((a||k.url||zc)+"").replace(Ac,"").replace(Fc,yc[1]+"//"),k.type=b.method||b.type||k.method||k.type,k.dataTypes=m.trim(k.dataType||"*").toLowerCase().match(E)||[""],null==k.crossDomain&&(c=Gc.exec(k.url.toLowerCase()),k.crossDomain=!(!c||c[1]===yc[1]&&c[2]===yc[2]&&(c[3]||("http:"===c[1]?"80":"443"))===(yc[3]||("http:"===yc[1]?"80":"443")))),k.data&&k.processData&&"string"!=typeof k.data&&(k.data=m.param(k.data,k.traditional)),Mc(Hc,k,b,v),2===t)return v;h=k.global,h&&0===m.active++&&m.event.trigger("ajaxStart"),k.type=k.type.toUpperCase(),k.hasContent=!Ec.test(k.type),e=k.url,k.hasContent||(k.data&&(e=k.url+=(wc.test(e)?"&":"?")+k.data,delete k.data),k.cache===!1&&(k.url=Bc.test(e)?e.replace(Bc,"$1_="+vc++):e+(wc.test(e)?"&":"?")+"_="+vc++)),k.ifModified&&(m.lastModified[e]&&v.setRequestHeader("If-Modified-Since",m.lastModified[e]),m.etag[e]&&v.setRequestHeader("If-None-Match",m.etag[e])),(k.data&&k.hasContent&&k.contentType!==!1||b.contentType)&&v.setRequestHeader("Content-Type",k.contentType),v.setRequestHeader("Accept",k.dataTypes[0]&&k.accepts[k.dataTypes[0]]?k.accepts[k.dataTypes[0]]+("*"!==k.dataTypes[0]?", "+Jc+"; q=0.01":""):k.accepts["*"]);for(d in k.headers)v.setRequestHeader(d,k.headers[d]);if(k.beforeSend&&(k.beforeSend.call(l,v,k)===!1||2===t))return v.abort();u="abort";for(d in{success:1,error:1,complete:1})v[d](k[d]);if(i=Mc(Ic,k,b,v)){v.readyState=1,h&&n.trigger("ajaxSend",[v,k]),k.async&&k.timeout>0&&(g=setTimeout(function(){v.abort("timeout")},k.timeout));try{t=1,i.send(r,x)}catch(w){if(!(2>t))throw w;x(-1,w)}}else x(-1,"No Transport");function x(a,b,c,d){var j,r,s,u,w,x=b;2!==t&&(t=2,g&&clearTimeout(g),i=void 0,f=d||"",v.readyState=a>0?4:0,j=a>=200&&300>a||304===a,c&&(u=Oc(k,v,c)),u=Pc(k,u,v,j),j?(k.ifModified&&(w=v.getResponseHeader("Last-Modified"),w&&(m.lastModified[e]=w),w=v.getResponseHeader("etag"),w&&(m.etag[e]=w)),204===a||"HEAD"===k.type?x="nocontent":304===a?x="notmodified":(x=u.state,r=u.data,s=u.error,j=!s)):(s=x,(a||!x)&&(x="error",0>a&&(a=0))),v.status=a,v.statusText=(b||x)+"",j?o.resolveWith(l,[r,x,v]):o.rejectWith(l,[v,x,s]),v.statusCode(q),q=void 0,h&&n.trigger(j?"ajaxSuccess":"ajaxError",[v,k,j?r:s]),p.fireWith(l,[v,x]),h&&(n.trigger("ajaxComplete",[v,k]),--m.active||m.event.trigger("ajaxStop")))}return v},getJSON:function(a,b,c){return m.get(a,b,c,"json")},getScript:function(a,b){return m.get(a,void 0,b,"script")}}),m.each(["get","post"],function(a,b){m[b]=function(a,c,d,e){return m.isFunction(c)&&(e=e||d,d=c,c=void 0),m.ajax({url:a,type:b,dataType:e,data:c,success:d})}}),m.each(["ajaxStart","ajaxStop","ajaxComplete","ajaxError","ajaxSuccess","ajaxSend"],function(a,b){m.fn[b]=function(a){return this.on(b,a)}}),m._evalUrl=function(a){return m.ajax({url:a,type:"GET",dataType:"script",async:!1,global:!1,"throws":!0})},m.fn.extend({wrapAll:function(a){if(m.isFunction(a))return this.each(function(b){m(this).wrapAll(a.call(this,b))});if(this[0]){var b=m(a,this[0].ownerDocument).eq(0).clone(!0);this[0].parentNode&&b.insertBefore(this[0]),b.map(function(){var a=this;while(a.firstChild&&1===a.firstChild.nodeType)a=a.firstChild;return a}).append(this)}return this},wrapInner:function(a){return this.each(m.isFunction(a)?function(b){m(this).wrapInner(a.call(this,b))}:function(){var b=m(this),c=b.contents();c.length?c.wrapAll(a):b.append(a)})},wrap:function(a){var b=m.isFunction(a);return this.each(function(c){m(this).wrapAll(b?a.call(this,c):a)})},unwrap:function(){return this.parent().each(function(){m.nodeName(this,"body")||m(this).replaceWith(this.childNodes)}).end()}}),m.expr.filters.hidden=function(a){return a.offsetWidth<=0&&a.offsetHeight<=0||!k.reliableHiddenOffsets()&&"none"===(a.style&&a.style.display||m.css(a,"display"))},m.expr.filters.visible=function(a){return!m.expr.filters.hidden(a)};var Qc=/%20/g,Rc=/\[\]$/,Sc=/\r?\n/g,Tc=/^(?:submit|button|image|reset|file)$/i,Uc=/^(?:input|select|textarea|keygen)/i;function Vc(a,b,c,d){var e;if(m.isArray(b))m.each(b,function(b,e){c||Rc.test(a)?d(a,e):Vc(a+"["+("object"==typeof e?b:"")+"]",e,c,d)});else if(c||"object"!==m.type(b))d(a,b);else for(e in b)Vc(a+"["+e+"]",b[e],c,d)}m.param=function(a,b){var c,d=[],e=function(a,b){b=m.isFunction(b)?b():null==b?"":b,d[d.length]=encodeURIComponent(a)+"="+encodeURIComponent(b)};if(void 0===b&&(b=m.ajaxSettings&&m.ajaxSettings.traditional),m.isArray(a)||a.jquery&&!m.isPlainObject(a))m.each(a,function(){e(this.name,this.value)});else for(c in a)Vc(c,a[c],b,e);return d.join("&").replace(Qc,"+")},m.fn.extend({serialize:function(){return m.param(this.serializeArray())},serializeArray:function(){return this.map(function(){var a=m.prop(this,"elements");return a?m.makeArray(a):this}).filter(function(){var a=this.type;return this.name&&!m(this).is(":disabled")&&Uc.test(this.nodeName)&&!Tc.test(a)&&(this.checked||!W.test(a))}).map(function(a,b){var c=m(this).val();return null==c?null:m.isArray(c)?m.map(c,function(a){return{name:b.name,value:a.replace(Sc,"\r\n")}}):{name:b.name,value:c.replace(Sc,"\r\n")}}).get()}}),m.ajaxSettings.xhr=void 0!==a.ActiveXObject?function(){return!this.isLocal&&/^(get|post|head|put|delete|options)$/i.test(this.type)&&Zc()||$c()}:Zc;var Wc=0,Xc={},Yc=m.ajaxSettings.xhr();a.ActiveXObject&&m(a).on("unload",function(){for(var a in Xc)Xc[a](void 0,!0)}),k.cors=!!Yc&&"withCredentials"in Yc,Yc=k.ajax=!!Yc,Yc&&m.ajaxTransport(function(a){if(!a.crossDomain||k.cors){var b;return{send:function(c,d){var e,f=a.xhr(),g=++Wc;if(f.open(a.type,a.url,a.async,a.username,a.password),a.xhrFields)for(e in a.xhrFields)f[e]=a.xhrFields[e];a.mimeType&&f.overrideMimeType&&f.overrideMimeType(a.mimeType),a.crossDomain||c["X-Requested-With"]||(c["X-Requested-With"]="XMLHttpRequest");for(e in c)void 0!==c[e]&&f.setRequestHeader(e,c[e]+"");f.send(a.hasContent&&a.data||null),b=function(c,e){var h,i,j;if(b&&(e||4===f.readyState))if(delete Xc[g],b=void 0,f.onreadystatechange=m.noop,e)4!==f.readyState&&f.abort();else{j={},h=f.status,"string"==typeof f.responseText&&(j.text=f.responseText);try{i=f.statusText}catch(k){i=""}h||!a.isLocal||a.crossDomain?1223===h&&(h=204):h=j.text?200:404}j&&d(h,i,j,f.getAllResponseHeaders())},a.async?4===f.readyState?setTimeout(b):f.onreadystatechange=Xc[g]=b:b()},abort:function(){b&&b(void 0,!0)}}}});function Zc(){try{return new a.XMLHttpRequest}catch(b){}}function $c(){try{return new a.ActiveXObject("Microsoft.XMLHTTP")}catch(b){}}m.ajaxSetup({accepts:{script:"text/javascript, application/javascript, application/ecmascript, application/x-ecmascript"},contents:{script:/(?:java|ecma)script/},converters:{"text script":function(a){return m.globalEval(a),a}}}),m.ajaxPrefilter("script",function(a){void 0===a.cache&&(a.cache=!1),a.crossDomain&&(a.type="GET",a.global=!1)}),m.ajaxTransport("script",function(a){if(a.crossDomain){var b,c=y.head||m("head")[0]||y.documentElement;return{send:function(d,e){b=y.createElement("script"),b.async=!0,a.scriptCharset&&(b.charset=a.scriptCharset),b.src=a.url,b.onload=b.onreadystatechange=function(a,c){(c||!b.readyState||/loaded|complete/.test(b.readyState))&&(b.onload=b.onreadystatechange=null,b.parentNode&&b.parentNode.removeChild(b),b=null,c||e(200,"success"))},c.insertBefore(b,c.firstChild)},abort:function(){b&&b.onload(void 0,!0)}}}});var _c=[],ad=/(=)\?(?=&|$)|\?\?/;m.ajaxSetup({jsonp:"callback",jsonpCallback:function(){var a=_c.pop()||m.expando+"_"+vc++;return this[a]=!0,a}}),m.ajaxPrefilter("json jsonp",function(b,c,d){var e,f,g,h=b.jsonp!==!1&&(ad.test(b.url)?"url":"string"==typeof b.data&&!(b.contentType||"").indexOf("application/x-www-form-urlencoded")&&ad.test(b.data)&&"data");return h||"jsonp"===b.dataTypes[0]?(e=b.jsonpCallback=m.isFunction(b.jsonpCallback)?b.jsonpCallback():b.jsonpCallback,h?b[h]=b[h].replace(ad,"$1"+e):b.jsonp!==!1&&(b.url+=(wc.test(b.url)?"&":"?")+b.jsonp+"="+e),b.converters["script json"]=function(){return g||m.error(e+" was not called"),g[0]},b.dataTypes[0]="json",f=a[e],a[e]=function(){g=arguments},d.always(function(){a[e]=f,b[e]&&(b.jsonpCallback=c.jsonpCallback,_c.push(e)),g&&m.isFunction(f)&&f(g[0]),g=f=void 0}),"script"):void 0}),m.parseHTML=function(a,b,c){if(!a||"string"!=typeof a)return null;"boolean"==typeof b&&(c=b,b=!1),b=b||y;var d=u.exec(a),e=!c&&[];return d?[b.createElement(d[1])]:(d=m.buildFragment([a],b,e),e&&e.length&&m(e).remove(),m.merge([],d.childNodes))};var bd=m.fn.load;m.fn.load=function(a,b,c){if("string"!=typeof a&&bd)return bd.apply(this,arguments);var d,e,f,g=this,h=a.indexOf(" ");return h>=0&&(d=m.trim(a.slice(h,a.length)),a=a.slice(0,h)),m.isFunction(b)?(c=b,b=void 0):b&&"object"==typeof b&&(f="POST"),g.length>0&&m.ajax({url:a,type:f,dataType:"html",data:b}).done(function(a){e=arguments,g.html(d?m("<div>").append(m.parseHTML(a)).find(d):a)}).complete(c&&function(a,b){g.each(c,e||[a.responseText,b,a])}),this},m.expr.filters.animated=function(a){return m.grep(m.timers,function(b){return a===b.elem}).length};var cd=a.document.documentElement;function dd(a){return m.isWindow(a)?a:9===a.nodeType?a.defaultView||a.parentWindow:!1}m.offset={setOffset:function(a,b,c){var d,e,f,g,h,i,j,k=m.css(a,"position"),l=m(a),n={};"static"===k&&(a.style.position="relative"),h=l.offset(),f=m.css(a,"top"),i=m.css(a,"left"),j=("absolute"===k||"fixed"===k)&&m.inArray("auto",[f,i])>-1,j?(d=l.position(),g=d.top,e=d.left):(g=parseFloat(f)||0,e=parseFloat(i)||0),m.isFunction(b)&&(b=b.call(a,c,h)),null!=b.top&&(n.top=b.top-h.top+g),null!=b.left&&(n.left=b.left-h.left+e),"using"in b?b.using.call(a,n):l.css(n)}},m.fn.extend({offset:function(a){if(arguments.length)return void 0===a?this:this.each(function(b){m.offset.setOffset(this,a,b)});var b,c,d={top:0,left:0},e=this[0],f=e&&e.ownerDocument;if(f)return b=f.documentElement,m.contains(b,e)?(typeof e.getBoundingClientRect!==K&&(d=e.getBoundingClientRect()),c=dd(f),{top:d.top+(c.pageYOffset||b.scrollTop)-(b.clientTop||0),left:d.left+(c.pageXOffset||b.scrollLeft)-(b.clientLeft||0)}):d},position:function(){if(this[0]){var a,b,c={top:0,left:0},d=this[0];return"fixed"===m.css(d,"position")?b=d.getBoundingClientRect():(a=this.offsetParent(),b=this.offset(),m.nodeName(a[0],"html")||(c=a.offset()),c.top+=m.css(a[0],"borderTopWidth",!0),c.left+=m.css(a[0],"borderLeftWidth",!0)),{top:b.top-c.top-m.css(d,"marginTop",!0),left:b.left-c.left-m.css(d,"marginLeft",!0)}}},offsetParent:function(){return this.map(function(){var a=this.offsetParent||cd;while(a&&!m.nodeName(a,"html")&&"static"===m.css(a,"position"))a=a.offsetParent;return a||cd})}}),m.each({scrollLeft:"pageXOffset",scrollTop:"pageYOffset"},function(a,b){var c=/Y/.test(b);m.fn[a]=function(d){return V(this,function(a,d,e){var f=dd(a);return void 0===e?f?b in f?f[b]:f.document.documentElement[d]:a[d]:void(f?f.scrollTo(c?m(f).scrollLeft():e,c?e:m(f).scrollTop()):a[d]=e)},a,d,arguments.length,null)}}),m.each(["top","left"],function(a,b){m.cssHooks[b]=Lb(k.pixelPosition,function(a,c){return c?(c=Jb(a,b),Hb.test(c)?m(a).position()[b]+"px":c):void 0})}),m.each({Height:"height",Width:"width"},function(a,b){m.each({padding:"inner"+a,content:b,"":"outer"+a},function(c,d){m.fn[d]=function(d,e){var f=arguments.length&&(c||"boolean"!=typeof d),g=c||(d===!0||e===!0?"margin":"border");return V(this,function(b,c,d){var e;return m.isWindow(b)?b.document.documentElement["client"+a]:9===b.nodeType?(e=b.documentElement,Math.max(b.body["scroll"+a],e["scroll"+a],b.body["offset"+a],e["offset"+a],e["client"+a])):void 0===d?m.css(b,c,g):m.style(b,c,d,g)},b,f?d:void 0,f,null)}})}),m.fn.size=function(){return this.length},m.fn.andSelf=m.fn.addBack,"function"==typeof define&&define.amd&&define("jquery",[],function(){return m});var ed=a.jQuery,fd=a.$;return m.noConflict=function(b){return a.$===m&&(a.$=fd),b&&a.jQuery===m&&(a.jQuery=ed),m},typeof b===K&&(a.jQuery=a.$=m),m}); diff --git a/doc/html/_static/searchtools.js b/doc/html/_static/searchtools.js index cb744672..066857ce 100644 --- a/doc/html/_static/searchtools.js +++ b/doc/html/_static/searchtools.js @@ -2,7 +2,7 @@ * searchtools.js_t * ~~~~~~~~~~~~~~~~ * - * Sphinx JavaScript utilties for the full-text search. + * Sphinx JavaScript utilities for the full-text search. * * :copyright: Copyright 2007-2016 by the Sphinx team, see AUTHORS. * :license: BSD, see LICENSE for details. @@ -623,7 +623,7 @@ var Search = { * helper function to return a node containing the * search summary for a given text. keywords is a list * of stemmed words, hlwords is the list of normal, unstemmed - * words. the first one is used to find the occurance, the + * words. the first one is used to find the occurrence, the * latter for highlighting it. */ makeSearchSummary : function(text, keywords, hlwords) { diff --git a/doc/html/_static/underscore-1.3.1.js b/doc/html/_static/underscore-1.3.1.js new file mode 100644 index 00000000..208d4cd8 --- /dev/null +++ b/doc/html/_static/underscore-1.3.1.js @@ -0,0 +1,999 @@ +// Underscore.js 1.3.1 +// (c) 2009-2012 Jeremy Ashkenas, DocumentCloud Inc. +// Underscore is freely distributable under the MIT license. +// Portions of Underscore are inspired or borrowed from Prototype, +// Oliver Steele's Functional, and John Resig's Micro-Templating. +// For all details and documentation: +// http://documentcloud.github.com/underscore + +(function() { + + // Baseline setup + // -------------- + + // Establish the root object, `window` in the browser, or `global` on the server. + var root = this; + + // Save the previous value of the `_` variable. + var previousUnderscore = root._; + + // Establish the object that gets returned to break out of a loop iteration. + var breaker = {}; + + // Save bytes in the minified (but not gzipped) version: + var ArrayProto = Array.prototype, ObjProto = Object.prototype, FuncProto = Function.prototype; + + // Create quick reference variables for speed access to core prototypes. + var slice = ArrayProto.slice, + unshift = ArrayProto.unshift, + toString = ObjProto.toString, + hasOwnProperty = ObjProto.hasOwnProperty; + + // All **ECMAScript 5** native function implementations that we hope to use + // are declared here. + var + nativeForEach = ArrayProto.forEach, + nativeMap = ArrayProto.map, + nativeReduce = ArrayProto.reduce, + nativeReduceRight = ArrayProto.reduceRight, + nativeFilter = ArrayProto.filter, + nativeEvery = ArrayProto.every, + nativeSome = ArrayProto.some, + nativeIndexOf = ArrayProto.indexOf, + nativeLastIndexOf = ArrayProto.lastIndexOf, + nativeIsArray = Array.isArray, + nativeKeys = Object.keys, + nativeBind = FuncProto.bind; + + // Create a safe reference to the Underscore object for use below. + var _ = function(obj) { return new wrapper(obj); }; + + // Export the Underscore object for **Node.js**, with + // backwards-compatibility for the old `require()` API. If we're in + // the browser, add `_` as a global object via a string identifier, + // for Closure Compiler "advanced" mode. + if (typeof exports !== 'undefined') { + if (typeof module !== 'undefined' && module.exports) { + exports = module.exports = _; + } + exports._ = _; + } else { + root['_'] = _; + } + + // Current version. + _.VERSION = '1.3.1'; + + // Collection Functions + // -------------------- + + // The cornerstone, an `each` implementation, aka `forEach`. + // Handles objects with the built-in `forEach`, arrays, and raw objects. + // Delegates to **ECMAScript 5**'s native `forEach` if available. + var each = _.each = _.forEach = function(obj, iterator, context) { + if (obj == null) return; + if (nativeForEach && obj.forEach === nativeForEach) { + obj.forEach(iterator, context); + } else if (obj.length === +obj.length) { + for (var i = 0, l = obj.length; i < l; i++) { + if (i in obj && iterator.call(context, obj[i], i, obj) === breaker) return; + } + } else { + for (var key in obj) { + if (_.has(obj, key)) { + if (iterator.call(context, obj[key], key, obj) === breaker) return; + } + } + } + }; + + // Return the results of applying the iterator to each element. + // Delegates to **ECMAScript 5**'s native `map` if available. + _.map = _.collect = function(obj, iterator, context) { + var results = []; + if (obj == null) return results; + if (nativeMap && obj.map === nativeMap) return obj.map(iterator, context); + each(obj, function(value, index, list) { + results[results.length] = iterator.call(context, value, index, list); + }); + if (obj.length === +obj.length) results.length = obj.length; + return results; + }; + + // **Reduce** builds up a single result from a list of values, aka `inject`, + // or `foldl`. Delegates to **ECMAScript 5**'s native `reduce` if available. + _.reduce = _.foldl = _.inject = function(obj, iterator, memo, context) { + var initial = arguments.length > 2; + if (obj == null) obj = []; + if (nativeReduce && obj.reduce === nativeReduce) { + if (context) iterator = _.bind(iterator, context); + return initial ? obj.reduce(iterator, memo) : obj.reduce(iterator); + } + each(obj, function(value, index, list) { + if (!initial) { + memo = value; + initial = true; + } else { + memo = iterator.call(context, memo, value, index, list); + } + }); + if (!initial) throw new TypeError('Reduce of empty array with no initial value'); + return memo; + }; + + // The right-associative version of reduce, also known as `foldr`. + // Delegates to **ECMAScript 5**'s native `reduceRight` if available. + _.reduceRight = _.foldr = function(obj, iterator, memo, context) { + var initial = arguments.length > 2; + if (obj == null) obj = []; + if (nativeReduceRight && obj.reduceRight === nativeReduceRight) { + if (context) iterator = _.bind(iterator, context); + return initial ? obj.reduceRight(iterator, memo) : obj.reduceRight(iterator); + } + var reversed = _.toArray(obj).reverse(); + if (context && !initial) iterator = _.bind(iterator, context); + return initial ? _.reduce(reversed, iterator, memo, context) : _.reduce(reversed, iterator); + }; + + // Return the first value which passes a truth test. Aliased as `detect`. + _.find = _.detect = function(obj, iterator, context) { + var result; + any(obj, function(value, index, list) { + if (iterator.call(context, value, index, list)) { + result = value; + return true; + } + }); + return result; + }; + + // Return all the elements that pass a truth test. + // Delegates to **ECMAScript 5**'s native `filter` if available. + // Aliased as `select`. + _.filter = _.select = function(obj, iterator, context) { + var results = []; + if (obj == null) return results; + if (nativeFilter && obj.filter === nativeFilter) return obj.filter(iterator, context); + each(obj, function(value, index, list) { + if (iterator.call(context, value, index, list)) results[results.length] = value; + }); + return results; + }; + + // Return all the elements for which a truth test fails. + _.reject = function(obj, iterator, context) { + var results = []; + if (obj == null) return results; + each(obj, function(value, index, list) { + if (!iterator.call(context, value, index, list)) results[results.length] = value; + }); + return results; + }; + + // Determine whether all of the elements match a truth test. + // Delegates to **ECMAScript 5**'s native `every` if available. + // Aliased as `all`. + _.every = _.all = function(obj, iterator, context) { + var result = true; + if (obj == null) return result; + if (nativeEvery && obj.every === nativeEvery) return obj.every(iterator, context); + each(obj, function(value, index, list) { + if (!(result = result && iterator.call(context, value, index, list))) return breaker; + }); + return result; + }; + + // Determine if at least one element in the object matches a truth test. + // Delegates to **ECMAScript 5**'s native `some` if available. + // Aliased as `any`. + var any = _.some = _.any = function(obj, iterator, context) { + iterator || (iterator = _.identity); + var result = false; + if (obj == null) return result; + if (nativeSome && obj.some === nativeSome) return obj.some(iterator, context); + each(obj, function(value, index, list) { + if (result || (result = iterator.call(context, value, index, list))) return breaker; + }); + return !!result; + }; + + // Determine if a given value is included in the array or object using `===`. + // Aliased as `contains`. + _.include = _.contains = function(obj, target) { + var found = false; + if (obj == null) return found; + if (nativeIndexOf && obj.indexOf === nativeIndexOf) return obj.indexOf(target) != -1; + found = any(obj, function(value) { + return value === target; + }); + return found; + }; + + // Invoke a method (with arguments) on every item in a collection. + _.invoke = function(obj, method) { + var args = slice.call(arguments, 2); + return _.map(obj, function(value) { + return (_.isFunction(method) ? method || value : value[method]).apply(value, args); + }); + }; + + // Convenience version of a common use case of `map`: fetching a property. + _.pluck = function(obj, key) { + return _.map(obj, function(value){ return value[key]; }); + }; + + // Return the maximum element or (element-based computation). + _.max = function(obj, iterator, context) { + if (!iterator && _.isArray(obj)) return Math.max.apply(Math, obj); + if (!iterator && _.isEmpty(obj)) return -Infinity; + var result = {computed : -Infinity}; + each(obj, function(value, index, list) { + var computed = iterator ? iterator.call(context, value, index, list) : value; + computed >= result.computed && (result = {value : value, computed : computed}); + }); + return result.value; + }; + + // Return the minimum element (or element-based computation). + _.min = function(obj, iterator, context) { + if (!iterator && _.isArray(obj)) return Math.min.apply(Math, obj); + if (!iterator && _.isEmpty(obj)) return Infinity; + var result = {computed : Infinity}; + each(obj, function(value, index, list) { + var computed = iterator ? iterator.call(context, value, index, list) : value; + computed < result.computed && (result = {value : value, computed : computed}); + }); + return result.value; + }; + + // Shuffle an array. + _.shuffle = function(obj) { + var shuffled = [], rand; + each(obj, function(value, index, list) { + if (index == 0) { + shuffled[0] = value; + } else { + rand = Math.floor(Math.random() * (index + 1)); + shuffled[index] = shuffled[rand]; + shuffled[rand] = value; + } + }); + return shuffled; + }; + + // Sort the object's values by a criterion produced by an iterator. + _.sortBy = function(obj, iterator, context) { + return _.pluck(_.map(obj, function(value, index, list) { + return { + value : value, + criteria : iterator.call(context, value, index, list) + }; + }).sort(function(left, right) { + var a = left.criteria, b = right.criteria; + return a < b ? -1 : a > b ? 1 : 0; + }), 'value'); + }; + + // Groups the object's values by a criterion. Pass either a string attribute + // to group by, or a function that returns the criterion. + _.groupBy = function(obj, val) { + var result = {}; + var iterator = _.isFunction(val) ? val : function(obj) { return obj[val]; }; + each(obj, function(value, index) { + var key = iterator(value, index); + (result[key] || (result[key] = [])).push(value); + }); + return result; + }; + + // Use a comparator function to figure out at what index an object should + // be inserted so as to maintain order. Uses binary search. + _.sortedIndex = function(array, obj, iterator) { + iterator || (iterator = _.identity); + var low = 0, high = array.length; + while (low < high) { + var mid = (low + high) >> 1; + iterator(array[mid]) < iterator(obj) ? low = mid + 1 : high = mid; + } + return low; + }; + + // Safely convert anything iterable into a real, live array. + _.toArray = function(iterable) { + if (!iterable) return []; + if (iterable.toArray) return iterable.toArray(); + if (_.isArray(iterable)) return slice.call(iterable); + if (_.isArguments(iterable)) return slice.call(iterable); + return _.values(iterable); + }; + + // Return the number of elements in an object. + _.size = function(obj) { + return _.toArray(obj).length; + }; + + // Array Functions + // --------------- + + // Get the first element of an array. Passing **n** will return the first N + // values in the array. Aliased as `head`. The **guard** check allows it to work + // with `_.map`. + _.first = _.head = function(array, n, guard) { + return (n != null) && !guard ? slice.call(array, 0, n) : array[0]; + }; + + // Returns everything but the last entry of the array. Especcialy useful on + // the arguments object. Passing **n** will return all the values in + // the array, excluding the last N. The **guard** check allows it to work with + // `_.map`. + _.initial = function(array, n, guard) { + return slice.call(array, 0, array.length - ((n == null) || guard ? 1 : n)); + }; + + // Get the last element of an array. Passing **n** will return the last N + // values in the array. The **guard** check allows it to work with `_.map`. + _.last = function(array, n, guard) { + if ((n != null) && !guard) { + return slice.call(array, Math.max(array.length - n, 0)); + } else { + return array[array.length - 1]; + } + }; + + // Returns everything but the first entry of the array. Aliased as `tail`. + // Especially useful on the arguments object. Passing an **index** will return + // the rest of the values in the array from that index onward. The **guard** + // check allows it to work with `_.map`. + _.rest = _.tail = function(array, index, guard) { + return slice.call(array, (index == null) || guard ? 1 : index); + }; + + // Trim out all falsy values from an array. + _.compact = function(array) { + return _.filter(array, function(value){ return !!value; }); + }; + + // Return a completely flattened version of an array. + _.flatten = function(array, shallow) { + return _.reduce(array, function(memo, value) { + if (_.isArray(value)) return memo.concat(shallow ? value : _.flatten(value)); + memo[memo.length] = value; + return memo; + }, []); + }; + + // Return a version of the array that does not contain the specified value(s). + _.without = function(array) { + return _.difference(array, slice.call(arguments, 1)); + }; + + // Produce a duplicate-free version of the array. If the array has already + // been sorted, you have the option of using a faster algorithm. + // Aliased as `unique`. + _.uniq = _.unique = function(array, isSorted, iterator) { + var initial = iterator ? _.map(array, iterator) : array; + var result = []; + _.reduce(initial, function(memo, el, i) { + if (0 == i || (isSorted === true ? _.last(memo) != el : !_.include(memo, el))) { + memo[memo.length] = el; + result[result.length] = array[i]; + } + return memo; + }, []); + return result; + }; + + // Produce an array that contains the union: each distinct element from all of + // the passed-in arrays. + _.union = function() { + return _.uniq(_.flatten(arguments, true)); + }; + + // Produce an array that contains every item shared between all the + // passed-in arrays. (Aliased as "intersect" for back-compat.) + _.intersection = _.intersect = function(array) { + var rest = slice.call(arguments, 1); + return _.filter(_.uniq(array), function(item) { + return _.every(rest, function(other) { + return _.indexOf(other, item) >= 0; + }); + }); + }; + + // Take the difference between one array and a number of other arrays. + // Only the elements present in just the first array will remain. + _.difference = function(array) { + var rest = _.flatten(slice.call(arguments, 1)); + return _.filter(array, function(value){ return !_.include(rest, value); }); + }; + + // Zip together multiple lists into a single array -- elements that share + // an index go together. + _.zip = function() { + var args = slice.call(arguments); + var length = _.max(_.pluck(args, 'length')); + var results = new Array(length); + for (var i = 0; i < length; i++) results[i] = _.pluck(args, "" + i); + return results; + }; + + // If the browser doesn't supply us with indexOf (I'm looking at you, **MSIE**), + // we need this function. Return the position of the first occurrence of an + // item in an array, or -1 if the item is not included in the array. + // Delegates to **ECMAScript 5**'s native `indexOf` if available. + // If the array is large and already in sort order, pass `true` + // for **isSorted** to use binary search. + _.indexOf = function(array, item, isSorted) { + if (array == null) return -1; + var i, l; + if (isSorted) { + i = _.sortedIndex(array, item); + return array[i] === item ? i : -1; + } + if (nativeIndexOf && array.indexOf === nativeIndexOf) return array.indexOf(item); + for (i = 0, l = array.length; i < l; i++) if (i in array && array[i] === item) return i; + return -1; + }; + + // Delegates to **ECMAScript 5**'s native `lastIndexOf` if available. + _.lastIndexOf = function(array, item) { + if (array == null) return -1; + if (nativeLastIndexOf && array.lastIndexOf === nativeLastIndexOf) return array.lastIndexOf(item); + var i = array.length; + while (i--) if (i in array && array[i] === item) return i; + return -1; + }; + + // Generate an integer Array containing an arithmetic progression. A port of + // the native Python `range()` function. See + // [the Python documentation](http://docs.python.org/library/functions.html#range). + _.range = function(start, stop, step) { + if (arguments.length <= 1) { + stop = start || 0; + start = 0; + } + step = arguments[2] || 1; + + var len = Math.max(Math.ceil((stop - start) / step), 0); + var idx = 0; + var range = new Array(len); + + while(idx < len) { + range[idx++] = start; + start += step; + } + + return range; + }; + + // Function (ahem) Functions + // ------------------ + + // Reusable constructor function for prototype setting. + var ctor = function(){}; + + // Create a function bound to a given object (assigning `this`, and arguments, + // optionally). Binding with arguments is also known as `curry`. + // Delegates to **ECMAScript 5**'s native `Function.bind` if available. + // We check for `func.bind` first, to fail fast when `func` is undefined. + _.bind = function bind(func, context) { + var bound, args; + if (func.bind === nativeBind && nativeBind) return nativeBind.apply(func, slice.call(arguments, 1)); + if (!_.isFunction(func)) throw new TypeError; + args = slice.call(arguments, 2); + return bound = function() { + if (!(this instanceof bound)) return func.apply(context, args.concat(slice.call(arguments))); + ctor.prototype = func.prototype; + var self = new ctor; + var result = func.apply(self, args.concat(slice.call(arguments))); + if (Object(result) === result) return result; + return self; + }; + }; + + // Bind all of an object's methods to that object. Useful for ensuring that + // all callbacks defined on an object belong to it. + _.bindAll = function(obj) { + var funcs = slice.call(arguments, 1); + if (funcs.length == 0) funcs = _.functions(obj); + each(funcs, function(f) { obj[f] = _.bind(obj[f], obj); }); + return obj; + }; + + // Memoize an expensive function by storing its results. + _.memoize = function(func, hasher) { + var memo = {}; + hasher || (hasher = _.identity); + return function() { + var key = hasher.apply(this, arguments); + return _.has(memo, key) ? memo[key] : (memo[key] = func.apply(this, arguments)); + }; + }; + + // Delays a function for the given number of milliseconds, and then calls + // it with the arguments supplied. + _.delay = function(func, wait) { + var args = slice.call(arguments, 2); + return setTimeout(function(){ return func.apply(func, args); }, wait); + }; + + // Defers a function, scheduling it to run after the current call stack has + // cleared. + _.defer = function(func) { + return _.delay.apply(_, [func, 1].concat(slice.call(arguments, 1))); + }; + + // Returns a function, that, when invoked, will only be triggered at most once + // during a given window of time. + _.throttle = function(func, wait) { + var context, args, timeout, throttling, more; + var whenDone = _.debounce(function(){ more = throttling = false; }, wait); + return function() { + context = this; args = arguments; + var later = function() { + timeout = null; + if (more) func.apply(context, args); + whenDone(); + }; + if (!timeout) timeout = setTimeout(later, wait); + if (throttling) { + more = true; + } else { + func.apply(context, args); + } + whenDone(); + throttling = true; + }; + }; + + // Returns a function, that, as long as it continues to be invoked, will not + // be triggered. The function will be called after it stops being called for + // N milliseconds. + _.debounce = function(func, wait) { + var timeout; + return function() { + var context = this, args = arguments; + var later = function() { + timeout = null; + func.apply(context, args); + }; + clearTimeout(timeout); + timeout = setTimeout(later, wait); + }; + }; + + // Returns a function that will be executed at most one time, no matter how + // often you call it. Useful for lazy initialization. + _.once = function(func) { + var ran = false, memo; + return function() { + if (ran) return memo; + ran = true; + return memo = func.apply(this, arguments); + }; + }; + + // Returns the first function passed as an argument to the second, + // allowing you to adjust arguments, run code before and after, and + // conditionally execute the original function. + _.wrap = function(func, wrapper) { + return function() { + var args = [func].concat(slice.call(arguments, 0)); + return wrapper.apply(this, args); + }; + }; + + // Returns a function that is the composition of a list of functions, each + // consuming the return value of the function that follows. + _.compose = function() { + var funcs = arguments; + return function() { + var args = arguments; + for (var i = funcs.length - 1; i >= 0; i--) { + args = [funcs[i].apply(this, args)]; + } + return args[0]; + }; + }; + + // Returns a function that will only be executed after being called N times. + _.after = function(times, func) { + if (times <= 0) return func(); + return function() { + if (--times < 1) { return func.apply(this, arguments); } + }; + }; + + // Object Functions + // ---------------- + + // Retrieve the names of an object's properties. + // Delegates to **ECMAScript 5**'s native `Object.keys` + _.keys = nativeKeys || function(obj) { + if (obj !== Object(obj)) throw new TypeError('Invalid object'); + var keys = []; + for (var key in obj) if (_.has(obj, key)) keys[keys.length] = key; + return keys; + }; + + // Retrieve the values of an object's properties. + _.values = function(obj) { + return _.map(obj, _.identity); + }; + + // Return a sorted list of the function names available on the object. + // Aliased as `methods` + _.functions = _.methods = function(obj) { + var names = []; + for (var key in obj) { + if (_.isFunction(obj[key])) names.push(key); + } + return names.sort(); + }; + + // Extend a given object with all the properties in passed-in object(s). + _.extend = function(obj) { + each(slice.call(arguments, 1), function(source) { + for (var prop in source) { + obj[prop] = source[prop]; + } + }); + return obj; + }; + + // Fill in a given object with default properties. + _.defaults = function(obj) { + each(slice.call(arguments, 1), function(source) { + for (var prop in source) { + if (obj[prop] == null) obj[prop] = source[prop]; + } + }); + return obj; + }; + + // Create a (shallow-cloned) duplicate of an object. + _.clone = function(obj) { + if (!_.isObject(obj)) return obj; + return _.isArray(obj) ? obj.slice() : _.extend({}, obj); + }; + + // Invokes interceptor with the obj, and then returns obj. + // The primary purpose of this method is to "tap into" a method chain, in + // order to perform operations on intermediate results within the chain. + _.tap = function(obj, interceptor) { + interceptor(obj); + return obj; + }; + + // Internal recursive comparison function. + function eq(a, b, stack) { + // Identical objects are equal. `0 === -0`, but they aren't identical. + // See the Harmony `egal` proposal: http://wiki.ecmascript.org/doku.php?id=harmony:egal. + if (a === b) return a !== 0 || 1 / a == 1 / b; + // A strict comparison is necessary because `null == undefined`. + if (a == null || b == null) return a === b; + // Unwrap any wrapped objects. + if (a._chain) a = a._wrapped; + if (b._chain) b = b._wrapped; + // Invoke a custom `isEqual` method if one is provided. + if (a.isEqual && _.isFunction(a.isEqual)) return a.isEqual(b); + if (b.isEqual && _.isFunction(b.isEqual)) return b.isEqual(a); + // Compare `[[Class]]` names. + var className = toString.call(a); + if (className != toString.call(b)) return false; + switch (className) { + // Strings, numbers, dates, and booleans are compared by value. + case '[object String]': + // Primitives and their corresponding object wrappers are equivalent; thus, `"5"` is + // equivalent to `new String("5")`. + return a == String(b); + case '[object Number]': + // `NaN`s are equivalent, but non-reflexive. An `egal` comparison is performed for + // other numeric values. + return a != +a ? b != +b : (a == 0 ? 1 / a == 1 / b : a == +b); + case '[object Date]': + case '[object Boolean]': + // Coerce dates and booleans to numeric primitive values. Dates are compared by their + // millisecond representations. Note that invalid dates with millisecond representations + // of `NaN` are not equivalent. + return +a == +b; + // RegExps are compared by their source patterns and flags. + case '[object RegExp]': + return a.source == b.source && + a.global == b.global && + a.multiline == b.multiline && + a.ignoreCase == b.ignoreCase; + } + if (typeof a != 'object' || typeof b != 'object') return false; + // Assume equality for cyclic structures. The algorithm for detecting cyclic + // structures is adapted from ES 5.1 section 15.12.3, abstract operation `JO`. + var length = stack.length; + while (length--) { + // Linear search. Performance is inversely proportional to the number of + // unique nested structures. + if (stack[length] == a) return true; + } + // Add the first object to the stack of traversed objects. + stack.push(a); + var size = 0, result = true; + // Recursively compare objects and arrays. + if (className == '[object Array]') { + // Compare array lengths to determine if a deep comparison is necessary. + size = a.length; + result = size == b.length; + if (result) { + // Deep compare the contents, ignoring non-numeric properties. + while (size--) { + // Ensure commutative equality for sparse arrays. + if (!(result = size in a == size in b && eq(a[size], b[size], stack))) break; + } + } + } else { + // Objects with different constructors are not equivalent. + if ('constructor' in a != 'constructor' in b || a.constructor != b.constructor) return false; + // Deep compare objects. + for (var key in a) { + if (_.has(a, key)) { + // Count the expected number of properties. + size++; + // Deep compare each member. + if (!(result = _.has(b, key) && eq(a[key], b[key], stack))) break; + } + } + // Ensure that both objects contain the same number of properties. + if (result) { + for (key in b) { + if (_.has(b, key) && !(size--)) break; + } + result = !size; + } + } + // Remove the first object from the stack of traversed objects. + stack.pop(); + return result; + } + + // Perform a deep comparison to check if two objects are equal. + _.isEqual = function(a, b) { + return eq(a, b, []); + }; + + // Is a given array, string, or object empty? + // An "empty" object has no enumerable own-properties. + _.isEmpty = function(obj) { + if (_.isArray(obj) || _.isString(obj)) return obj.length === 0; + for (var key in obj) if (_.has(obj, key)) return false; + return true; + }; + + // Is a given value a DOM element? + _.isElement = function(obj) { + return !!(obj && obj.nodeType == 1); + }; + + // Is a given value an array? + // Delegates to ECMA5's native Array.isArray + _.isArray = nativeIsArray || function(obj) { + return toString.call(obj) == '[object Array]'; + }; + + // Is a given variable an object? + _.isObject = function(obj) { + return obj === Object(obj); + }; + + // Is a given variable an arguments object? + _.isArguments = function(obj) { + return toString.call(obj) == '[object Arguments]'; + }; + if (!_.isArguments(arguments)) { + _.isArguments = function(obj) { + return !!(obj && _.has(obj, 'callee')); + }; + } + + // Is a given value a function? + _.isFunction = function(obj) { + return toString.call(obj) == '[object Function]'; + }; + + // Is a given value a string? + _.isString = function(obj) { + return toString.call(obj) == '[object String]'; + }; + + // Is a given value a number? + _.isNumber = function(obj) { + return toString.call(obj) == '[object Number]'; + }; + + // Is the given value `NaN`? + _.isNaN = function(obj) { + // `NaN` is the only value for which `===` is not reflexive. + return obj !== obj; + }; + + // Is a given value a boolean? + _.isBoolean = function(obj) { + return obj === true || obj === false || toString.call(obj) == '[object Boolean]'; + }; + + // Is a given value a date? + _.isDate = function(obj) { + return toString.call(obj) == '[object Date]'; + }; + + // Is the given value a regular expression? + _.isRegExp = function(obj) { + return toString.call(obj) == '[object RegExp]'; + }; + + // Is a given value equal to null? + _.isNull = function(obj) { + return obj === null; + }; + + // Is a given variable undefined? + _.isUndefined = function(obj) { + return obj === void 0; + }; + + // Has own property? + _.has = function(obj, key) { + return hasOwnProperty.call(obj, key); + }; + + // Utility Functions + // ----------------- + + // Run Underscore.js in *noConflict* mode, returning the `_` variable to its + // previous owner. Returns a reference to the Underscore object. + _.noConflict = function() { + root._ = previousUnderscore; + return this; + }; + + // Keep the identity function around for default iterators. + _.identity = function(value) { + return value; + }; + + // Run a function **n** times. + _.times = function (n, iterator, context) { + for (var i = 0; i < n; i++) iterator.call(context, i); + }; + + // Escape a string for HTML interpolation. + _.escape = function(string) { + return (''+string).replace(/&/g, '&').replace(/</g, '<').replace(/>/g, '>').replace(/"/g, '"').replace(/'/g, ''').replace(/\//g,'/'); + }; + + // Add your own custom functions to the Underscore object, ensuring that + // they're correctly added to the OOP wrapper as well. + _.mixin = function(obj) { + each(_.functions(obj), function(name){ + addToWrapper(name, _[name] = obj[name]); + }); + }; + + // Generate a unique integer id (unique within the entire client session). + // Useful for temporary DOM ids. + var idCounter = 0; + _.uniqueId = function(prefix) { + var id = idCounter++; + return prefix ? prefix + id : id; + }; + + // By default, Underscore uses ERB-style template delimiters, change the + // following template settings to use alternative delimiters. + _.templateSettings = { + evaluate : /<%([\s\S]+?)%>/g, + interpolate : /<%=([\s\S]+?)%>/g, + escape : /<%-([\s\S]+?)%>/g + }; + + // When customizing `templateSettings`, if you don't want to define an + // interpolation, evaluation or escaping regex, we need one that is + // guaranteed not to match. + var noMatch = /.^/; + + // Within an interpolation, evaluation, or escaping, remove HTML escaping + // that had been previously added. + var unescape = function(code) { + return code.replace(/\\\\/g, '\\').replace(/\\'/g, "'"); + }; + + // JavaScript micro-templating, similar to John Resig's implementation. + // Underscore templating handles arbitrary delimiters, preserves whitespace, + // and correctly escapes quotes within interpolated code. + _.template = function(str, data) { + var c = _.templateSettings; + var tmpl = 'var __p=[],print=function(){__p.push.apply(__p,arguments);};' + + 'with(obj||{}){__p.push(\'' + + str.replace(/\\/g, '\\\\') + .replace(/'/g, "\\'") + .replace(c.escape || noMatch, function(match, code) { + return "',_.escape(" + unescape(code) + "),'"; + }) + .replace(c.interpolate || noMatch, function(match, code) { + return "'," + unescape(code) + ",'"; + }) + .replace(c.evaluate || noMatch, function(match, code) { + return "');" + unescape(code).replace(/[\r\n\t]/g, ' ') + ";__p.push('"; + }) + .replace(/\r/g, '\\r') + .replace(/\n/g, '\\n') + .replace(/\t/g, '\\t') + + "');}return __p.join('');"; + var func = new Function('obj', '_', tmpl); + if (data) return func(data, _); + return function(data) { + return func.call(this, data, _); + }; + }; + + // Add a "chain" function, which will delegate to the wrapper. + _.chain = function(obj) { + return _(obj).chain(); + }; + + // The OOP Wrapper + // --------------- + + // If Underscore is called as a function, it returns a wrapped object that + // can be used OO-style. This wrapper holds altered versions of all the + // underscore functions. Wrapped objects may be chained. + var wrapper = function(obj) { this._wrapped = obj; }; + + // Expose `wrapper.prototype` as `_.prototype` + _.prototype = wrapper.prototype; + + // Helper function to continue chaining intermediate results. + var result = function(obj, chain) { + return chain ? _(obj).chain() : obj; + }; + + // A method to easily add functions to the OOP wrapper. + var addToWrapper = function(name, func) { + wrapper.prototype[name] = function() { + var args = slice.call(arguments); + unshift.call(args, this._wrapped); + return result(func.apply(_, args), this._chain); + }; + }; + + // Add all of the Underscore functions to the wrapper object. + _.mixin(_); + + // Add all mutator Array functions to the wrapper. + each(['pop', 'push', 'reverse', 'shift', 'sort', 'splice', 'unshift'], function(name) { + var method = ArrayProto[name]; + wrapper.prototype[name] = function() { + var wrapped = this._wrapped; + method.apply(wrapped, arguments); + var length = wrapped.length; + if ((name == 'shift' || name == 'splice') && length === 0) delete wrapped[0]; + return result(wrapped, this._chain); + }; + }); + + // Add all accessor Array functions to the wrapper. + each(['concat', 'join', 'slice'], function(name) { + var method = ArrayProto[name]; + wrapper.prototype[name] = function() { + return result(method.apply(this._wrapped, arguments), this._chain); + }; + }); + + // Start chaining a wrapped Underscore object. + wrapper.prototype.chain = function() { + this._chain = true; + return this; + }; + + // Extracts the result from a wrapped and chained object. + wrapper.prototype.value = function() { + return this._wrapped; + }; + +}).call(this); diff --git a/doc/html/_static/underscore.js b/doc/html/_static/underscore.js index b4f49a02..5b55f32b 100644 --- a/doc/html/_static/underscore.js +++ b/doc/html/_static/underscore.js @@ -1,1415 +1,31 @@ -// Underscore.js 1.7.0 -// http://underscorejs.org -// (c) 2009-2014 Jeremy Ashkenas, DocumentCloud and Investigative Reporters & Editors -// Underscore may be freely distributed under the MIT license. - -(function() { - - // Baseline setup - // -------------- - - // Establish the root object, `window` in the browser, or `exports` on the server. - var root = this; - - // Save the previous value of the `_` variable. - var previousUnderscore = root._; - - // Save bytes in the minified (but not gzipped) version: - var ArrayProto = Array.prototype, ObjProto = Object.prototype, FuncProto = Function.prototype; - - // Create quick reference variables for speed access to core prototypes. - var - push = ArrayProto.push, - slice = ArrayProto.slice, - concat = ArrayProto.concat, - toString = ObjProto.toString, - hasOwnProperty = ObjProto.hasOwnProperty; - - // All **ECMAScript 5** native function implementations that we hope to use - // are declared here. - var - nativeIsArray = Array.isArray, - nativeKeys = Object.keys, - nativeBind = FuncProto.bind; - - // Create a safe reference to the Underscore object for use below. - var _ = function(obj) { - if (obj instanceof _) return obj; - if (!(this instanceof _)) return new _(obj); - this._wrapped = obj; - }; - - // Export the Underscore object for **Node.js**, with - // backwards-compatibility for the old `require()` API. If we're in - // the browser, add `_` as a global object. - if (typeof exports !== 'undefined') { - if (typeof module !== 'undefined' && module.exports) { - exports = module.exports = _; - } - exports._ = _; - } else { - root._ = _; - } - - // Current version. - _.VERSION = '1.7.0'; - - // Internal function that returns an efficient (for current engines) version - // of the passed-in callback, to be repeatedly applied in other Underscore - // functions. - var createCallback = function(func, context, argCount) { - if (context === void 0) return func; - switch (argCount == null ? 3 : argCount) { - case 1: return function(value) { - return func.call(context, value); - }; - case 2: return function(value, other) { - return func.call(context, value, other); - }; - case 3: return function(value, index, collection) { - return func.call(context, value, index, collection); - }; - case 4: return function(accumulator, value, index, collection) { - return func.call(context, accumulator, value, index, collection); - }; - } - return function() { - return func.apply(context, arguments); - }; - }; - - // A mostly-internal function to generate callbacks that can be applied - // to each element in a collection, returning the desired result — either - // identity, an arbitrary callback, a property matcher, or a property accessor. - _.iteratee = function(value, context, argCount) { - if (value == null) return _.identity; - if (_.isFunction(value)) return createCallback(value, context, argCount); - if (_.isObject(value)) return _.matches(value); - return _.property(value); - }; - - // Collection Functions - // -------------------- - - // The cornerstone, an `each` implementation, aka `forEach`. - // Handles raw objects in addition to array-likes. Treats all - // sparse array-likes as if they were dense. - _.each = _.forEach = function(obj, iteratee, context) { - if (obj == null) return obj; - iteratee = createCallback(iteratee, context); - var i, length = obj.length; - if (length === +length) { - for (i = 0; i < length; i++) { - iteratee(obj[i], i, obj); - } - } else { - var keys = _.keys(obj); - for (i = 0, length = keys.length; i < length; i++) { - iteratee(obj[keys[i]], keys[i], obj); - } - } - return obj; - }; - - // Return the results of applying the iteratee to each element. - _.map = _.collect = function(obj, iteratee, context) { - if (obj == null) return []; - iteratee = _.iteratee(iteratee, context); - var keys = obj.length !== +obj.length && _.keys(obj), - length = (keys || obj).length, - results = Array(length), - currentKey; - for (var index = 0; index < length; index++) { - currentKey = keys ? keys[index] : index; - results[index] = iteratee(obj[currentKey], currentKey, obj); - } - return results; - }; - - var reduceError = 'Reduce of empty array with no initial value'; - - // **Reduce** builds up a single result from a list of values, aka `inject`, - // or `foldl`. - _.reduce = _.foldl = _.inject = function(obj, iteratee, memo, context) { - if (obj == null) obj = []; - iteratee = createCallback(iteratee, context, 4); - var keys = obj.length !== +obj.length && _.keys(obj), - length = (keys || obj).length, - index = 0, currentKey; - if (arguments.length < 3) { - if (!length) throw new TypeError(reduceError); - memo = obj[keys ? keys[index++] : index++]; - } - for (; index < length; index++) { - currentKey = keys ? keys[index] : index; - memo = iteratee(memo, obj[currentKey], currentKey, obj); - } - return memo; - }; - - // The right-associative version of reduce, also known as `foldr`. - _.reduceRight = _.foldr = function(obj, iteratee, memo, context) { - if (obj == null) obj = []; - iteratee = createCallback(iteratee, context, 4); - var keys = obj.length !== + obj.length && _.keys(obj), - index = (keys || obj).length, - currentKey; - if (arguments.length < 3) { - if (!index) throw new TypeError(reduceError); - memo = obj[keys ? keys[--index] : --index]; - } - while (index--) { - currentKey = keys ? keys[index] : index; - memo = iteratee(memo, obj[currentKey], currentKey, obj); - } - return memo; - }; - - // Return the first value which passes a truth test. Aliased as `detect`. - _.find = _.detect = function(obj, predicate, context) { - var result; - predicate = _.iteratee(predicate, context); - _.some(obj, function(value, index, list) { - if (predicate(value, index, list)) { - result = value; - return true; - } - }); - return result; - }; - - // Return all the elements that pass a truth test. - // Aliased as `select`. - _.filter = _.select = function(obj, predicate, context) { - var results = []; - if (obj == null) return results; - predicate = _.iteratee(predicate, context); - _.each(obj, function(value, index, list) { - if (predicate(value, index, list)) results.push(value); - }); - return results; - }; - - // Return all the elements for which a truth test fails. - _.reject = function(obj, predicate, context) { - return _.filter(obj, _.negate(_.iteratee(predicate)), context); - }; - - // Determine whether all of the elements match a truth test. - // Aliased as `all`. - _.every = _.all = function(obj, predicate, context) { - if (obj == null) return true; - predicate = _.iteratee(predicate, context); - var keys = obj.length !== +obj.length && _.keys(obj), - length = (keys || obj).length, - index, currentKey; - for (index = 0; index < length; index++) { - currentKey = keys ? keys[index] : index; - if (!predicate(obj[currentKey], currentKey, obj)) return false; - } - return true; - }; - - // Determine if at least one element in the object matches a truth test. - // Aliased as `any`. - _.some = _.any = function(obj, predicate, context) { - if (obj == null) return false; - predicate = _.iteratee(predicate, context); - var keys = obj.length !== +obj.length && _.keys(obj), - length = (keys || obj).length, - index, currentKey; - for (index = 0; index < length; index++) { - currentKey = keys ? keys[index] : index; - if (predicate(obj[currentKey], currentKey, obj)) return true; - } - return false; - }; - - // Determine if the array or object contains a given value (using `===`). - // Aliased as `include`. - _.contains = _.include = function(obj, target) { - if (obj == null) return false; - if (obj.length !== +obj.length) obj = _.values(obj); - return _.indexOf(obj, target) >= 0; - }; - - // Invoke a method (with arguments) on every item in a collection. - _.invoke = function(obj, method) { - var args = slice.call(arguments, 2); - var isFunc = _.isFunction(method); - return _.map(obj, function(value) { - return (isFunc ? method : value[method]).apply(value, args); - }); - }; - - // Convenience version of a common use case of `map`: fetching a property. - _.pluck = function(obj, key) { - return _.map(obj, _.property(key)); - }; - - // Convenience version of a common use case of `filter`: selecting only objects - // containing specific `key:value` pairs. - _.where = function(obj, attrs) { - return _.filter(obj, _.matches(attrs)); - }; - - // Convenience version of a common use case of `find`: getting the first object - // containing specific `key:value` pairs. - _.findWhere = function(obj, attrs) { - return _.find(obj, _.matches(attrs)); - }; - - // Return the maximum element (or element-based computation). - _.max = function(obj, iteratee, context) { - var result = -Infinity, lastComputed = -Infinity, - value, computed; - if (iteratee == null && obj != null) { - obj = obj.length === +obj.length ? obj : _.values(obj); - for (var i = 0, length = obj.length; i < length; i++) { - value = obj[i]; - if (value > result) { - result = value; - } - } - } else { - iteratee = _.iteratee(iteratee, context); - _.each(obj, function(value, index, list) { - computed = iteratee(value, index, list); - if (computed > lastComputed || computed === -Infinity && result === -Infinity) { - result = value; - lastComputed = computed; - } - }); - } - return result; - }; - - // Return the minimum element (or element-based computation). - _.min = function(obj, iteratee, context) { - var result = Infinity, lastComputed = Infinity, - value, computed; - if (iteratee == null && obj != null) { - obj = obj.length === +obj.length ? obj : _.values(obj); - for (var i = 0, length = obj.length; i < length; i++) { - value = obj[i]; - if (value < result) { - result = value; - } - } - } else { - iteratee = _.iteratee(iteratee, context); - _.each(obj, function(value, index, list) { - computed = iteratee(value, index, list); - if (computed < lastComputed || computed === Infinity && result === Infinity) { - result = value; - lastComputed = computed; - } - }); - } - return result; - }; - - // Shuffle a collection, using the modern version of the - // [Fisher-Yates shuffle](http://en.wikipedia.org/wiki/Fisher–Yates_shuffle). - _.shuffle = function(obj) { - var set = obj && obj.length === +obj.length ? obj : _.values(obj); - var length = set.length; - var shuffled = Array(length); - for (var index = 0, rand; index < length; index++) { - rand = _.random(0, index); - if (rand !== index) shuffled[index] = shuffled[rand]; - shuffled[rand] = set[index]; - } - return shuffled; - }; - - // Sample **n** random values from a collection. - // If **n** is not specified, returns a single random element. - // The internal `guard` argument allows it to work with `map`. - _.sample = function(obj, n, guard) { - if (n == null || guard) { - if (obj.length !== +obj.length) obj = _.values(obj); - return obj[_.random(obj.length - 1)]; - } - return _.shuffle(obj).slice(0, Math.max(0, n)); - }; - - // Sort the object's values by a criterion produced by an iteratee. - _.sortBy = function(obj, iteratee, context) { - iteratee = _.iteratee(iteratee, context); - return _.pluck(_.map(obj, function(value, index, list) { - return { - value: value, - index: index, - criteria: iteratee(value, index, list) - }; - }).sort(function(left, right) { - var a = left.criteria; - var b = right.criteria; - if (a !== b) { - if (a > b || a === void 0) return 1; - if (a < b || b === void 0) return -1; - } - return left.index - right.index; - }), 'value'); - }; - - // An internal function used for aggregate "group by" operations. - var group = function(behavior) { - return function(obj, iteratee, context) { - var result = {}; - iteratee = _.iteratee(iteratee, context); - _.each(obj, function(value, index) { - var key = iteratee(value, index, obj); - behavior(result, value, key); - }); - return result; - }; - }; - - // Groups the object's values by a criterion. Pass either a string attribute - // to group by, or a function that returns the criterion. - _.groupBy = group(function(result, value, key) { - if (_.has(result, key)) result[key].push(value); else result[key] = [value]; - }); - - // Indexes the object's values by a criterion, similar to `groupBy`, but for - // when you know that your index values will be unique. - _.indexBy = group(function(result, value, key) { - result[key] = value; - }); - - // Counts instances of an object that group by a certain criterion. Pass - // either a string attribute to count by, or a function that returns the - // criterion. - _.countBy = group(function(result, value, key) { - if (_.has(result, key)) result[key]++; else result[key] = 1; - }); - - // Use a comparator function to figure out the smallest index at which - // an object should be inserted so as to maintain order. Uses binary search. - _.sortedIndex = function(array, obj, iteratee, context) { - iteratee = _.iteratee(iteratee, context, 1); - var value = iteratee(obj); - var low = 0, high = array.length; - while (low < high) { - var mid = low + high >>> 1; - if (iteratee(array[mid]) < value) low = mid + 1; else high = mid; - } - return low; - }; - - // Safely create a real, live array from anything iterable. - _.toArray = function(obj) { - if (!obj) return []; - if (_.isArray(obj)) return slice.call(obj); - if (obj.length === +obj.length) return _.map(obj, _.identity); - return _.values(obj); - }; - - // Return the number of elements in an object. - _.size = function(obj) { - if (obj == null) return 0; - return obj.length === +obj.length ? obj.length : _.keys(obj).length; - }; - - // Split a collection into two arrays: one whose elements all satisfy the given - // predicate, and one whose elements all do not satisfy the predicate. - _.partition = function(obj, predicate, context) { - predicate = _.iteratee(predicate, context); - var pass = [], fail = []; - _.each(obj, function(value, key, obj) { - (predicate(value, key, obj) ? pass : fail).push(value); - }); - return [pass, fail]; - }; - - // Array Functions - // --------------- - - // Get the first element of an array. Passing **n** will return the first N - // values in the array. Aliased as `head` and `take`. The **guard** check - // allows it to work with `_.map`. - _.first = _.head = _.take = function(array, n, guard) { - if (array == null) return void 0; - if (n == null || guard) return array[0]; - if (n < 0) return []; - return slice.call(array, 0, n); - }; - - // Returns everything but the last entry of the array. Especially useful on - // the arguments object. Passing **n** will return all the values in - // the array, excluding the last N. The **guard** check allows it to work with - // `_.map`. - _.initial = function(array, n, guard) { - return slice.call(array, 0, Math.max(0, array.length - (n == null || guard ? 1 : n))); - }; - - // Get the last element of an array. Passing **n** will return the last N - // values in the array. The **guard** check allows it to work with `_.map`. - _.last = function(array, n, guard) { - if (array == null) return void 0; - if (n == null || guard) return array[array.length - 1]; - return slice.call(array, Math.max(array.length - n, 0)); - }; - - // Returns everything but the first entry of the array. Aliased as `tail` and `drop`. - // Especially useful on the arguments object. Passing an **n** will return - // the rest N values in the array. The **guard** - // check allows it to work with `_.map`. - _.rest = _.tail = _.drop = function(array, n, guard) { - return slice.call(array, n == null || guard ? 1 : n); - }; - - // Trim out all falsy values from an array. - _.compact = function(array) { - return _.filter(array, _.identity); - }; - - // Internal implementation of a recursive `flatten` function. - var flatten = function(input, shallow, strict, output) { - if (shallow && _.every(input, _.isArray)) { - return concat.apply(output, input); - } - for (var i = 0, length = input.length; i < length; i++) { - var value = input[i]; - if (!_.isArray(value) && !_.isArguments(value)) { - if (!strict) output.push(value); - } else if (shallow) { - push.apply(output, value); - } else { - flatten(value, shallow, strict, output); - } - } - return output; - }; - - // Flatten out an array, either recursively (by default), or just one level. - _.flatten = function(array, shallow) { - return flatten(array, shallow, false, []); - }; - - // Return a version of the array that does not contain the specified value(s). - _.without = function(array) { - return _.difference(array, slice.call(arguments, 1)); - }; - - // Produce a duplicate-free version of the array. If the array has already - // been sorted, you have the option of using a faster algorithm. - // Aliased as `unique`. - _.uniq = _.unique = function(array, isSorted, iteratee, context) { - if (array == null) return []; - if (!_.isBoolean(isSorted)) { - context = iteratee; - iteratee = isSorted; - isSorted = false; - } - if (iteratee != null) iteratee = _.iteratee(iteratee, context); - var result = []; - var seen = []; - for (var i = 0, length = array.length; i < length; i++) { - var value = array[i]; - if (isSorted) { - if (!i || seen !== value) result.push(value); - seen = value; - } else if (iteratee) { - var computed = iteratee(value, i, array); - if (_.indexOf(seen, computed) < 0) { - seen.push(computed); - result.push(value); - } - } else if (_.indexOf(result, value) < 0) { - result.push(value); - } - } - return result; - }; - - // Produce an array that contains the union: each distinct element from all of - // the passed-in arrays. - _.union = function() { - return _.uniq(flatten(arguments, true, true, [])); - }; - - // Produce an array that contains every item shared between all the - // passed-in arrays. - _.intersection = function(array) { - if (array == null) return []; - var result = []; - var argsLength = arguments.length; - for (var i = 0, length = array.length; i < length; i++) { - var item = array[i]; - if (_.contains(result, item)) continue; - for (var j = 1; j < argsLength; j++) { - if (!_.contains(arguments[j], item)) break; - } - if (j === argsLength) result.push(item); - } - return result; - }; - - // Take the difference between one array and a number of other arrays. - // Only the elements present in just the first array will remain. - _.difference = function(array) { - var rest = flatten(slice.call(arguments, 1), true, true, []); - return _.filter(array, function(value){ - return !_.contains(rest, value); - }); - }; - - // Zip together multiple lists into a single array -- elements that share - // an index go together. - _.zip = function(array) { - if (array == null) return []; - var length = _.max(arguments, 'length').length; - var results = Array(length); - for (var i = 0; i < length; i++) { - results[i] = _.pluck(arguments, i); - } - return results; - }; - - // Converts lists into objects. Pass either a single array of `[key, value]` - // pairs, or two parallel arrays of the same length -- one of keys, and one of - // the corresponding values. - _.object = function(list, values) { - if (list == null) return {}; - var result = {}; - for (var i = 0, length = list.length; i < length; i++) { - if (values) { - result[list[i]] = values[i]; - } else { - result[list[i][0]] = list[i][1]; - } - } - return result; - }; - - // Return the position of the first occurrence of an item in an array, - // or -1 if the item is not included in the array. - // If the array is large and already in sort order, pass `true` - // for **isSorted** to use binary search. - _.indexOf = function(array, item, isSorted) { - if (array == null) return -1; - var i = 0, length = array.length; - if (isSorted) { - if (typeof isSorted == 'number') { - i = isSorted < 0 ? Math.max(0, length + isSorted) : isSorted; - } else { - i = _.sortedIndex(array, item); - return array[i] === item ? i : -1; - } - } - for (; i < length; i++) if (array[i] === item) return i; - return -1; - }; - - _.lastIndexOf = function(array, item, from) { - if (array == null) return -1; - var idx = array.length; - if (typeof from == 'number') { - idx = from < 0 ? idx + from + 1 : Math.min(idx, from + 1); - } - while (--idx >= 0) if (array[idx] === item) return idx; - return -1; - }; - - // Generate an integer Array containing an arithmetic progression. A port of - // the native Python `range()` function. See - // [the Python documentation](http://docs.python.org/library/functions.html#range). - _.range = function(start, stop, step) { - if (arguments.length <= 1) { - stop = start || 0; - start = 0; - } - step = step || 1; - - var length = Math.max(Math.ceil((stop - start) / step), 0); - var range = Array(length); - - for (var idx = 0; idx < length; idx++, start += step) { - range[idx] = start; - } - - return range; - }; - - // Function (ahem) Functions - // ------------------ - - // Reusable constructor function for prototype setting. - var Ctor = function(){}; - - // Create a function bound to a given object (assigning `this`, and arguments, - // optionally). Delegates to **ECMAScript 5**'s native `Function.bind` if - // available. - _.bind = function(func, context) { - var args, bound; - if (nativeBind && func.bind === nativeBind) return nativeBind.apply(func, slice.call(arguments, 1)); - if (!_.isFunction(func)) throw new TypeError('Bind must be called on a function'); - args = slice.call(arguments, 2); - bound = function() { - if (!(this instanceof bound)) return func.apply(context, args.concat(slice.call(arguments))); - Ctor.prototype = func.prototype; - var self = new Ctor; - Ctor.prototype = null; - var result = func.apply(self, args.concat(slice.call(arguments))); - if (_.isObject(result)) return result; - return self; - }; - return bound; - }; - - // Partially apply a function by creating a version that has had some of its - // arguments pre-filled, without changing its dynamic `this` context. _ acts - // as a placeholder, allowing any combination of arguments to be pre-filled. - _.partial = function(func) { - var boundArgs = slice.call(arguments, 1); - return function() { - var position = 0; - var args = boundArgs.slice(); - for (var i = 0, length = args.length; i < length; i++) { - if (args[i] === _) args[i] = arguments[position++]; - } - while (position < arguments.length) args.push(arguments[position++]); - return func.apply(this, args); - }; - }; - - // Bind a number of an object's methods to that object. Remaining arguments - // are the method names to be bound. Useful for ensuring that all callbacks - // defined on an object belong to it. - _.bindAll = function(obj) { - var i, length = arguments.length, key; - if (length <= 1) throw new Error('bindAll must be passed function names'); - for (i = 1; i < length; i++) { - key = arguments[i]; - obj[key] = _.bind(obj[key], obj); - } - return obj; - }; - - // Memoize an expensive function by storing its results. - _.memoize = function(func, hasher) { - var memoize = function(key) { - var cache = memoize.cache; - var address = hasher ? hasher.apply(this, arguments) : key; - if (!_.has(cache, address)) cache[address] = func.apply(this, arguments); - return cache[address]; - }; - memoize.cache = {}; - return memoize; - }; - - // Delays a function for the given number of milliseconds, and then calls - // it with the arguments supplied. - _.delay = function(func, wait) { - var args = slice.call(arguments, 2); - return setTimeout(function(){ - return func.apply(null, args); - }, wait); - }; - - // Defers a function, scheduling it to run after the current call stack has - // cleared. - _.defer = function(func) { - return _.delay.apply(_, [func, 1].concat(slice.call(arguments, 1))); - }; - - // Returns a function, that, when invoked, will only be triggered at most once - // during a given window of time. Normally, the throttled function will run - // as much as it can, without ever going more than once per `wait` duration; - // but if you'd like to disable the execution on the leading edge, pass - // `{leading: false}`. To disable execution on the trailing edge, ditto. - _.throttle = function(func, wait, options) { - var context, args, result; - var timeout = null; - var previous = 0; - if (!options) options = {}; - var later = function() { - previous = options.leading === false ? 0 : _.now(); - timeout = null; - result = func.apply(context, args); - if (!timeout) context = args = null; - }; - return function() { - var now = _.now(); - if (!previous && options.leading === false) previous = now; - var remaining = wait - (now - previous); - context = this; - args = arguments; - if (remaining <= 0 || remaining > wait) { - clearTimeout(timeout); - timeout = null; - previous = now; - result = func.apply(context, args); - if (!timeout) context = args = null; - } else if (!timeout && options.trailing !== false) { - timeout = setTimeout(later, remaining); - } - return result; - }; - }; - - // Returns a function, that, as long as it continues to be invoked, will not - // be triggered. The function will be called after it stops being called for - // N milliseconds. If `immediate` is passed, trigger the function on the - // leading edge, instead of the trailing. - _.debounce = function(func, wait, immediate) { - var timeout, args, context, timestamp, result; - - var later = function() { - var last = _.now() - timestamp; - - if (last < wait && last > 0) { - timeout = setTimeout(later, wait - last); - } else { - timeout = null; - if (!immediate) { - result = func.apply(context, args); - if (!timeout) context = args = null; - } - } - }; - - return function() { - context = this; - args = arguments; - timestamp = _.now(); - var callNow = immediate && !timeout; - if (!timeout) timeout = setTimeout(later, wait); - if (callNow) { - result = func.apply(context, args); - context = args = null; - } - - return result; - }; - }; - - // Returns the first function passed as an argument to the second, - // allowing you to adjust arguments, run code before and after, and - // conditionally execute the original function. - _.wrap = function(func, wrapper) { - return _.partial(wrapper, func); - }; - - // Returns a negated version of the passed-in predicate. - _.negate = function(predicate) { - return function() { - return !predicate.apply(this, arguments); - }; - }; - - // Returns a function that is the composition of a list of functions, each - // consuming the return value of the function that follows. - _.compose = function() { - var args = arguments; - var start = args.length - 1; - return function() { - var i = start; - var result = args[start].apply(this, arguments); - while (i--) result = args[i].call(this, result); - return result; - }; - }; - - // Returns a function that will only be executed after being called N times. - _.after = function(times, func) { - return function() { - if (--times < 1) { - return func.apply(this, arguments); - } - }; - }; - - // Returns a function that will only be executed before being called N times. - _.before = function(times, func) { - var memo; - return function() { - if (--times > 0) { - memo = func.apply(this, arguments); - } else { - func = null; - } - return memo; - }; - }; - - // Returns a function that will be executed at most one time, no matter how - // often you call it. Useful for lazy initialization. - _.once = _.partial(_.before, 2); - - // Object Functions - // ---------------- - - // Retrieve the names of an object's properties. - // Delegates to **ECMAScript 5**'s native `Object.keys` - _.keys = function(obj) { - if (!_.isObject(obj)) return []; - if (nativeKeys) return nativeKeys(obj); - var keys = []; - for (var key in obj) if (_.has(obj, key)) keys.push(key); - return keys; - }; - - // Retrieve the values of an object's properties. - _.values = function(obj) { - var keys = _.keys(obj); - var length = keys.length; - var values = Array(length); - for (var i = 0; i < length; i++) { - values[i] = obj[keys[i]]; - } - return values; - }; - - // Convert an object into a list of `[key, value]` pairs. - _.pairs = function(obj) { - var keys = _.keys(obj); - var length = keys.length; - var pairs = Array(length); - for (var i = 0; i < length; i++) { - pairs[i] = [keys[i], obj[keys[i]]]; - } - return pairs; - }; - - // Invert the keys and values of an object. The values must be serializable. - _.invert = function(obj) { - var result = {}; - var keys = _.keys(obj); - for (var i = 0, length = keys.length; i < length; i++) { - result[obj[keys[i]]] = keys[i]; - } - return result; - }; - - // Return a sorted list of the function names available on the object. - // Aliased as `methods` - _.functions = _.methods = function(obj) { - var names = []; - for (var key in obj) { - if (_.isFunction(obj[key])) names.push(key); - } - return names.sort(); - }; - - // Extend a given object with all the properties in passed-in object(s). - _.extend = function(obj) { - if (!_.isObject(obj)) return obj; - var source, prop; - for (var i = 1, length = arguments.length; i < length; i++) { - source = arguments[i]; - for (prop in source) { - if (hasOwnProperty.call(source, prop)) { - obj[prop] = source[prop]; - } - } - } - return obj; - }; - - // Return a copy of the object only containing the whitelisted properties. - _.pick = function(obj, iteratee, context) { - var result = {}, key; - if (obj == null) return result; - if (_.isFunction(iteratee)) { - iteratee = createCallback(iteratee, context); - for (key in obj) { - var value = obj[key]; - if (iteratee(value, key, obj)) result[key] = value; - } - } else { - var keys = concat.apply([], slice.call(arguments, 1)); - obj = new Object(obj); - for (var i = 0, length = keys.length; i < length; i++) { - key = keys[i]; - if (key in obj) result[key] = obj[key]; - } - } - return result; - }; - - // Return a copy of the object without the blacklisted properties. - _.omit = function(obj, iteratee, context) { - if (_.isFunction(iteratee)) { - iteratee = _.negate(iteratee); - } else { - var keys = _.map(concat.apply([], slice.call(arguments, 1)), String); - iteratee = function(value, key) { - return !_.contains(keys, key); - }; - } - return _.pick(obj, iteratee, context); - }; - - // Fill in a given object with default properties. - _.defaults = function(obj) { - if (!_.isObject(obj)) return obj; - for (var i = 1, length = arguments.length; i < length; i++) { - var source = arguments[i]; - for (var prop in source) { - if (obj[prop] === void 0) obj[prop] = source[prop]; - } - } - return obj; - }; - - // Create a (shallow-cloned) duplicate of an object. - _.clone = function(obj) { - if (!_.isObject(obj)) return obj; - return _.isArray(obj) ? obj.slice() : _.extend({}, obj); - }; - - // Invokes interceptor with the obj, and then returns obj. - // The primary purpose of this method is to "tap into" a method chain, in - // order to perform operations on intermediate results within the chain. - _.tap = function(obj, interceptor) { - interceptor(obj); - return obj; - }; - - // Internal recursive comparison function for `isEqual`. - var eq = function(a, b, aStack, bStack) { - // Identical objects are equal. `0 === -0`, but they aren't identical. - // See the [Harmony `egal` proposal](http://wiki.ecmascript.org/doku.php?id=harmony:egal). - if (a === b) return a !== 0 || 1 / a === 1 / b; - // A strict comparison is necessary because `null == undefined`. - if (a == null || b == null) return a === b; - // Unwrap any wrapped objects. - if (a instanceof _) a = a._wrapped; - if (b instanceof _) b = b._wrapped; - // Compare `[[Class]]` names. - var className = toString.call(a); - if (className !== toString.call(b)) return false; - switch (className) { - // Strings, numbers, regular expressions, dates, and booleans are compared by value. - case '[object RegExp]': - // RegExps are coerced to strings for comparison (Note: '' + /a/i === '/a/i') - case '[object String]': - // Primitives and their corresponding object wrappers are equivalent; thus, `"5"` is - // equivalent to `new String("5")`. - return '' + a === '' + b; - case '[object Number]': - // `NaN`s are equivalent, but non-reflexive. - // Object(NaN) is equivalent to NaN - if (+a !== +a) return +b !== +b; - // An `egal` comparison is performed for other numeric values. - return +a === 0 ? 1 / +a === 1 / b : +a === +b; - case '[object Date]': - case '[object Boolean]': - // Coerce dates and booleans to numeric primitive values. Dates are compared by their - // millisecond representations. Note that invalid dates with millisecond representations - // of `NaN` are not equivalent. - return +a === +b; - } - if (typeof a != 'object' || typeof b != 'object') return false; - // Assume equality for cyclic structures. The algorithm for detecting cyclic - // structures is adapted from ES 5.1 section 15.12.3, abstract operation `JO`. - var length = aStack.length; - while (length--) { - // Linear search. Performance is inversely proportional to the number of - // unique nested structures. - if (aStack[length] === a) return bStack[length] === b; - } - // Objects with different constructors are not equivalent, but `Object`s - // from different frames are. - var aCtor = a.constructor, bCtor = b.constructor; - if ( - aCtor !== bCtor && - // Handle Object.create(x) cases - 'constructor' in a && 'constructor' in b && - !(_.isFunction(aCtor) && aCtor instanceof aCtor && - _.isFunction(bCtor) && bCtor instanceof bCtor) - ) { - return false; - } - // Add the first object to the stack of traversed objects. - aStack.push(a); - bStack.push(b); - var size, result; - // Recursively compare objects and arrays. - if (className === '[object Array]') { - // Compare array lengths to determine if a deep comparison is necessary. - size = a.length; - result = size === b.length; - if (result) { - // Deep compare the contents, ignoring non-numeric properties. - while (size--) { - if (!(result = eq(a[size], b[size], aStack, bStack))) break; - } - } - } else { - // Deep compare objects. - var keys = _.keys(a), key; - size = keys.length; - // Ensure that both objects contain the same number of properties before comparing deep equality. - result = _.keys(b).length === size; - if (result) { - while (size--) { - // Deep compare each member - key = keys[size]; - if (!(result = _.has(b, key) && eq(a[key], b[key], aStack, bStack))) break; - } - } - } - // Remove the first object from the stack of traversed objects. - aStack.pop(); - bStack.pop(); - return result; - }; - - // Perform a deep comparison to check if two objects are equal. - _.isEqual = function(a, b) { - return eq(a, b, [], []); - }; - - // Is a given array, string, or object empty? - // An "empty" object has no enumerable own-properties. - _.isEmpty = function(obj) { - if (obj == null) return true; - if (_.isArray(obj) || _.isString(obj) || _.isArguments(obj)) return obj.length === 0; - for (var key in obj) if (_.has(obj, key)) return false; - return true; - }; - - // Is a given value a DOM element? - _.isElement = function(obj) { - return !!(obj && obj.nodeType === 1); - }; - - // Is a given value an array? - // Delegates to ECMA5's native Array.isArray - _.isArray = nativeIsArray || function(obj) { - return toString.call(obj) === '[object Array]'; - }; - - // Is a given variable an object? - _.isObject = function(obj) { - var type = typeof obj; - return type === 'function' || type === 'object' && !!obj; - }; - - // Add some isType methods: isArguments, isFunction, isString, isNumber, isDate, isRegExp. - _.each(['Arguments', 'Function', 'String', 'Number', 'Date', 'RegExp'], function(name) { - _['is' + name] = function(obj) { - return toString.call(obj) === '[object ' + name + ']'; - }; - }); - - // Define a fallback version of the method in browsers (ahem, IE), where - // there isn't any inspectable "Arguments" type. - if (!_.isArguments(arguments)) { - _.isArguments = function(obj) { - return _.has(obj, 'callee'); - }; - } - - // Optimize `isFunction` if appropriate. Work around an IE 11 bug. - if (typeof /./ !== 'function') { - _.isFunction = function(obj) { - return typeof obj == 'function' || false; - }; - } - - // Is a given object a finite number? - _.isFinite = function(obj) { - return isFinite(obj) && !isNaN(parseFloat(obj)); - }; - - // Is the given value `NaN`? (NaN is the only number which does not equal itself). - _.isNaN = function(obj) { - return _.isNumber(obj) && obj !== +obj; - }; - - // Is a given value a boolean? - _.isBoolean = function(obj) { - return obj === true || obj === false || toString.call(obj) === '[object Boolean]'; - }; - - // Is a given value equal to null? - _.isNull = function(obj) { - return obj === null; - }; - - // Is a given variable undefined? - _.isUndefined = function(obj) { - return obj === void 0; - }; - - // Shortcut function for checking if an object has a given property directly - // on itself (in other words, not on a prototype). - _.has = function(obj, key) { - return obj != null && hasOwnProperty.call(obj, key); - }; - - // Utility Functions - // ----------------- - - // Run Underscore.js in *noConflict* mode, returning the `_` variable to its - // previous owner. Returns a reference to the Underscore object. - _.noConflict = function() { - root._ = previousUnderscore; - return this; - }; - - // Keep the identity function around for default iteratees. - _.identity = function(value) { - return value; - }; - - _.constant = function(value) { - return function() { - return value; - }; - }; - - _.noop = function(){}; - - _.property = function(key) { - return function(obj) { - return obj[key]; - }; - }; - - // Returns a predicate for checking whether an object has a given set of `key:value` pairs. - _.matches = function(attrs) { - var pairs = _.pairs(attrs), length = pairs.length; - return function(obj) { - if (obj == null) return !length; - obj = new Object(obj); - for (var i = 0; i < length; i++) { - var pair = pairs[i], key = pair[0]; - if (pair[1] !== obj[key] || !(key in obj)) return false; - } - return true; - }; - }; - - // Run a function **n** times. - _.times = function(n, iteratee, context) { - var accum = Array(Math.max(0, n)); - iteratee = createCallback(iteratee, context, 1); - for (var i = 0; i < n; i++) accum[i] = iteratee(i); - return accum; - }; - - // Return a random integer between min and max (inclusive). - _.random = function(min, max) { - if (max == null) { - max = min; - min = 0; - } - return min + Math.floor(Math.random() * (max - min + 1)); - }; - - // A (possibly faster) way to get the current timestamp as an integer. - _.now = Date.now || function() { - return new Date().getTime(); - }; - - // List of HTML entities for escaping. - var escapeMap = { - '&': '&', - '<': '<', - '>': '>', - '"': '"', - "'": ''', - '`': '`' - }; - var unescapeMap = _.invert(escapeMap); - - // Functions for escaping and unescaping strings to/from HTML interpolation. - var createEscaper = function(map) { - var escaper = function(match) { - return map[match]; - }; - // Regexes for identifying a key that needs to be escaped - var source = '(?:' + _.keys(map).join('|') + ')'; - var testRegexp = RegExp(source); - var replaceRegexp = RegExp(source, 'g'); - return function(string) { - string = string == null ? '' : '' + string; - return testRegexp.test(string) ? string.replace(replaceRegexp, escaper) : string; - }; - }; - _.escape = createEscaper(escapeMap); - _.unescape = createEscaper(unescapeMap); - - // If the value of the named `property` is a function then invoke it with the - // `object` as context; otherwise, return it. - _.result = function(object, property) { - if (object == null) return void 0; - var value = object[property]; - return _.isFunction(value) ? object[property]() : value; - }; - - // Generate a unique integer id (unique within the entire client session). - // Useful for temporary DOM ids. - var idCounter = 0; - _.uniqueId = function(prefix) { - var id = ++idCounter + ''; - return prefix ? prefix + id : id; - }; - - // By default, Underscore uses ERB-style template delimiters, change the - // following template settings to use alternative delimiters. - _.templateSettings = { - evaluate : /<%([\s\S]+?)%>/g, - interpolate : /<%=([\s\S]+?)%>/g, - escape : /<%-([\s\S]+?)%>/g - }; - - // When customizing `templateSettings`, if you don't want to define an - // interpolation, evaluation or escaping regex, we need one that is - // guaranteed not to match. - var noMatch = /(.)^/; - - // Certain characters need to be escaped so that they can be put into a - // string literal. - var escapes = { - "'": "'", - '\\': '\\', - '\r': 'r', - '\n': 'n', - '\u2028': 'u2028', - '\u2029': 'u2029' - }; - - var escaper = /\\|'|\r|\n|\u2028|\u2029/g; - - var escapeChar = function(match) { - return '\\' + escapes[match]; - }; - - // JavaScript micro-templating, similar to John Resig's implementation. - // Underscore templating handles arbitrary delimiters, preserves whitespace, - // and correctly escapes quotes within interpolated code. - // NB: `oldSettings` only exists for backwards compatibility. - _.template = function(text, settings, oldSettings) { - if (!settings && oldSettings) settings = oldSettings; - settings = _.defaults({}, settings, _.templateSettings); - - // Combine delimiters into one regular expression via alternation. - var matcher = RegExp([ - (settings.escape || noMatch).source, - (settings.interpolate || noMatch).source, - (settings.evaluate || noMatch).source - ].join('|') + '|$', 'g'); - - // Compile the template source, escaping string literals appropriately. - var index = 0; - var source = "__p+='"; - text.replace(matcher, function(match, escape, interpolate, evaluate, offset) { - source += text.slice(index, offset).replace(escaper, escapeChar); - index = offset + match.length; - - if (escape) { - source += "'+\n((__t=(" + escape + "))==null?'':_.escape(__t))+\n'"; - } else if (interpolate) { - source += "'+\n((__t=(" + interpolate + "))==null?'':__t)+\n'"; - } else if (evaluate) { - source += "';\n" + evaluate + "\n__p+='"; - } - - // Adobe VMs need the match returned to produce the correct offest. - return match; - }); - source += "';\n"; - - // If a variable is not specified, place data values in local scope. - if (!settings.variable) source = 'with(obj||{}){\n' + source + '}\n'; - - source = "var __t,__p='',__j=Array.prototype.join," + - "print=function(){__p+=__j.call(arguments,'');};\n" + - source + 'return __p;\n'; - - try { - var render = new Function(settings.variable || 'obj', '_', source); - } catch (e) { - e.source = source; - throw e; - } - - var template = function(data) { - return render.call(this, data, _); - }; - - // Provide the compiled source as a convenience for precompilation. - var argument = settings.variable || 'obj'; - template.source = 'function(' + argument + '){\n' + source + '}'; - - return template; - }; - - // Add a "chain" function. Start chaining a wrapped Underscore object. - _.chain = function(obj) { - var instance = _(obj); - instance._chain = true; - return instance; - }; - - // OOP - // --------------- - // If Underscore is called as a function, it returns a wrapped object that - // can be used OO-style. This wrapper holds altered versions of all the - // underscore functions. Wrapped objects may be chained. - - // Helper function to continue chaining intermediate results. - var result = function(obj) { - return this._chain ? _(obj).chain() : obj; - }; - - // Add your own custom functions to the Underscore object. - _.mixin = function(obj) { - _.each(_.functions(obj), function(name) { - var func = _[name] = obj[name]; - _.prototype[name] = function() { - var args = [this._wrapped]; - push.apply(args, arguments); - return result.call(this, func.apply(_, args)); - }; - }); - }; - - // Add all of the Underscore functions to the wrapper object. - _.mixin(_); - - // Add all mutator Array functions to the wrapper. - _.each(['pop', 'push', 'reverse', 'shift', 'sort', 'splice', 'unshift'], function(name) { - var method = ArrayProto[name]; - _.prototype[name] = function() { - var obj = this._wrapped; - method.apply(obj, arguments); - if ((name === 'shift' || name === 'splice') && obj.length === 0) delete obj[0]; - return result.call(this, obj); - }; - }); - - // Add all accessor Array functions to the wrapper. - _.each(['concat', 'join', 'slice'], function(name) { - var method = ArrayProto[name]; - _.prototype[name] = function() { - return result.call(this, method.apply(this._wrapped, arguments)); - }; - }); - - // Extracts the result from a wrapped and chained object. - _.prototype.value = function() { - return this._wrapped; - }; - - // AMD registration happens at the end for compatibility with AMD loaders - // that may not enforce next-turn semantics on modules. Even though general - // practice for AMD registration is to be anonymous, underscore registers - // as a named module because, like jQuery, it is a base library that is - // popular enough to be bundled in a third party lib, but not be part of - // an AMD load request. Those cases could generate an error when an - // anonymous define() is called outside of a loader request. - if (typeof define === 'function' && define.amd) { - define('underscore', [], function() { - return _; - }); - } -}.call(this)); +// Underscore.js 1.3.1 +// (c) 2009-2012 Jeremy Ashkenas, DocumentCloud Inc. +// Underscore is freely distributable under the MIT license. +// Portions of Underscore are inspired or borrowed from Prototype, +// Oliver Steele's Functional, and John Resig's Micro-Templating. +// For all details and documentation: +// http://documentcloud.github.com/underscore +(function(){function q(a,c,d){if(a===c)return a!==0||1/a==1/c;if(a==null||c==null)return a===c;if(a._chain)a=a._wrapped;if(c._chain)c=c._wrapped;if(a.isEqual&&b.isFunction(a.isEqual))return a.isEqual(c);if(c.isEqual&&b.isFunction(c.isEqual))return c.isEqual(a);var e=l.call(a);if(e!=l.call(c))return false;switch(e){case "[object String]":return a==String(c);case "[object Number]":return a!=+a?c!=+c:a==0?1/a==1/c:a==+c;case "[object Date]":case "[object Boolean]":return+a==+c;case "[object RegExp]":return a.source== +c.source&&a.global==c.global&&a.multiline==c.multiline&&a.ignoreCase==c.ignoreCase}if(typeof a!="object"||typeof c!="object")return false;for(var f=d.length;f--;)if(d[f]==a)return true;d.push(a);var f=0,g=true;if(e=="[object Array]"){if(f=a.length,g=f==c.length)for(;f--;)if(!(g=f in a==f in c&&q(a[f],c[f],d)))break}else{if("constructor"in a!="constructor"in c||a.constructor!=c.constructor)return false;for(var h in a)if(b.has(a,h)&&(f++,!(g=b.has(c,h)&&q(a[h],c[h],d))))break;if(g){for(h in c)if(b.has(c, +h)&&!f--)break;g=!f}}d.pop();return g}var r=this,G=r._,n={},k=Array.prototype,o=Object.prototype,i=k.slice,H=k.unshift,l=o.toString,I=o.hasOwnProperty,w=k.forEach,x=k.map,y=k.reduce,z=k.reduceRight,A=k.filter,B=k.every,C=k.some,p=k.indexOf,D=k.lastIndexOf,o=Array.isArray,J=Object.keys,s=Function.prototype.bind,b=function(a){return new m(a)};if(typeof exports!=="undefined"){if(typeof module!=="undefined"&&module.exports)exports=module.exports=b;exports._=b}else r._=b;b.VERSION="1.3.1";var j=b.each= +b.forEach=function(a,c,d){if(a!=null)if(w&&a.forEach===w)a.forEach(c,d);else if(a.length===+a.length)for(var e=0,f=a.length;e<f;e++){if(e in a&&c.call(d,a[e],e,a)===n)break}else for(e in a)if(b.has(a,e)&&c.call(d,a[e],e,a)===n)break};b.map=b.collect=function(a,c,b){var e=[];if(a==null)return e;if(x&&a.map===x)return a.map(c,b);j(a,function(a,g,h){e[e.length]=c.call(b,a,g,h)});if(a.length===+a.length)e.length=a.length;return e};b.reduce=b.foldl=b.inject=function(a,c,d,e){var f=arguments.length>2;a== +null&&(a=[]);if(y&&a.reduce===y)return e&&(c=b.bind(c,e)),f?a.reduce(c,d):a.reduce(c);j(a,function(a,b,i){f?d=c.call(e,d,a,b,i):(d=a,f=true)});if(!f)throw new TypeError("Reduce of empty array with no initial value");return d};b.reduceRight=b.foldr=function(a,c,d,e){var f=arguments.length>2;a==null&&(a=[]);if(z&&a.reduceRight===z)return e&&(c=b.bind(c,e)),f?a.reduceRight(c,d):a.reduceRight(c);var g=b.toArray(a).reverse();e&&!f&&(c=b.bind(c,e));return f?b.reduce(g,c,d,e):b.reduce(g,c)};b.find=b.detect= +function(a,c,b){var e;E(a,function(a,g,h){if(c.call(b,a,g,h))return e=a,true});return e};b.filter=b.select=function(a,c,b){var e=[];if(a==null)return e;if(A&&a.filter===A)return a.filter(c,b);j(a,function(a,g,h){c.call(b,a,g,h)&&(e[e.length]=a)});return e};b.reject=function(a,c,b){var e=[];if(a==null)return e;j(a,function(a,g,h){c.call(b,a,g,h)||(e[e.length]=a)});return e};b.every=b.all=function(a,c,b){var e=true;if(a==null)return e;if(B&&a.every===B)return a.every(c,b);j(a,function(a,g,h){if(!(e= +e&&c.call(b,a,g,h)))return n});return e};var E=b.some=b.any=function(a,c,d){c||(c=b.identity);var e=false;if(a==null)return e;if(C&&a.some===C)return a.some(c,d);j(a,function(a,b,h){if(e||(e=c.call(d,a,b,h)))return n});return!!e};b.include=b.contains=function(a,c){var b=false;if(a==null)return b;return p&&a.indexOf===p?a.indexOf(c)!=-1:b=E(a,function(a){return a===c})};b.invoke=function(a,c){var d=i.call(arguments,2);return b.map(a,function(a){return(b.isFunction(c)?c||a:a[c]).apply(a,d)})};b.pluck= +function(a,c){return b.map(a,function(a){return a[c]})};b.max=function(a,c,d){if(!c&&b.isArray(a))return Math.max.apply(Math,a);if(!c&&b.isEmpty(a))return-Infinity;var e={computed:-Infinity};j(a,function(a,b,h){b=c?c.call(d,a,b,h):a;b>=e.computed&&(e={value:a,computed:b})});return e.value};b.min=function(a,c,d){if(!c&&b.isArray(a))return Math.min.apply(Math,a);if(!c&&b.isEmpty(a))return Infinity;var e={computed:Infinity};j(a,function(a,b,h){b=c?c.call(d,a,b,h):a;b<e.computed&&(e={value:a,computed:b})}); +return e.value};b.shuffle=function(a){var b=[],d;j(a,function(a,f){f==0?b[0]=a:(d=Math.floor(Math.random()*(f+1)),b[f]=b[d],b[d]=a)});return b};b.sortBy=function(a,c,d){return b.pluck(b.map(a,function(a,b,g){return{value:a,criteria:c.call(d,a,b,g)}}).sort(function(a,b){var c=a.criteria,d=b.criteria;return c<d?-1:c>d?1:0}),"value")};b.groupBy=function(a,c){var d={},e=b.isFunction(c)?c:function(a){return a[c]};j(a,function(a,b){var c=e(a,b);(d[c]||(d[c]=[])).push(a)});return d};b.sortedIndex=function(a, +c,d){d||(d=b.identity);for(var e=0,f=a.length;e<f;){var g=e+f>>1;d(a[g])<d(c)?e=g+1:f=g}return e};b.toArray=function(a){return!a?[]:a.toArray?a.toArray():b.isArray(a)?i.call(a):b.isArguments(a)?i.call(a):b.values(a)};b.size=function(a){return b.toArray(a).length};b.first=b.head=function(a,b,d){return b!=null&&!d?i.call(a,0,b):a[0]};b.initial=function(a,b,d){return i.call(a,0,a.length-(b==null||d?1:b))};b.last=function(a,b,d){return b!=null&&!d?i.call(a,Math.max(a.length-b,0)):a[a.length-1]};b.rest= +b.tail=function(a,b,d){return i.call(a,b==null||d?1:b)};b.compact=function(a){return b.filter(a,function(a){return!!a})};b.flatten=function(a,c){return b.reduce(a,function(a,e){if(b.isArray(e))return a.concat(c?e:b.flatten(e));a[a.length]=e;return a},[])};b.without=function(a){return b.difference(a,i.call(arguments,1))};b.uniq=b.unique=function(a,c,d){var d=d?b.map(a,d):a,e=[];b.reduce(d,function(d,g,h){if(0==h||(c===true?b.last(d)!=g:!b.include(d,g)))d[d.length]=g,e[e.length]=a[h];return d},[]); +return e};b.union=function(){return b.uniq(b.flatten(arguments,true))};b.intersection=b.intersect=function(a){var c=i.call(arguments,1);return b.filter(b.uniq(a),function(a){return b.every(c,function(c){return b.indexOf(c,a)>=0})})};b.difference=function(a){var c=b.flatten(i.call(arguments,1));return b.filter(a,function(a){return!b.include(c,a)})};b.zip=function(){for(var a=i.call(arguments),c=b.max(b.pluck(a,"length")),d=Array(c),e=0;e<c;e++)d[e]=b.pluck(a,""+e);return d};b.indexOf=function(a,c, +d){if(a==null)return-1;var e;if(d)return d=b.sortedIndex(a,c),a[d]===c?d:-1;if(p&&a.indexOf===p)return a.indexOf(c);for(d=0,e=a.length;d<e;d++)if(d in a&&a[d]===c)return d;return-1};b.lastIndexOf=function(a,b){if(a==null)return-1;if(D&&a.lastIndexOf===D)return a.lastIndexOf(b);for(var d=a.length;d--;)if(d in a&&a[d]===b)return d;return-1};b.range=function(a,b,d){arguments.length<=1&&(b=a||0,a=0);for(var d=arguments[2]||1,e=Math.max(Math.ceil((b-a)/d),0),f=0,g=Array(e);f<e;)g[f++]=a,a+=d;return g}; +var F=function(){};b.bind=function(a,c){var d,e;if(a.bind===s&&s)return s.apply(a,i.call(arguments,1));if(!b.isFunction(a))throw new TypeError;e=i.call(arguments,2);return d=function(){if(!(this instanceof d))return a.apply(c,e.concat(i.call(arguments)));F.prototype=a.prototype;var b=new F,g=a.apply(b,e.concat(i.call(arguments)));return Object(g)===g?g:b}};b.bindAll=function(a){var c=i.call(arguments,1);c.length==0&&(c=b.functions(a));j(c,function(c){a[c]=b.bind(a[c],a)});return a};b.memoize=function(a, +c){var d={};c||(c=b.identity);return function(){var e=c.apply(this,arguments);return b.has(d,e)?d[e]:d[e]=a.apply(this,arguments)}};b.delay=function(a,b){var d=i.call(arguments,2);return setTimeout(function(){return a.apply(a,d)},b)};b.defer=function(a){return b.delay.apply(b,[a,1].concat(i.call(arguments,1)))};b.throttle=function(a,c){var d,e,f,g,h,i=b.debounce(function(){h=g=false},c);return function(){d=this;e=arguments;var b;f||(f=setTimeout(function(){f=null;h&&a.apply(d,e);i()},c));g?h=true: +a.apply(d,e);i();g=true}};b.debounce=function(a,b){var d;return function(){var e=this,f=arguments;clearTimeout(d);d=setTimeout(function(){d=null;a.apply(e,f)},b)}};b.once=function(a){var b=false,d;return function(){if(b)return d;b=true;return d=a.apply(this,arguments)}};b.wrap=function(a,b){return function(){var d=[a].concat(i.call(arguments,0));return b.apply(this,d)}};b.compose=function(){var a=arguments;return function(){for(var b=arguments,d=a.length-1;d>=0;d--)b=[a[d].apply(this,b)];return b[0]}}; +b.after=function(a,b){return a<=0?b():function(){if(--a<1)return b.apply(this,arguments)}};b.keys=J||function(a){if(a!==Object(a))throw new TypeError("Invalid object");var c=[],d;for(d in a)b.has(a,d)&&(c[c.length]=d);return c};b.values=function(a){return b.map(a,b.identity)};b.functions=b.methods=function(a){var c=[],d;for(d in a)b.isFunction(a[d])&&c.push(d);return c.sort()};b.extend=function(a){j(i.call(arguments,1),function(b){for(var d in b)a[d]=b[d]});return a};b.defaults=function(a){j(i.call(arguments, +1),function(b){for(var d in b)a[d]==null&&(a[d]=b[d])});return a};b.clone=function(a){return!b.isObject(a)?a:b.isArray(a)?a.slice():b.extend({},a)};b.tap=function(a,b){b(a);return a};b.isEqual=function(a,b){return q(a,b,[])};b.isEmpty=function(a){if(b.isArray(a)||b.isString(a))return a.length===0;for(var c in a)if(b.has(a,c))return false;return true};b.isElement=function(a){return!!(a&&a.nodeType==1)};b.isArray=o||function(a){return l.call(a)=="[object Array]"};b.isObject=function(a){return a===Object(a)}; +b.isArguments=function(a){return l.call(a)=="[object Arguments]"};if(!b.isArguments(arguments))b.isArguments=function(a){return!(!a||!b.has(a,"callee"))};b.isFunction=function(a){return l.call(a)=="[object Function]"};b.isString=function(a){return l.call(a)=="[object String]"};b.isNumber=function(a){return l.call(a)=="[object Number]"};b.isNaN=function(a){return a!==a};b.isBoolean=function(a){return a===true||a===false||l.call(a)=="[object Boolean]"};b.isDate=function(a){return l.call(a)=="[object Date]"}; +b.isRegExp=function(a){return l.call(a)=="[object RegExp]"};b.isNull=function(a){return a===null};b.isUndefined=function(a){return a===void 0};b.has=function(a,b){return I.call(a,b)};b.noConflict=function(){r._=G;return this};b.identity=function(a){return a};b.times=function(a,b,d){for(var e=0;e<a;e++)b.call(d,e)};b.escape=function(a){return(""+a).replace(/&/g,"&").replace(/</g,"<").replace(/>/g,">").replace(/"/g,""").replace(/'/g,"'").replace(/\//g,"/")};b.mixin=function(a){j(b.functions(a), +function(c){K(c,b[c]=a[c])})};var L=0;b.uniqueId=function(a){var b=L++;return a?a+b:b};b.templateSettings={evaluate:/<%([\s\S]+?)%>/g,interpolate:/<%=([\s\S]+?)%>/g,escape:/<%-([\s\S]+?)%>/g};var t=/.^/,u=function(a){return a.replace(/\\\\/g,"\\").replace(/\\'/g,"'")};b.template=function(a,c){var d=b.templateSettings,d="var __p=[],print=function(){__p.push.apply(__p,arguments);};with(obj||{}){__p.push('"+a.replace(/\\/g,"\\\\").replace(/'/g,"\\'").replace(d.escape||t,function(a,b){return"',_.escape("+ +u(b)+"),'"}).replace(d.interpolate||t,function(a,b){return"',"+u(b)+",'"}).replace(d.evaluate||t,function(a,b){return"');"+u(b).replace(/[\r\n\t]/g," ")+";__p.push('"}).replace(/\r/g,"\\r").replace(/\n/g,"\\n").replace(/\t/g,"\\t")+"');}return __p.join('');",e=new Function("obj","_",d);return c?e(c,b):function(a){return e.call(this,a,b)}};b.chain=function(a){return b(a).chain()};var m=function(a){this._wrapped=a};b.prototype=m.prototype;var v=function(a,c){return c?b(a).chain():a},K=function(a,c){m.prototype[a]= +function(){var a=i.call(arguments);H.call(a,this._wrapped);return v(c.apply(b,a),this._chain)}};b.mixin(b);j("pop,push,reverse,shift,sort,splice,unshift".split(","),function(a){var b=k[a];m.prototype[a]=function(){var d=this._wrapped;b.apply(d,arguments);var e=d.length;(a=="shift"||a=="splice")&&e===0&&delete d[0];return v(d,this._chain)}});j(["concat","join","slice"],function(a){var b=k[a];m.prototype[a]=function(){return v(b.apply(this._wrapped,arguments),this._chain)}});m.prototype.chain=function(){this._chain= +true;return this};m.prototype.value=function(){return this._wrapped}}).call(this); diff --git a/doc/html/_static/websupport.js b/doc/html/_static/websupport.js index ffd9b2bf..98e7f40b 100644 --- a/doc/html/_static/websupport.js +++ b/doc/html/_static/websupport.js @@ -2,7 +2,7 @@ * websupport.js * ~~~~~~~~~~~~~ * - * sphinx.websupport utilties for all documentation. + * sphinx.websupport utilities for all documentation. * * :copyright: Copyright 2007-2016 by the Sphinx team, see AUTHORS. * :license: BSD, see LICENSE for details. diff --git a/doc/html/actions/index.html b/doc/html/actions/index.html index e7468692..84c071d6 100644 --- a/doc/html/actions/index.html +++ b/doc/html/actions/index.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>ProMod3 Actions — ProMod3 1.2.0 documentation</title> + <title>ProMod3 Actions — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="Documentation For Users" href="../users.html" /> <link rel="next" title="Building ProMod3" href="../buildsystem.html" /> <link rel="prev" title="Getting Started" href="../gettingstarted.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -50,12 +52,12 @@ you can type <code class="docutils literal"><span class="pre">pm</span> <span cl <span id="promod-build-model"></span><h2>Building models<a class="headerlink" href="#building-models" title="Permalink to this headline">¶</a></h2> <p>You can run a full protein homology modelling pipeline from the command line with</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> pm build-model <span class="o">[</span>-h<span class="o">]</span> <span class="o">(</span>-f <FILE> <span class="p">|</span> -c <FILE> <span class="p">|</span> -j <OBJECT><span class="p">|</span><FILE><span class="o">)</span> +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> pm build-model <span class="o">[</span>-h<span class="o">]</span> <span class="o">(</span>-f <FILE> <span class="p">|</span> -c <FILE> <span class="p">|</span> -j <OBJECT><span class="p">|</span><FILE><span class="o">)</span> <span class="go"> (-p <FILE> | -e <FILE>) [-s <FILE>] [-o <FILENAME>]</span> </pre></div> </div> <p>Example usage:</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> pm build-model -f aln.fasta -p tpl.pdb +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> pm build-model -f aln.fasta -p tpl.pdb </pre></div> </div> <p>This reads a target-template alignment from <code class="file docutils literal"><span class="pre">aln.fasta</span></code> and a matching @@ -72,7 +74,7 @@ Notes on the input formats:</p> <li><p class="first">Leading/trailing whitespaces of sequence names will always be deleted</p> </li> <li><p class="first">FASTA input example:</p> -<div class="highlight-none"><div class="highlight"><pre>>target +<div class="highlight-none"><div class="highlight"><pre><span></span>>target HGFHVHEFGDNTNGCMSSGPHFNPYGKEHGAPVDENRHLG >2jlp-1.A|55 RAIHVHQFGDLSQGCESTGPHYNPLAVPH------PQHPG @@ -93,7 +95,7 @@ Those in turn are objects with keys ‘seqres’ (string for aligned sequence) and optionally for templates ‘offset’ (number of residues to skip in structure file attached to it). Example:</p> -<div class="highlight-json"><div class="highlight"><pre><span class="p">{</span><span class="nt">"alignmentlist"</span><span class="p">:</span> <span class="p">[</span> <span class="p">{</span> +<div class="highlight-json"><div class="highlight"><pre><span></span><span class="p">{</span><span class="nt">"alignmentlist"</span><span class="p">:</span> <span class="p">[</span> <span class="p">{</span> <span class="nt">"target"</span><span class="p">:</span> <span class="p">{</span> <span class="nt">"name"</span><span class="p">:</span> <span class="s2">"mytrg"</span><span class="p">,</span> <span class="nt">"seqres"</span><span class="p">:</span> <span class="s2">"HGFHVHEFGDNTNGCMSSGPHFNPYGKEHGAPVDENRHLG"</span> @@ -147,7 +149,7 @@ i.e. one profile is mapped to several chains in case of homo-oligomers</li> target sequences</li> </ul> <p>Example usage:</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> pm build-model -f aln.fasta -p tpl.pdb -s prof.hhm +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> pm build-model -f aln.fasta -p tpl.pdb -s prof.hhm </pre></div> </div> <p>Possible exit codes of the action:</p> @@ -164,12 +166,12 @@ target sequences</li> <div class="section" id="sidechain-modelling"> <h2>Sidechain Modelling<a class="headerlink" href="#sidechain-modelling" title="Permalink to this headline">¶</a></h2> <p>You can (re-)construct the sidechains in a model from the command line.</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> usage: build-sidechains <span class="o">[</span>-h<span class="o">]</span> <span class="o">(</span>-p <FILE> <span class="p">|</span> -e <FILE><span class="o">)</span> <span class="o">[</span>-o <FILENAME><span class="o">]</span> <span class="o">[</span>-k<span class="o">]</span> <span class="o">[</span>-n<span class="o">]</span> +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> usage: build-sidechains <span class="o">[</span>-h<span class="o">]</span> <span class="o">(</span>-p <FILE> <span class="p">|</span> -e <FILE><span class="o">)</span> <span class="o">[</span>-o <FILENAME><span class="o">]</span> <span class="o">[</span>-k<span class="o">]</span> <span class="o">[</span>-n<span class="o">]</span> <span class="go"> [-r] [-i] [-s]</span> </pre></div> </div> <p>Example usage:</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> pm build-sidechains -p input.pdb +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> pm build-sidechains -p input.pdb </pre></div> </div> <p>This reads a structure stored in in.pdb, strips all sidechains, @@ -256,9 +258,6 @@ dependent one (from <a class="reference internal" href="../sidechain/loading.htm <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -269,8 +268,8 @@ dependent one (from <a class="reference internal" href="../sidechain/loading.htm ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/actions/index.txt" diff --git a/doc/html/actions/index_dev.html b/doc/html/actions/index_dev.html index cc45e891..a0e99aa9 100644 --- a/doc/html/actions/index_dev.html +++ b/doc/html/actions/index_dev.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>test_actions - Testing Actions — ProMod3 1.2.0 documentation</title> + <title>test_actions - Testing Actions — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="Documentation For Developers" href="../developers.html" /> <link rel="next" title="ProMod3‘s Share Of CMake" href="../cmake/index.html" /> <link rel="prev" title="Contributing" href="../contributing.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -63,15 +65,15 @@ Python imports a module, its usually compiled into bytecode. This new file would clutter up the source repository, it would always show up as untracked file on <code class="docutils literal"><span class="pre">git</span> <span class="pre">status</span></code>. To prevent this, tell Python to stop producing bytecode right at the beginning of your test-script:</p> -<div class="highlight-python"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>1 +<div class="highlight-default"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>1 2 3 4 -5</pre></div></td><td class="code"><div class="highlight"><pre><span class="kn">import</span> <span class="nn">sys</span> +5</pre></div></td><td class="code"><div class="highlight"><pre><span></span><span class="kn">import</span> <span class="nn">sys</span> <span class="c1"># this is needed so there will be no test_actions.pyc created in the source</span> <span class="c1"># directory</span> -<span class="hll"><span class="n">sys</span><span class="o">.</span><span class="n">dont_write_bytecode</span> <span class="o">=</span> <span class="bp">True</span> +<span class="hll"><span class="n">sys</span><span class="o">.</span><span class="n">dont_write_bytecode</span> <span class="o">=</span> <span class="kc">True</span> </span></pre></div> </td></tr></table></div> <p>Line 5 does the trick. This needs to be set by you in every action unit test @@ -102,20 +104,20 @@ called <code class="docutils literal"><span class="pre">do-awesome</span></code> action. So here we create a file <code class="file docutils literal"><span class="pre">test_action_do_awesome.py</span></code> (recognise the underscore between <code class="docutils literal"><span class="pre">do</span></code> and <code class="docutils literal"><span class="pre">awesome</span></code> instead of a hyphen, that’s <a class="reference external" href="https://www.python.org/dev/peps/pep-0008/">PEP 8</a>).</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> touch <SOURCE>/actions/tests/test_action_do_awesome.py +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> touch <SOURCE>/actions/tests/test_action_do_awesome.py <span class="gp">$</span> </pre></div> </div> <p>As a starter, we disable bytecode compilation in the script:</p> -<div class="highlight-python"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>1 +<div class="highlight-default"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>1 2 3 4 -5</pre></div></td><td class="code"><div class="highlight"><pre><span class="kn">import</span> <span class="nn">sys</span> +5</pre></div></td><td class="code"><div class="highlight"><pre><span></span><span class="kn">import</span> <span class="nn">sys</span> <span class="c1"># this is needed so there will be no test_actions.pyc created in the source</span> <span class="c1"># directory</span> -<span class="n">sys</span><span class="o">.</span><span class="n">dont_write_bytecode</span> <span class="o">=</span> <span class="bp">True</span> +<span class="n">sys</span><span class="o">.</span><span class="n">dont_write_bytecode</span> <span class="o">=</span> <span class="kc">True</span> </pre></div> </td></tr></table></div> </div> @@ -131,7 +133,7 @@ add your new script:</p> 4 5 6 -7</pre></div></td><td class="code"><div class="highlight"><pre><span class="nb">set</span><span class="p">(</span><span class="s">ACTION_UNIT_TESTS</span> +7</pre></div></td><td class="code"><div class="highlight"><pre><span></span><span class="nb">set</span><span class="p">(</span><span class="s">ACTION_UNIT_TESTS</span> <span class="s">test_action_help.py</span> <span class="hll"> <span class="s">test_action_do_awesome.py</span> </span> <span class="s">test_actions.py</span> <span class="c"># leave this as last item so it will be executed first!</span> @@ -153,17 +155,17 @@ other action test script is run.</p> tests. By spawning off from this you inherit a bunch of useful methods for your testing. To make it work, the childclass needs to be set up properly. But first, <code class="file docutils literal"><span class="pre">test_actions.py</span></code> has to be loaded as a module:</p> -<div class="highlight-python"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>6</pre></div></td><td class="code"><div class="highlight"><pre><span class="kn">import</span> <span class="nn">test_actions</span> +<div class="highlight-default"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>6</pre></div></td><td class="code"><div class="highlight"><pre><span></span><span class="kn">import</span> <span class="nn">test_actions</span> </pre></div> </td></tr></table></div> <p>To showcase, the test cases, we explain how one would (and does) test the <code class="docutils literal"><span class="pre">help</span></code> action of <code class="docutils literal"><span class="pre">pm</span></code>. First, we create the childclass for the action. Go for <code class="xref py py-class docutils literal"><span class="pre"><NAME>ActionTests</span></code> as a naming scheme:</p> -<div class="highlight-python"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre> 7 +<div class="highlight-default"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre> 7 8 9 -10</pre></div></td><td class="code"><div class="highlight"><pre><span class="k">class</span> <span class="nc">HelpActionTests</span><span class="p">(</span><span class="n">test_actions</span><span class="o">.</span><span class="n">ActionTestCase</span><span class="p">):</span> +10</pre></div></td><td class="code"><div class="highlight"><pre><span></span><span class="k">class</span> <span class="nc">HelpActionTests</span><span class="p">(</span><span class="n">test_actions</span><span class="o">.</span><span class="n">ActionTestCase</span><span class="p">):</span> <span class="k">def</span> <span class="nf">__init__</span><span class="p">(</span><span class="bp">self</span><span class="p">,</span> <span class="o">*</span><span class="n">args</span><span class="p">,</span> <span class="o">**</span><span class="n">kwargs</span><span class="p">):</span> <span class="n">test_actions</span><span class="o">.</span><span class="n">ActionTestCase</span><span class="o">.</span><span class="n">__init__</span><span class="p">(</span><span class="bp">self</span><span class="p">,</span> <span class="o">*</span><span class="n">args</span><span class="p">,</span> <span class="o">**</span><span class="n">kwargs</span><span class="p">)</span> <span class="bp">self</span><span class="o">.</span><span class="n">pm_action</span> <span class="o">=</span> <span class="s1">'help'</span> @@ -179,8 +181,8 @@ is derived from the <a class="reference external" href="https://docs.python.org/ states will be placed in the userlevel documentation. This topic is already covered in <a class="reference internal" href="#test_actions.ActionTestCase" title="test_actions.ActionTestCase"><code class="xref py py-class docutils literal"><span class="pre">test_actions.ActionTestCase</span></code></a> by <a class="reference internal" href="#test_actions.ActionTestCase.RunExitStatusTest" title="test_actions.ActionTestCase.RunExitStatusTest"><code class="xref py py-meth docutils literal"><span class="pre">RunExitStatusTest()</span></code></a>. As an example, testing for <code class="docutils literal"><span class="pre">$?=0</span></code> could work like this:</p> -<div class="highlight-python"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>11 -12</pre></div></td><td class="code"><div class="highlight"><pre> <span class="k">def</span> <span class="nf">testExit0</span><span class="p">(</span><span class="bp">self</span><span class="p">):</span> +<div class="highlight-default"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>11 +12</pre></div></td><td class="code"><div class="highlight"><pre><span></span> <span class="k">def</span> <span class="nf">testExit0</span><span class="p">(</span><span class="bp">self</span><span class="p">):</span> <span class="bp">self</span><span class="o">.</span><span class="n">RunExitStatusTest</span><span class="p">(</span><span class="mi">0</span><span class="p">,</span> <span class="nb">list</span><span class="p">())</span> </pre></div> </td></tr></table></div> @@ -195,10 +197,10 @@ happens if a user throws dirty input data in.</p> <p>In ProMod3, unit tests are run via <a class="reference external" href="https://www.OpenStructure.org">OST</a>‘s <a class="reference external" href="https://www.openstructure.org/docs/dev/base/testutils/#module-ost.testutils" title="(in OpenStructure v1.8.0)"><code class="xref py py-mod docutils literal"><span class="pre">ost.testutils</span></code></a> and Python‘s <a class="reference external" href="https://docs.python.org/2.7/library/unittest.html#unittest.TestCase" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">unittest.TestCase</span></code></a>. Those are called when the test module is executed as a script:</p> -<div class="highlight-python"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>13 +<div class="highlight-default"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>13 14 -15</pre></div></td><td class="code"><div class="highlight"><pre><span class="k">if</span> <span class="n">__name__</span> <span class="o">==</span> <span class="s2">"__main__"</span><span class="p">:</span> - <span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">testutils</span> +15</pre></div></td><td class="code"><div class="highlight"><pre><span></span><span class="k">if</span> <span class="n">__name__</span> <span class="o">==</span> <span class="s2">"__main__"</span><span class="p">:</span> + <span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">testutils</span> <span class="n">testutils</span><span class="o">.</span><span class="n">RunTests</span><span class="p">()</span> </pre></div> </td></tr></table></div> @@ -209,7 +211,7 @@ as a script:</p> <p>Unit tests are executed via <code class="docutils literal"><span class="pre">make</span> <span class="pre">check</span></code> and so are ProMod3 action tests. But for every test script, we also provide a private <code class="docutils literal"><span class="pre">make</span></code> target, ending with <code class="file docutils literal"><span class="pre">_run</span></code>. To solely run the tests for the awesome action, hit</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> make test_action_do_awesome.py_run +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> make test_action_do_awesome.py_run </pre></div> </div> </div> @@ -226,20 +228,20 @@ parameter <code class="xref py py-attr docutils literal"><span class="pre">verbo output onto the command line. The idea is to turn it on for development, but once done, disable it to keep output of unit tests low.</p> <p>To get the test for exit code <code class="docutils literal"><span class="pre">0</span></code> talking to you, just do</p> -<div class="highlight-python"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>11 -12</pre></div></td><td class="code"><div class="highlight"><pre> <span class="k">def</span> <span class="nf">testExit0</span><span class="p">(</span><span class="bp">self</span><span class="p">):</span> - <span class="bp">self</span><span class="o">.</span><span class="n">RunExitStatusTest</span><span class="p">(</span><span class="mi">0</span><span class="p">,</span> <span class="nb">list</span><span class="p">(),</span> <span class="n">verbose</span><span class="o">=</span><span class="bp">True</span><span class="p">)</span> +<div class="highlight-default"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>11 +12</pre></div></td><td class="code"><div class="highlight"><pre><span></span> <span class="k">def</span> <span class="nf">testExit0</span><span class="p">(</span><span class="bp">self</span><span class="p">):</span> + <span class="bp">self</span><span class="o">.</span><span class="n">RunExitStatusTest</span><span class="p">(</span><span class="mi">0</span><span class="p">,</span> <span class="nb">list</span><span class="p">(),</span> <span class="n">verbose</span><span class="o">=</span><span class="kc">True</span><span class="p">)</span> </pre></div> </td></tr></table></div> <p>and</p> -<div class="highlight-python"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>11 -12</pre></div></td><td class="code"><div class="highlight"><pre> <span class="k">def</span> <span class="nf">testExit0</span><span class="p">(</span><span class="bp">self</span><span class="p">):</span> +<div class="highlight-default"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>11 +12</pre></div></td><td class="code"><div class="highlight"><pre><span></span> <span class="k">def</span> <span class="nf">testExit0</span><span class="p">(</span><span class="bp">self</span><span class="p">):</span> <span class="bp">self</span><span class="o">.</span><span class="n">RunExitStatusTest</span><span class="p">(</span><span class="mi">0</span><span class="p">,</span> <span class="nb">list</span><span class="p">())</span> </pre></div> </td></tr></table></div> <p>keeps it silent (<code class="xref py py-attr docutils literal"><span class="pre">verbose</span></code> is set to <code class="docutils literal"><span class="pre">False</span></code> by default). If enabled, output will be separated into <code class="file docutils literal"><span class="pre">stdout</span></code> and <code class="file docutils literal"><span class="pre">stderr</span></code>:</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> make test_action_do_awesome.py_run +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> make test_action_do_awesome.py_run <span class="go"><Lots of output from the build process></span> <span class="go">running checks test_action_do_awesome.py</span> <span class="go">stdout of '<BUILD>/stage/bin/pm do-awesome'</span> @@ -402,9 +404,6 @@ file (also complains if a directory is found instead).</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -415,8 +414,8 @@ file (also complains if a directory is found instead).</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/actions/index_dev.txt" diff --git a/doc/html/buildsystem.html b/doc/html/buildsystem.html index 5f862a43..98547d3d 100644 --- a/doc/html/buildsystem.html +++ b/doc/html/buildsystem.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Building ProMod3 — ProMod3 1.2.0 documentation</title> + <title>Building ProMod3 — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: './', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="_static/underscore.js"></script> <script type="text/javascript" src="_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="index.html" /> <link rel="up" title="Documentation For Users" href="users.html" /> <link rel="next" title="ProMod3 and Containers" href="container/index.html" /> <link rel="prev" title="ProMod3 Actions" href="actions/index.html" /> + <link rel="stylesheet" href="_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -44,16 +46,14 @@ <span id="building-promod"></span><h1>Building ProMod3<a class="headerlink" href="#building-project" title="Permalink to this headline">¶</a></h1> <div class="section" id="dependencies"> <h2>Dependencies<a class="headerlink" href="#dependencies" title="Permalink to this headline">¶</a></h2> -<p>ProMod3 is build on top of <a class="reference external" href="https://www.OpenStructure.org">OpenStructure</a> (OST), requiring at least version -1.7. OST must be configured and compiled with <code class="docutils literal"><span class="pre">ENABLE_MM=1</span></code> to use <a class="reference external" href="http://openmm.org">OpenMM</a>. -To create the build system, <a class="reference external" href="https://cmake.org/">CMake</a> is required in version -2.8.7 or higher. <a class="reference external" href="https://www.python.org/">Python</a> works well from version 2.7. For OST and the -C++ bit of ProMod3, <a class="reference external" href="https://www.boost.org/">Boost</a> is required in version 1.53.0 (the same as -used for OST). Also <a class="reference external" href="http://eigen.tuxfamily.org/index.php?title=Main_Page">Eigen 3</a> is needed. To build -documentation, <a class="reference external" href="http://sphinx-doc.org/">Sphinx</a> 1.2b1 is required.</p> +<p>ProMod3 is build on top of <a class="reference external" href="https://www.OpenStructure.org">OpenStructure</a> (OST), requiring at least version 1.8. +OST must be configured and compiled with <code class="docutils literal"><span class="pre">ENABLE_MM=1</span></code> to use <a class="reference external" href="http://openmm.org">OpenMM</a>. +To create the build system, <a class="reference external" href="https://cmake.org/">CMake</a> is required. The same versions of <a class="reference external" href="https://www.python.org/">Python</a> +and <a class="reference external" href="https://www.boost.org/">Boost</a> are needed as used in OST. For <a class="reference external" href="http://eigen.tuxfamily.org/index.php?title=Main_Page">Eigen 3</a> we need at least +version 3.3.0. To build the documentation, <a class="reference external" href="http://sphinx-doc.org/">Sphinx</a> is required.</p> <p>The currently preferred versions are:</p> <ul class="simple"> -<li><a class="reference external" href="https://www.OpenStructure.org">OST</a> 1.7</li> +<li><a class="reference external" href="https://www.OpenStructure.org">OST</a> 1.9</li> <li><a class="reference external" href="http://openmm.org">OpenMM</a> 7.1.1</li> <li><a class="reference external" href="https://cmake.org/">CMake</a> 2.8.12</li> <li><a class="reference external" href="https://www.python.org/">Python</a> 2.7.5</li> @@ -69,7 +69,7 @@ and certain directories needed for building ProMod3. Basically it is called right from a shell with the directory containing the top-level <code class="file docutils literal"><span class="pre">CMakeLists.txt</span></code> as an argument. The preferred approach is to generate a build folder and configure and compile in there:</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">#</span> execute this in the ProMod3 root folder +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">#</span> execute this in the ProMod3 root folder <span class="gp">$</span> mkdir build <span class="gp">$</span> <span class="nb">cd</span> build <span class="gp">$</span> cmake .. -DOST_ROOT<span class="o">=</span><PATH TO OST> @@ -116,7 +116,7 @@ really got rebuild and similar things required.</p> <div class="section" id="running-make"> <h2>Running Make<a class="headerlink" href="#running-make" title="Permalink to this headline">¶</a></h2> <p>After configuring, you want to build ProMod3 by</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> make +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> make </pre></div> </div> <p>to populate the <code class="file docutils literal"><span class="pre">stage</span></code> directory with a ready-to-go version of the @@ -140,7 +140,7 @@ builder</li> <h2>Installing ProMod3<a class="headerlink" href="#installing-project" title="Permalink to this headline">¶</a></h2> <p>If you wish to install ProMod3 (note that you can also safely keep it all in the <code class="file docutils literal"><span class="pre">stage</span></code> directory), you can use</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> make install +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> make install </pre></div> </div> <p>By default, this will copy the <code class="file docutils literal"><span class="pre">stage</span></code> directory to <code class="file docutils literal"><span class="pre">/usr/local</span></code>. To @@ -196,9 +196,6 @@ safely delete the whole source folder.</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -209,8 +206,8 @@ safely delete the whole source folder.</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="_sources/buildsystem.txt" diff --git a/doc/html/changelog.html b/doc/html/changelog.html index ee3fe26e..460b1c77 100644 --- a/doc/html/changelog.html +++ b/doc/html/changelog.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Changelog — ProMod3 1.2.0 documentation</title> + <title>Changelog — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: './', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,14 +24,16 @@ <script type="text/javascript" src="_static/underscore.js"></script> <script type="text/javascript" src="_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="index.html" /> <link rel="prev" title="References" href="references.html" /> + <link rel="stylesheet" href="_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -160,9 +162,6 @@ selected loops, reconstruct hydrogens and minimize energy with MM</li> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -173,8 +172,8 @@ selected loops, reconstruct hydrogens and minimize energy with MM</li> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="_sources/changelog.txt" diff --git a/doc/html/cmake/index.html b/doc/html/cmake/index.html index 78c3e04b..a53376df 100644 --- a/doc/html/cmake/index.html +++ b/doc/html/cmake/index.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>ProMod3‘s Share Of CMake — ProMod3 1.2.0 documentation</title> + <title>ProMod3‘s Share Of CMake — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="Documentation For Developers" href="../developers.html" /> <link rel="next" title="Using Binary Files In ProMod3" href="../portableIO.html" /> <link rel="prev" title="test_actions - Testing Actions" href="../actions/index_dev.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -74,7 +76,7 @@ various <code class="file docutils literal"><span class="pre">CMakeLists.txt</sp <dl class="command"> <dt id="command:module"> <code class="descname">module</code><a class="headerlink" href="#command:module" title="Permalink to this definition">¶</a></dt> -<dd><div class="highlight-cmake"><div class="highlight"><pre><span class="nb">module</span><span class="p">(</span><span class="s">NAME</span> <span class="s">name</span> +<dd><div class="highlight-cmake"><div class="highlight"><pre><span></span><span class="nb">module</span><span class="p">(</span><span class="s">NAME</span> <span class="s">name</span> <span class="s">SOURCES</span> <span class="s">source1</span> <span class="s">source2</span> <span class="s">HEADERS</span> <span class="s">header1</span> <span class="s">header2</span> <span class="s">[IN_DIR</span> <span class="s">dir]</span> <span class="s">[header3</span> <span class="s">header4</span> <span class="s">[IN_DIR</span> <span class="s">dir]]</span> @@ -115,7 +117,7 @@ libraries here, such as <code class="docutils literal"><span class="pre">${OST_L <dl class="command"> <dt id="command:pymod"> <code class="descname">pymod</code><a class="headerlink" href="#command:pymod" title="Permalink to this definition">¶</a></dt> -<dd><div class="highlight-cmake"><div class="highlight"><pre><span class="nb">pymod</span><span class="p">(</span><span class="s">NAME</span> <span class="s">name</span> +<dd><div class="highlight-cmake"><div class="highlight"><pre><span></span><span class="nb">pymod</span><span class="p">(</span><span class="s">NAME</span> <span class="s">name</span> <span class="s">CPP</span> <span class="s">source1</span> <span class="s">source2</span> <span class="s">PY</span> <span class="s">source</span> <span class="s">source2</span> <span class="s">[IN_DIR</span> <span class="s">dir]</span> <span class="s">[source3</span> <span class="s">source4</span> <span class="s">[IN_DIR</span> <span class="s">dir]]</span> @@ -163,7 +165,7 @@ headers in the <code class="file docutils literal"><span class="pre">config</spa <dl class="command"> <dt id="command:convert_module_data"> <code class="descname">convert_module_data</code><a class="headerlink" href="#command:convert_module_data" title="Permalink to this definition">¶</a></dt> -<dd><div class="highlight-cmake"><div class="highlight"><pre><span class="nb">convert_module_data</span><span class="p">(</span><span class="s">MODULE</span> <span class="s">name</span> +<dd><div class="highlight-cmake"><div class="highlight"><pre><span></span><span class="nb">convert_module_data</span><span class="p">(</span><span class="s">MODULE</span> <span class="s">name</span> <span class="s">FILE</span> <span class="s">file</span> <span class="s">SCRIPT</span> <span class="s">script</span> <span class="s">[ARGS</span> <span class="s">args]</span><span class="p">)</span> @@ -185,7 +187,7 @@ If given, <code class="docutils literal"><span class="pre">args</span></code> ca <dl class="command"> <dt id="command:promod3_unittest"> <code class="descname">promod3_unittest</code><a class="headerlink" href="#command:promod3_unittest" title="Permalink to this definition">¶</a></dt> -<dd><div class="highlight-cmake"><div class="highlight"><pre><span class="nb">promod3_unittest</span><span class="p">(</span><span class="s">MODULE</span> <span class="s">name</span> +<dd><div class="highlight-cmake"><div class="highlight"><pre><span></span><span class="nb">promod3_unittest</span><span class="p">(</span><span class="s">MODULE</span> <span class="s">name</span> <span class="s">SOURCES</span> <span class="s">source1</span> <span class="s">[source2</span> <span class="s">...]</span> <span class="s">[LINK</span> <span class="s">library1/</span> <span class="s">linker</span> <span class="s">flag1</span> <span class="s">[library2/</span> <span class="s">linker</span> <span class="s">flag2</span> <span class="s">...]]</span> <span class="s">[DATA</span> <span class="s">data1</span> <span class="s">[data2</span> <span class="s">...]]</span> @@ -241,7 +243,7 @@ By default all unit tests are registered to be executed with the <dl class="command"> <dt id="command:add_doc_source"> <code class="descname">add_doc_source</code><a class="headerlink" href="#command:add_doc_source" title="Permalink to this definition">¶</a></dt> -<dd><div class="highlight-cmake"><div class="highlight"><pre><span class="nb">add_doc_source</span><span class="p">(</span><span class="s">NAME</span> <span class="s">name</span> +<dd><div class="highlight-cmake"><div class="highlight"><pre><span></span><span class="nb">add_doc_source</span><span class="p">(</span><span class="s">NAME</span> <span class="s">name</span> <span class="s">RST</span> <span class="s">rst1</span> <span class="s">[rst2...]</span><span class="p">)</span> </pre></div> </div> @@ -266,7 +268,7 @@ name or a CMake list.</dd> <dl class="command"> <dt id="command:add_doc_dependency"> <code class="descname">add_doc_dependency</code><a class="headerlink" href="#command:add_doc_dependency" title="Permalink to this definition">¶</a></dt> -<dd><div class="highlight-cmake"><div class="highlight"><pre><span class="nb">add_doc_dependency</span><span class="p">(</span><span class="s">NAME</span> <span class="s">name</span> +<dd><div class="highlight-cmake"><div class="highlight"><pre><span></span><span class="nb">add_doc_dependency</span><span class="p">(</span><span class="s">NAME</span> <span class="s">name</span> <span class="s">DEP</span> <span class="s">dependency1</span> <span class="s">[dependency2...]</span><span class="p">)</span> </pre></div> </div> @@ -293,7 +295,7 @@ absolute path.</dd> <dl class="command"> <dt id="command:pm_action"> <code class="descname">pm_action</code><a class="headerlink" href="#command:pm_action" title="Permalink to this definition">¶</a></dt> -<dd><div class="highlight-cmake"><div class="highlight"><pre><span class="nb">pm_action</span><span class="p">(</span><span class="s">ACTION</span> <span class="s">action-script</span> +<dd><div class="highlight-cmake"><div class="highlight"><pre><span></span><span class="nb">pm_action</span><span class="p">(</span><span class="s">ACTION</span> <span class="s">action-script</span> <span class="s">TARGET</span> <span class="s">target</span><span class="p">)</span> </pre></div> </div> @@ -364,9 +366,6 @@ target has to be created <strong>before</strong> any action may be attached to i <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -377,8 +376,8 @@ target has to be created <strong>before</strong> any action may be attached to i ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/cmake/index.txt" diff --git a/doc/html/container/docker.html b/doc/html/container/docker.html index bb4ef747..d744acd6 100644 --- a/doc/html/container/docker.html +++ b/doc/html/container/docker.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Docker — ProMod3 1.2.0 documentation</title> + <title>Docker — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="ProMod3 and Containers" href="index.html" /> <link rel="next" title="Singularity" href="singularity.html" /> <link rel="prev" title="ProMod3 and Containers" href="index.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -45,7 +47,7 @@ <div class="section" id="build-docker-image"> <h2>Build Docker Image<a class="headerlink" href="#build-docker-image" title="Permalink to this headline">¶</a></h2> <p>In order to build the image:</p> -<div class="highlight-bash"><div class="highlight"><pre>sudo docker build --tag <IMAGE_NAME> -f Dockerfile <PATH_TO_DOCKERFILE_DIR> +<div class="highlight-bash"><div class="highlight"><pre><span></span>sudo docker build --tag <IMAGE_NAME> -f Dockerfile <PATH_TO_DOCKERFILE_DIR> </pre></div> </div> <p>You can chose any image name (tag) eg. promod.</p> @@ -58,15 +60,15 @@ path. Eg. assuming that we have a struc.pdb file in /home/<USER>/pdbs dire a script.py in /home/<USER> we could mount the /home/<USER> to /home in docker as above by specifying -v /home/<USER>:/home. To run the script we thus need to provide the (relative) path to the script and (relative) path to the file eg:</p> -<div class="highlight-bash"><div class="highlight"><pre>sudo docker run --rm -v /home/<USER>:/home <IMAGE_NAME> pm script.py pdbs/struct.pdb +<div class="highlight-bash"><div class="highlight"><pre><span></span>sudo docker run --rm -v /home/<USER>:/home <IMAGE_NAME> pm script.py pdbs/struct.pdb </pre></div> </div> <p>or with absolute paths:</p> -<div class="highlight-bash"><div class="highlight"><pre>sudo docker run --rm -v /home/<USER>:/home <IMAGE_NAME> pm /home/script.py /home/pdbs/struct.pdb +<div class="highlight-bash"><div class="highlight"><pre><span></span>sudo docker run --rm -v /home/<USER>:/home <IMAGE_NAME> pm /home/script.py /home/pdbs/struct.pdb </pre></div> </div> <p>An alternative is to mount the current working directory into the docker home:</p> -<div class="highlight-bash"><div class="highlight"><pre>sudo docker run --rm -v <span class="k">$(</span><span class="nb">pwd</span><span class="k">)</span>:/home <IMAGE_NAME> pm script.py pdbs/struct.pdb +<div class="highlight-bash"><div class="highlight"><pre><span></span>sudo docker run --rm -v <span class="k">$(</span><span class="nb">pwd</span><span class="k">)</span>:/home <IMAGE_NAME> pm script.py pdbs/struct.pdb </pre></div> </div> </div> @@ -95,11 +97,11 @@ The files are rather large, it is therefore recommended to download the gzipped version.</p> <p>After downloading the file use <strong class="program">chemdict_tool</strong> in the container to convert the MMCIF dictionary into our internal format:</p> -<div class="highlight-bash"><div class="highlight"><pre>sudo docker run --rm -v <span class="k">$(</span><span class="nb">pwd</span><span class="k">)</span>:/home <IMAGE_NAME> chemdict_tool create components.cif.gz compounds.chemlib +<div class="highlight-bash"><div class="highlight"><pre><span></span>sudo docker run --rm -v <span class="k">$(</span><span class="nb">pwd</span><span class="k">)</span>:/home <IMAGE_NAME> chemdict_tool create components.cif.gz compounds.chemlib </pre></div> </div> <p>To run a script with the upated compound library, use the -v option for mounting/overriding:</p> -<div class="highlight-bash"><div class="highlight"><pre>sudo docker run --rm -v /home/<USER>:/home -v <COMPLIB_DIR_LOCALHOST>:<COMPLIB_DIR_CONTAINER> <IMAGE_NAME> pm script.py pdbs/struct.pdb +<div class="highlight-bash"><div class="highlight"><pre><span></span>sudo docker run --rm -v /home/<USER>:/home -v <COMPLIB_DIR_LOCALHOST>:<COMPLIB_DIR_CONTAINER> <IMAGE_NAME> pm script.py pdbs/struct.pdb </pre></div> </div> <p>with COMPLIB_DIR_LOCALHOST being the directory that contains the newly generated @@ -109,7 +111,7 @@ If you didnt change anything in the Dockerfile, the latter should be /usr/local/share/ost_complib</p> <p>You can check whether the default lib is successfully overriden by looking at the output when running a Python script with following code in the container:</p> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">import</span> <span class="nn">promod3</span> <span class="c1"># required to setup default lib</span> +<div class="highlight-python"><div class="highlight"><pre><span></span><span class="kn">import</span> <span class="nn">promod3</span> <span class="c1"># required to setup default lib</span> <span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">conop</span> <span class="n">lib</span> <span class="o">=</span> <span class="n">conop</span><span class="o">.</span><span class="n">GetDefaultLib</span><span class="p">()</span> <span class="k">print</span> <span class="n">lib</span><span class="o">.</span><span class="n">GetCreationDate</span><span class="p">()</span> @@ -161,9 +163,6 @@ output when running a Python script with following code in the container:</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -174,8 +173,8 @@ output when running a Python script with following code in the container:</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/container/docker.txt" diff --git a/doc/html/container/index.html b/doc/html/container/index.html index c564a551..43bb816f 100644 --- a/doc/html/container/index.html +++ b/doc/html/container/index.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>ProMod3 and Containers — ProMod3 1.2.0 documentation</title> + <title>ProMod3 and Containers — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="Documentation For Users" href="../users.html" /> <link rel="next" title="Docker" href="docker.html" /> <link rel="prev" title="Building ProMod3" href="../buildsystem.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -85,9 +87,6 @@ some sugar on top.</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -98,8 +97,8 @@ some sugar on top.</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/container/index.txt" diff --git a/doc/html/container/singularity.html b/doc/html/container/singularity.html index 97ef62cb..27652932 100644 --- a/doc/html/container/singularity.html +++ b/doc/html/container/singularity.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Singularity — ProMod3 1.2.0 documentation</title> + <title>Singularity — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="ProMod3 and Containers" href="index.html" /> <link rel="next" title="modelling - Protein Modelling" href="../modelling/index.html" /> <link rel="prev" title="Docker" href="docker.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -52,27 +54,27 @@ Docker image.</p> this we have to fire up a local Docker registry and pull from there. Let’s assume you built the Docker image with tag promod.</p> <p>Fire the local Registry and push the promod image to it:</p> -<div class="highlight-bash"><div class="highlight"><pre>sudo docker run -d -p 5000:5000 --restart<span class="o">=</span>always --name registry registry:2 +<div class="highlight-bash"><div class="highlight"><pre><span></span>sudo docker run -d -p 5000:5000 --restart<span class="o">=</span>always --name registry registry:2 sudo docker tag promod localhost:5000/promod sudo docker push localhost:5000/promod </pre></div> </div> <p>Make sure, that on top of your Singularity recipe you have something like:</p> -<div class="highlight-bash"><div class="highlight"><pre>BootStrap: docker +<div class="highlight-bash"><div class="highlight"><pre><span></span>BootStrap: docker Registry: http://localhost:5000 Namespace: From: promod:latest </pre></div> </div> <p>and build the image with:</p> -<div class="highlight-bash"><div class="highlight"><pre>sudo <span class="nv">SINGULARITY_NOHTTPS</span><span class="o">=</span><span class="m">1</span> singularity build promod.img Singularity +<div class="highlight-bash"><div class="highlight"><pre><span></span>sudo <span class="nv">SINGULARITY_NOHTTPS</span><span class="o">=</span><span class="m">1</span> singularity build promod.img Singularity </pre></div> </div> <p>Option Two:</p> <p>You pull a Docker image from an external Docker registry. Fill in a lot of words as soon as its on Dockerhub. Many words. The best words.</p> <p>and build the image with:</p> -<div class="highlight-bash"><div class="highlight"><pre>sudo singularity build promod.img Singularity +<div class="highlight-bash"><div class="highlight"><pre><span></span>sudo singularity build promod.img Singularity </pre></div> </div> </div> @@ -83,12 +85,12 @@ For convenience, a jupyter notebook playground with OST, ProMod3 and nglview is available.</p> <p>To run ost, pm or chemdict_tool executables, use the exec command. E.g. to run scripts with pm:</p> -<div class="highlight-bash"><div class="highlight"><pre>singularity <span class="nb">exec</span> <IMAGE> pm my_script.py <span class="o">[</span>options<span class="o">]</span> +<div class="highlight-bash"><div class="highlight"><pre><span></span>singularity <span class="nb">exec</span> <IMAGE> pm my_script.py <span class="o">[</span>options<span class="o">]</span> </pre></div> </div> <p>The jupyter notebook is setup as an app in the container. To get help on how to run it:</p> -<div class="highlight-bash"><div class="highlight"><pre>singularity run --app Notebook <IMAGE> --help +<div class="highlight-bash"><div class="highlight"><pre><span></span>singularity run --app Notebook <IMAGE> --help </pre></div> </div> </div> @@ -96,16 +98,16 @@ To get help on how to run it:</p> <h2>The Compound Library<a class="headerlink" href="#the-compound-library" title="Permalink to this headline">¶</a></h2> <p>You’ll have the exact same problem with outdated compound libraries as in the raw Docker image. You can find more information on that matter in the Docker -section of the documentation: <a class="reference internal" href="docker.html#docker-compound-lib"><span>The Compound Library</span></a>.</p> +section of the documentation: <a class="reference internal" href="docker.html#docker-compound-lib"><span class="std std-ref">The Compound Library</span></a>.</p> <p>The same trick of mounting an up to date compound library from the local host into the container applies. The two relevant commands for Singularity are building a new library and mount it.</p> <p>Build a new library:</p> -<div class="highlight-bash"><div class="highlight"><pre>singularity <span class="nb">exec</span> <IMAGE_NAME> chemdict_tool create components.cif.gz compounds.chemlib +<div class="highlight-bash"><div class="highlight"><pre><span></span>singularity <span class="nb">exec</span> <IMAGE_NAME> chemdict_tool create components.cif.gz compounds.chemlib </pre></div> </div> <p>Run some script with an updated compound library from localhost:</p> -<div class="highlight-bash"><div class="highlight"><pre>singularity <span class="nb">exec</span> -B <COMPLIB_DIR_LOCALHOST>:<COMPLIB_DIR_CONTAINER> <IMAGE_NAME> pm my_script.py +<div class="highlight-bash"><div class="highlight"><pre><span></span>singularity <span class="nb">exec</span> -B <COMPLIB_DIR_LOCALHOST>:<COMPLIB_DIR_CONTAINER> <IMAGE_NAME> pm my_script.py </pre></div> </div> <p>Same as for the Docker, if you didn’t meddle with the original Dockerfile, @@ -113,7 +115,7 @@ a new library and mount it.</p> <COMPLIB_DIR_LOCALHOST> is the directory that contains the compound lib with the name compounds.chemlib that you created before. Make sure that everything works as expected by executing the exact same lines of Python code as described -in the Docker documentation: <a class="reference internal" href="docker.html#docker-compound-lib"><span>The Compound Library</span></a>.</p> +in the Docker documentation: <a class="reference internal" href="docker.html#docker-compound-lib"><span class="std std-ref">The Compound Library</span></a>.</p> </div> </div> @@ -160,9 +162,6 @@ in the Docker documentation: <a class="reference internal" href="docker.html#doc <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -173,8 +172,8 @@ in the Docker documentation: <a class="reference internal" href="docker.html#doc ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/container/singularity.txt" diff --git a/doc/html/contributing.html b/doc/html/contributing.html index 83fdf768..aeb7bd45 100644 --- a/doc/html/contributing.html +++ b/doc/html/contributing.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Contributing — ProMod3 1.2.0 documentation</title> + <title>Contributing — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: './', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="_static/underscore.js"></script> <script type="text/javascript" src="_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="index.html" /> <link rel="up" title="Documentation For Developers" href="developers.html" /> <link rel="next" title="test_actions - Testing Actions" href="actions/index_dev.html" /> <link rel="prev" title="ProMod3 Setup" href="dev_setup.html" /> + <link rel="stylesheet" href="_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -54,27 +56,27 @@ the repository into a directory and just changed into it.</p> work fine with all the other new fellows waiting for release right from the beginning. Therefore you need to switch branches as a first step. Git will tell you for which branch you went, a story of failure otherwise.</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> git checkout develop +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> git checkout develop <span class="go">Switched to branch 'develop'</span> </pre></div> </div> <p>Sitting on top of the right code basis, you should just spawn your own branch from it. As an example, your feature will go by the name of ‘sidechain’.</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> git checkout -b sidechain +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> git checkout -b sidechain <span class="go">Switched to a new branch 'sidechain'</span> </pre></div> </div> <p>This time, Git should tell you about going for <strong>a new</strong> branch.</p> <p>Before starting to create anything for real, now is the perfect moment to install our very own Git hook to check some coding rules on commit.</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> cp extras/pre_commit/pre-commit .git/hooks/ +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> cp extras/pre_commit/pre-commit .git/hooks/ </pre></div> </div> <p>With that in place, changes which break our coding standards will abort any commit.</p> <p>Now create the directory structure where your project will live. Here is the list of directories which are likely to be used in every project.</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> mkdir -p sidechain/doc +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> mkdir -p sidechain/doc <span class="gp">$</span> mkdir -p sidechain/pymod <span class="gp">$</span> mkdir -p sidechain/tests </pre></div> @@ -82,7 +84,7 @@ list of directories which are likely to be used in every project.</p> <p>If you run <code class="docutils literal"><span class="pre">git</span> <span class="pre">status</span></code> at this point, you will see basically nothing. That is, Git does not admire empty directories. Before you bring your module under version control, create a couple of files which are always needed.</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> touch sidechain/pymod/__init__.py +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> touch sidechain/pymod/__init__.py <span class="gp">$</span> <span class="nb">echo</span> <span class="s2">":mod:\`~promod3.sidechain\` - ProMod3 side chain optimiser"</span> >> sidechain/doc/index.rst <span class="gp">$</span> <span class="nb">echo</span> <span class="s2">"================================================================================"</span> >> sidechain/doc/index.rst </pre></div> @@ -94,7 +96,7 @@ your documentation.</p> <p>For integration with <strong class="command">make</strong>, the build system needs to now about the new module and its members. This goes for setting up new CMake files and extending some around the directory root.</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> touch sidechain/CMakeLists.txt +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> touch sidechain/CMakeLists.txt <span class="gp">$</span> touch sidechain/pymod/CMakeLists.txt <span class="gp">$</span> touch sidechain/doc/CMakeLists.txt </pre></div> @@ -102,7 +104,7 @@ extending some around the directory root.</p> <p>Each of those files still needs a bit of content. The simplest one comes from the module’s root, <code class="file docutils literal"><span class="pre">sidechain/CMakeLists.txt</span></code>:</p> <div class="highlight-cmake"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>1 -2</pre></div></td><td class="code"><div class="highlight"><pre><span class="nb">add_subdirectory</span><span class="p">(</span><span class="s">pymod</span><span class="p">)</span> +2</pre></div></td><td class="code"><div class="highlight"><pre><span></span><span class="nb">add_subdirectory</span><span class="p">(</span><span class="s">pymod</span><span class="p">)</span> <span class="nb">add_subdirectory</span><span class="p">(</span><span class="s">doc</span><span class="p">)</span> </pre></div> </td></tr></table></div> @@ -114,7 +116,7 @@ configurations. The next level in <code class="file docutils literal"><span clas 2 3 4 -5</pre></div></td><td class="code"><div class="highlight"><pre><span class="nb">set</span><span class="p">(</span><span class="s">SIDECHAIN_RST</span> +5</pre></div></td><td class="code"><div class="highlight"><pre><span></span><span class="nb">set</span><span class="p">(</span><span class="s">SIDECHAIN_RST</span> <span class="s">index.rst</span> <span class="p">)</span> @@ -139,7 +141,7 @@ a couple of examples around in this repository. Here is the most basic 2 3 4 -5</pre></div></td><td class="code"><div class="highlight"><pre><span class="nb">set</span><span class="p">(</span><span class="s">SIDECHAIN_PYMOD</span> +5</pre></div></td><td class="code"><div class="highlight"><pre><span></span><span class="nb">set</span><span class="p">(</span><span class="s">SIDECHAIN_PYMOD</span> <span class="s">__init__.py</span> <span class="p">)</span> @@ -167,7 +169,7 @@ top level <code class="file docutils literal"><span class="pre">CMakeLists.txt</ 12 13 14 -15</pre></div></td><td class="code"><div class="highlight"><pre><span class="c">## <lots of cmake commands...></span> +15</pre></div></td><td class="code"><div class="highlight"><pre><span></span><span class="c">## <lots of cmake commands...></span> <span class="c">## sub dirs to be recognised by CMake</span> <span class="c">## e.g. add_subdirectory(src), subdirs have their own CMakeLists.txt</span> @@ -199,7 +201,7 @@ still can stay in your repository while being out of the source tree by using sub-directories. ProMod3 comes with a dedicated prefix ‘build*’ in <code class="file docutils literal"><span class="pre">.gitignore</span></code>. Have a directory <code class="file docutils literal"><span class="pre">build</span></code> and <code class="file docutils literal"><span class="pre">build-dbg</span></code> and it will not show up in <code class="docutils literal"><span class="pre">git</span> <span class="pre">status</span></code>.</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> mkdir build +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> mkdir build <span class="gp">$</span> <span class="nb">cd</span> build </pre></div> </div> @@ -209,7 +211,7 @@ those scripts only need to be pointed to an OST staging tree. Even if you are on a system not covered by available scripts, their code may help you at the CMake command. Once you managed to conquer a new system, feel free to add a new configuration script. The following example assumes Fedora 19.</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> ../conf-scripts/fedora-19-conf ../../ost.git/stage +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> ../conf-scripts/fedora-19-conf ../../ost.git/stage </pre></div> </div> <p>From this point, <strong class="command">make</strong> should work and you could start adding your @@ -226,7 +228,7 @@ basic scheme is to import your module, subclass <a class="reference external" hr make the whole file runnable as script using the most common <a class="reference external" href="https://docs.python.org/2.7/library/__main__.html"><code class="xref py py-attr docutils literal"><span class="pre">__name__</span></code></a> attribute. As an example we test the <a class="reference internal" href="modelling/sidechain_reconstruction.html#promod3.modelling.ReconstructSidechains" title="promod3.modelling.ReconstructSidechains"><code class="xref py py-func docutils literal"><span class="pre">promod3.modelling.ReconstructSidechains()</span></code></a> function:</p> -<div class="highlight-python"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre> 1 +<div class="highlight-default"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre> 1 2 3 4 @@ -244,9 +246,9 @@ attribute. As an example we test the 16 17 18 -19</pre></div></td><td class="code"><div class="highlight"><pre><span class="kn">import</span> <span class="nn">unittest</span> -<span class="kn">from</span> <span class="nn">promod3</span> <span class="kn">import</span> <span class="n">modelling</span> -<span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span><span class="p">,</span><span class="n">mol</span> +19</pre></div></td><td class="code"><div class="highlight"><pre><span></span><span class="kn">import</span> <span class="nn">unittest</span> +<span class="kn">from</span> <span class="nn">promod3</span> <span class="k">import</span> <span class="n">modelling</span> +<span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">io</span><span class="p">,</span><span class="n">mol</span> <span class="kn">import</span> <span class="nn">os</span> <span class="k">class</span> <span class="nc">ReconstructTests</span><span class="p">(</span><span class="n">unittest</span><span class="o">.</span><span class="n">TestCase</span><span class="p">):</span> @@ -255,13 +257,13 @@ attribute. As an example we test the <span class="n">ref_file</span> <span class="o">=</span> <span class="n">os</span><span class="o">.</span><span class="n">path</span><span class="o">.</span><span class="n">join</span><span class="p">(</span><span class="s1">'data'</span><span class="p">,</span> <span class="s1">'1eye_rec.pdb'</span><span class="p">)</span> <span class="c1"># get and reconstruct 1eye</span> <span class="n">prot</span> <span class="o">=</span> <span class="n">io</span><span class="o">.</span><span class="n">LoadPDB</span><span class="p">(</span><span class="n">in_file</span><span class="p">)</span> - <span class="n">modelling</span><span class="o">.</span><span class="n">ReconstructSidechains</span><span class="p">(</span><span class="n">prot</span><span class="p">,</span> <span class="n">keep_sidechains</span><span class="o">=</span><span class="bp">False</span><span class="p">)</span> + <span class="n">modelling</span><span class="o">.</span><span class="n">ReconstructSidechains</span><span class="p">(</span><span class="n">prot</span><span class="p">,</span> <span class="n">keep_sidechains</span><span class="o">=</span><span class="kc">False</span><span class="p">)</span> <span class="c1"># compare with reference solution</span> <span class="n">prot_rec</span> <span class="o">=</span> <span class="n">io</span><span class="o">.</span><span class="n">LoadPDB</span><span class="p">(</span><span class="n">ref_file</span><span class="p">)</span> <span class="bp">self</span><span class="o">.</span><span class="n">assertEqual</span><span class="p">(</span><span class="n">prot</span><span class="o">.</span><span class="n">GetAtomCount</span><span class="p">(),</span> <span class="n">prot_rec</span><span class="o">.</span><span class="n">GetAtomCount</span><span class="p">())</span> <span class="k">if</span> <span class="n">__name__</span> <span class="o">==</span> <span class="s2">"__main__"</span><span class="p">:</span> - <span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">testutils</span> + <span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">testutils</span> <span class="n">testutils</span><span class="o">.</span><span class="n">RunTests</span><span class="p">()</span> </pre></div> </td></tr></table></div> @@ -271,7 +273,7 @@ First, tell CMake to search <code class="file docutils literal"><span class="pre by extending the list of sub-directories in <code class="file docutils literal"><span class="pre">sidechain/CMakeLists.txt</span></code>:</p> <div class="highlight-cmake"><table class="highlighttable"><tr><td class="linenos"><div class="linenodiv"><pre>1 2 -3</pre></div></td><td class="code"><div class="highlight"><pre> <span class="nb">add_subdirectory</span><span class="p">(</span><span class="s">pymod</span><span class="p">)</span> +3</pre></div></td><td class="code"><div class="highlight"><pre><span></span> <span class="nb">add_subdirectory</span><span class="p">(</span><span class="s">pymod</span><span class="p">)</span> <span class="nb">add_subdirectory</span><span class="p">(</span><span class="s">doc</span><span class="p">)</span> <span class="nb">add_subdirectory</span><span class="p">(</span><span class="s">tests</span><span class="p">)</span> </pre></div> @@ -290,7 +292,7 @@ you.</p> 9 10 11 -12</pre></div></td><td class="code"><div class="highlight"><pre><span class="nb">set</span><span class="p">(</span><span class="s">SIDECHAIN_UNIT_TESTS</span> +12</pre></div></td><td class="code"><div class="highlight"><pre><span></span><span class="nb">set</span><span class="p">(</span><span class="s">SIDECHAIN_UNIT_TESTS</span> <span class="s">test_reconstruct_sidechains.py</span> <span class="p">)</span> @@ -315,10 +317,10 @@ you.</p> launcher found in your staging directory at <code class="file docutils literal"><span class="pre">stage/bin/pm</span></code>. This little guy helps keeping the shell environment in the right mood to carry out your job. So usually you will start an action by</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> stage/bin/pm <span class="nb">help</span> +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> stage/bin/pm <span class="nb">help</span> </pre></div> </div> -<p>To start your own action, follow <a class="reference internal" href="#how-to-start-your-own-module"><span>How To Start Your Own Module</span></a> until +<p>To start your own action, follow <a class="reference internal" href="#how-to-start-your-own-module"><span class="std std-ref">How To Start Your Own Module</span></a> until creating a directory structure for a new module. Also <strong>do</strong> go for a dedicated branch for action-development. There you can produce intermediate commits while other branches stay clean in case you have to do some work there which needs to @@ -326,7 +328,7 @@ get public.</p> <p>After preparing your repository its time to create a file for the action. That is a bit different than for modules. Assuming we are sitting in the repository’s root:</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> touch action/pm-awesome-action +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> touch action/pm-awesome-action <span class="gp">$</span> chmod +x action/pm-awesome-action </pre></div> </div> @@ -343,7 +345,7 @@ executable, which does not propagate if you do it <strong>after</strong> the fir 4 5 6 -7</pre></div></td><td class="code"><div class="highlight"><pre> <span class="nb">add_custom_target</span><span class="p">(</span><span class="s">actions</span> <span class="s">ALL</span><span class="p">)</span> +7</pre></div></td><td class="code"><div class="highlight"><pre><span></span> <span class="nb">add_custom_target</span><span class="p">(</span><span class="s">actions</span> <span class="s">ALL</span><span class="p">)</span> <span class="nb">add_subdirectory</span><span class="p">(</span><span class="s">tests</span><span class="p">)</span> <span class="nb">pm_action_init</span><span class="p">()</span> @@ -377,7 +379,7 @@ that’s enough to get everything just right.</p> Your action will have own function definitions, variables and all the bells and whistles. Hiding behind <a class="reference external" href="https://docs.python.org/2.7/library/__main__.html"><code class="xref py py-attr docutils literal"><span class="pre">__main__</span></code></a> keeps everything separated and makes things easier when it gets to debugging. So just after</p> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">import</span> <span class="nn">alot</span> +<div class="highlight-python"><div class="highlight"><pre><span></span><span class="kn">import</span> <span class="nn">alot</span> <span class="k">def</span> <span class="nf">functions_specific_to_your_action</span><span class="p">(</span><span class="o">...</span><span class="p">):</span> @@ -464,7 +466,7 @@ and <code class="docutils literal"><span class="pre">ost</span></code> as in the folder and adapt it for your purposes. First, you will have to fix the paths to ProMod3 and OST in the <code class="file docutils literal"><span class="pre">Makefile</span></code> by changing the following lines:</p> -<div class="highlight-make"><div class="highlight"><pre><span class="c"># path to OST and ProMod3 stage</span> +<div class="highlight-make"><div class="highlight"><pre><span></span><span class="c"># path to OST and ProMod3 stage</span> <span class="nv">OST_ROOT</span> <span class="o">=</span> <DEFINEME>/ost/build/stage <span class="nv">PROMOD3_ROOT</span> <span class="o">=</span> <DEFINEME>/ProMod3/build/stage </pre></div> @@ -530,13 +532,13 @@ they can be included in the documentation using the literalinclude directive. For instance, if you add a new example code <code class="file docutils literal"><span class="pre">loop_main.py</span></code>, you would add it in your module documentation as follows:</p> -<div class="highlight-rest"><div class="highlight"><pre><span class="p">..</span> <span class="ow">literalinclude</span><span class="p">::</span> ../../../tests/doc/scripts/loop_main.py +<div class="highlight-rest"><div class="highlight"><pre><span></span><span class="p">..</span> <span class="ow">literalinclude</span><span class="p">::</span> ../../../tests/doc/scripts/loop_main.py </pre></div> </div> <p>If your example does not relate to a specific module and the documentation is in the top-level <code class="file docutils literal"><span class="pre">doc</span></code> directory, you need to drop one of the <code class="docutils literal"><span class="pre">..</span></code> as follows:</p> -<div class="highlight-rest"><div class="highlight"><pre><span class="p">..</span> <span class="ow">literalinclude</span><span class="p">::</span> ../../tests/doc/scripts/hello_world.py +<div class="highlight-rest"><div class="highlight"><pre><span></span><span class="p">..</span> <span class="ow">literalinclude</span><span class="p">::</span> ../../tests/doc/scripts/hello_world.py </pre></div> </div> <p>To ensure that the code examples keep on working, a unit test has to be defined @@ -554,7 +556,7 @@ test.</li> there is no need to compile ProMod3 to read it. Our policy is to keep that folder in-sync with the latest documentation at least on the <code class="docutils literal"><span class="pre">master</span></code> branch (i.e. for every release). You can use the following commands to do the update:</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> <span class="nb">cd</span> <PROMOD3_PATH>/build +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> <span class="nb">cd</span> <PROMOD3_PATH>/build <span class="gp">$</span> make html <span class="gp">$</span> rsync -iv -az --exclude<span class="o">=</span><span class="s2">".*"</span> --delete <span class="se">\</span> <span class="go"> "stage/share/promod3/html/" "../doc/html"</span> @@ -637,9 +639,6 @@ contributions to web pages using ProMod3.</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -650,8 +649,8 @@ contributions to web pages using ProMod3.</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="_sources/contributing.txt" diff --git a/doc/html/core/geometry.html b/doc/html/core/geometry.html index ee31fc7f..236cc393 100644 --- a/doc/html/core/geometry.html +++ b/doc/html/core/geometry.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Geometry functions — ProMod3 1.2.0 documentation</title> + <title>Geometry functions — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="core - ProMod3 Core Functionality" href="index.html" /> <link rel="next" title="Runtime profiling" href="runtime_profiling.html" /> <link rel="prev" title="helper - Shared Functionality For the Everything" href="helper.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -338,9 +340,6 @@ angles and one distance and is used in the fragment database for fast lookups.</ <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -351,8 +350,8 @@ angles and one distance and is used in the fragment database for fast lookups.</ ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/core/geometry.txt" diff --git a/doc/html/core/graph_minimizer.html b/doc/html/core/graph_minimizer.html index f3689561..751d2f81 100644 --- a/doc/html/core/graph_minimizer.html +++ b/doc/html/core/graph_minimizer.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Graph Minimizer — ProMod3 1.2.0 documentation</title> + <title>Graph Minimizer — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="core - ProMod3 Core Functionality" href="index.html" /> <link rel="next" title="SetCompoundsChemlib()" href="setcompoundschemlib.html" /> <link rel="prev" title="Runtime profiling" href="runtime_profiling.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -48,7 +50,7 @@ Every solution has a self energy <span class="math">\(E_{self}\)</span> and pair are possible. The goal is to select exactly one solution per node to obtain a set <span class="math">\(X=[x_1, x_2, ..., x_n]\)</span> that minimizes:</p> <div class="math"> -\[\begin{split}F(X)=\displaystyle\sum_iE_{self}(N_i[x_i]) +\displaystyle \sum_i \displaystyle \sum_{j>i}E_{pair}(N_i[x_i], N_j[x_j])\end{split}\]</div> +\[F(X)=\displaystyle\sum_iE_{self}(N_i[x_i]) +\displaystyle \sum_i \displaystyle \sum_{j>i}E_{pair}(N_i[x_i], N_j[x_j])\]</div> <dl class="class"> <dt id="promod3.core.GraphMinimizer"> <em class="property">class </em><code class="descclassname">promod3.core.</code><code class="descname">GraphMinimizer</code><a class="headerlink" href="#promod3.core.GraphMinimizer" title="Permalink to this definition">¶</a></dt> @@ -364,9 +366,6 @@ The second element is the according energy value.</td> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -377,8 +376,8 @@ The second element is the according energy value.</td> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/core/graph_minimizer.txt" diff --git a/doc/html/core/helper.html b/doc/html/core/helper.html index 9e1caf9b..138df086 100644 --- a/doc/html/core/helper.html +++ b/doc/html/core/helper.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>helper - Shared Functionality For the Everything — ProMod3 1.2.0 documentation</title> + <title>helper - Shared Functionality For the Everything — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="core - ProMod3 Core Functionality" href="index.html" /> <link rel="next" title="Geometry functions" href="geometry.html" /> <link rel="prev" title="pm3argparse - Parsing Command Lines" href="pm3argparse.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -49,7 +51,7 @@ rather empty modules left alone.</p> </div> <div class="section" id="messages"> <h2>Messages<a class="headerlink" href="#messages" title="Permalink to this headline">¶</a></h2> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">promod3.core</span> <span class="kn">import</span> <span class="n">helper</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="kn">from</span> <span class="nn">promod3.core</span> <span class="k">import</span> <span class="n">helper</span> <span class="n">helper</span><span class="o">.</span><span class="n">MsgErrorAndExit</span><span class="p">(</span><span class="s2">"Something failed!"</span><span class="p">,</span> <span class="mi">1</span><span class="p">)</span> </pre></div> @@ -82,9 +84,9 @@ traditionally reserved to successful commands.</li> <h2>File Tests<a class="headerlink" href="#file-tests" title="Permalink to this headline">¶</a></h2> <p>The following example parses an argument (call as <code class="docutils literal"><span class="pre">pm</span> <span class="pre">SCRIPTNAME</span> <span class="pre">FILENAME</span></code>) as a file name and checks whether it is a <code class="docutils literal"><span class="pre">pdb</span></code> or <code class="docutils literal"><span class="pre">mmcif</span></code> file.</p> -<div class="highlight-python"><div class="highlight"><pre><span class="sd">"""Test for file reading."""</span> -<span class="kn">from</span> <span class="nn">promod3.core</span> <span class="kn">import</span> <span class="n">helper</span> -<span class="kn">from</span> <span class="nn">promod3.core</span> <span class="kn">import</span> <span class="n">pm3argparse</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="sd">"""Test for file reading."""</span> +<span class="kn">from</span> <span class="nn">promod3.core</span> <span class="k">import</span> <span class="n">helper</span> +<span class="kn">from</span> <span class="nn">promod3.core</span> <span class="k">import</span> <span class="n">pm3argparse</span> <span class="n">p</span> <span class="o">=</span> <span class="n">pm3argparse</span><span class="o">.</span><span class="n">PM3ArgumentParser</span><span class="p">(</span><span class="n">__doc__</span><span class="p">)</span> <span class="n">p</span><span class="o">.</span><span class="n">add_argument</span><span class="p">(</span><span class="s1">'file'</span><span class="p">,</span> <span class="nb">type</span><span class="o">=</span><span class="nb">str</span><span class="p">)</span> @@ -95,7 +97,7 @@ a file name and checks whether it is a <code class="docutils literal"><span clas <span class="n">opts</span><span class="o">.</span><span class="n">name</span><span class="p">,</span> <span class="n">opts</span><span class="o">.</span><span class="n">ext</span><span class="p">,</span> <span class="n">opts</span><span class="o">.</span><span class="n">gz</span> <span class="o">=</span> <span class="n">helper</span><span class="o">.</span><span class="n">FileExtension</span><span class="p">(</span><span class="s1">'Test file'</span><span class="p">,</span> <span class="mi">2</span><span class="p">,</span> <span class="n">opts</span><span class="o">.</span><span class="n">file</span><span class="p">,</span> <span class="p">(</span><span class="s1">'pdb'</span><span class="p">,</span> <span class="s1">'mmcif'</span><span class="p">),</span> - <span class="n">gzip</span><span class="o">=</span><span class="bp">True</span><span class="p">)</span> + <span class="n">gzip</span><span class="o">=</span><span class="kc">True</span><span class="p">)</span> </pre></div> </div> <dl class="function"> @@ -238,9 +240,6 @@ script will terminate if a gzip file is found.</li> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -251,8 +250,8 @@ script will terminate if a gzip file is found.</li> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/core/helper.txt" diff --git a/doc/html/core/index.html b/doc/html/core/index.html index bb514aa8..d65e79fb 100644 --- a/doc/html/core/index.html +++ b/doc/html/core/index.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>core - ProMod3 Core Functionality — ProMod3 1.2.0 documentation</title> + <title>core - ProMod3 Core Functionality — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="Documentation For Users" href="../users.html" /> <link rel="next" title="pm3argparse - Parsing Command Lines" href="pm3argparse.html" /> <link rel="prev" title="Loading Precomputed Objects" href="../loop/load_loop_objects.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -96,9 +98,6 @@ modeling per se but cover standard programming issues.</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -109,8 +108,8 @@ modeling per se but cover standard programming issues.</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/core/index.txt" diff --git a/doc/html/core/pm3argparse.html b/doc/html/core/pm3argparse.html index 580197b7..e527fc76 100644 --- a/doc/html/core/pm3argparse.html +++ b/doc/html/core/pm3argparse.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>pm3argparse - Parsing Command Lines — ProMod3 1.2.0 documentation</title> + <title>pm3argparse - Parsing Command Lines — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="core - ProMod3 Core Functionality" href="index.html" /> <link rel="next" title="helper - Shared Functionality For the Everything" href="helper.html" /> <link rel="prev" title="core - ProMod3 Core Functionality" href="index.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -53,12 +55,12 @@ There <a class="reference internal" href="#promod3.core.pm3argparse.PM3ArgumentP simplification. It provides a set of standard arguments you just need to activate for your action plus it comes with some verification functionality for input.</p> -<div class="highlight-python"><div class="highlight"><pre><span class="sd">"""</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="sd">"""</span> <span class="sd">Place the description of your script right in the file and import</span> <span class="sd">it via '__doc__' as description to the parser ('-h', '--help').</span> <span class="sd">"""</span> -<span class="kn">from</span> <span class="nn">promod3.core</span> <span class="kn">import</span> <span class="n">pm3argparse</span> +<span class="kn">from</span> <span class="nn">promod3.core</span> <span class="k">import</span> <span class="n">pm3argparse</span> <span class="c1"># make sure we see output when passing '-h'</span> <span class="kn">import</span> <span class="nn">ost</span> @@ -155,7 +157,7 @@ sequence is used. File can be plain or gzipped.</li> <li><code class="docutils literal"><span class="pre">-j/--json</span> <span class="pre"><OBJECT>|<FILE></span></code> - Alignments provided as JSON file/object. File can be plain or gzipped.</li> </ul> -<p>See <a class="reference internal" href="../actions/index.html#promod-build-model"><span>here</span></a> for details on the file formats.</p> +<p>See <a class="reference internal" href="../actions/index.html#promod-build-model"><span class="std std-ref">here</span></a> for details on the file formats.</p> <p>Attributes added to the namespace returned by <a class="reference internal" href="#promod3.core.pm3argparse.PM3ArgumentParser.Parse" title="promod3.core.pm3argparse.PM3ArgumentParser.Parse"><code class="xref py py-meth docutils literal"><span class="pre">Parse()</span></code></a>:</p> <ul class="simple"> <li><code class="xref py py-attr docutils literal"><span class="pre">fasta</span></code> - filled with the input of the <code class="docutils literal"><span class="pre">--fasta</span></code> option, a @@ -252,7 +254,7 @@ input is post processed and checked in <a class="reference internal" href="#prom to <a class="reference internal" href="#promod3.core.pm3argparse.PM3ArgumentParser.AddAlignment" title="promod3.core.pm3argparse.PM3ArgumentParser.AddAlignment"><code class="xref py py-meth docutils literal"><span class="pre">AddAlignment()</span></code></a>. Chains for each sequence are identified based on the sequence name of the templates in the alignments (see -<a class="reference internal" href="../actions/index.html#promod-build-model"><span>here</span></a> for details).</td> +<a class="reference internal" href="../actions/index.html#promod-build-model"><span class="std std-ref">here</span></a> for details).</td> </tr> </tbody> </table> @@ -375,9 +377,6 @@ and with the right constraints.</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -388,8 +387,8 @@ and with the right constraints.</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/core/pm3argparse.txt" diff --git a/doc/html/core/runtime_profiling.html b/doc/html/core/runtime_profiling.html index 03dd39d1..d7218105 100644 --- a/doc/html/core/runtime_profiling.html +++ b/doc/html/core/runtime_profiling.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Runtime profiling — ProMod3 1.2.0 documentation</title> + <title>Runtime profiling — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="core - ProMod3 Core Functionality" href="index.html" /> <link rel="next" title="Graph Minimizer" href="graph_minimizer.html" /> <link rel="prev" title="Geometry functions" href="geometry.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -192,9 +194,6 @@ will fail miserably if timers are currently running.</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -205,8 +204,8 @@ will fail miserably if timers are currently running.</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/core/runtime_profiling.txt" diff --git a/doc/html/core/setcompoundschemlib.html b/doc/html/core/setcompoundschemlib.html index ce61a107..724fb324 100644 --- a/doc/html/core/setcompoundschemlib.html +++ b/doc/html/core/setcompoundschemlib.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>SetCompoundsChemlib() — ProMod3 1.2.0 documentation</title> + <title>SetCompoundsChemlib() — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="Documentation For Users" href="../users.html" /> <link rel="next" title="Documentation For Developers" href="../developers.html" /> <link rel="prev" title="Graph Minimizer" href="graph_minimizer.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -97,9 +99,6 @@ enabled globally.</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -110,8 +109,8 @@ enabled globally.</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/core/setcompoundschemlib.txt" diff --git a/doc/html/dev_setup.html b/doc/html/dev_setup.html index e1d54f0a..075ba92b 100644 --- a/doc/html/dev_setup.html +++ b/doc/html/dev_setup.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>ProMod3 Setup — ProMod3 1.2.0 documentation</title> + <title>ProMod3 Setup — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: './', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="_static/underscore.js"></script> <script type="text/javascript" src="_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="index.html" /> <link rel="up" title="Documentation For Developers" href="developers.html" /> <link rel="next" title="Contributing" href="contributing.html" /> <link rel="prev" title="Documentation For Developers" href="developers.html" /> + <link rel="stylesheet" href="_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -86,7 +88,7 @@ created something that could go into a release, tidy things up according to the rules from above and merge it into <code class="docutils literal"><span class="pre">develop</span></code>. From there it will automatically find its way into the next release.</p> <p>To set up your own branch, start from a current <code class="docutils literal"><span class="pre">develop</span></code> branch:</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> git checkout develop <span class="c1"># switch to branch develop</span> +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> git checkout develop <span class="c1"># switch to branch develop</span> <span class="gp">$</span> git pull --rebase <span class="c1"># update branch develop</span> <span class="gp">$</span> git checkout -b <BRANCHNAME> <span class="c1"># create branch <BRANCHNAME> and switch to it</span> </pre></div> @@ -96,7 +98,7 @@ want to make use of in your project. Keeping your branch up to date is a three step process. Git does not allow updates on top of changed code, so either changes have to be committed, or if in the middle of implementing something, stored away temporarily. Making commits is straight forward:</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> git commit -m <span class="s1">'<DESCRIPTION>'</span> <span class="c1"># commit changes including a comment</span> +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> git commit -m <span class="s1">'<DESCRIPTION>'</span> <span class="c1"># commit changes including a comment</span> </pre></div> </div> <p>Hiding your changes away from Git just for updating files is a bit more @@ -107,15 +109,15 @@ you have changed, too, and stashed away, this may end up in a non-resolvable merge conflict and your changes are lost. Usually the log tells you, which files were recently modified. Moving all current changes to the stack is achieved by:</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> git stash save +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> git stash save </pre></div> </div> <p>To revive them, use:</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> git stash pop +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> git stash pop </pre></div> </div> <p>After cleaning up your branch, switch to <code class="docutils literal"><span class="pre">develop</span></code>, update it and switch back:</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> git checkout develop +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> git checkout develop <span class="gp">$</span> git pull --rebase <span class="gp">$</span> git checkout <BRANCHNAME> </pre></div> @@ -124,11 +126,11 @@ achieved by:</p> and rebasing. A rebase may only be done, if you <strong>never</strong> pushed your branch to the origin of the repository (otherwise you will mess up history, in the worst case <code class="docutils literal"><span class="pre">develop</span></code> may be unusable once you merge):</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> git rebase develop +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> git rebase develop </pre></div> </div> <p>For branches which are available to others, do a proper merge:</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> git merge develop +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> git merge develop </pre></div> </div> <p>This may require some manual conflict solving and will end up in a merge commit.</p> @@ -137,17 +139,17 @@ case <code class="docutils literal"><span class="pre">develop</span></code> may <h2>Git Hooks<a class="headerlink" href="#git-hooks" title="Permalink to this headline">¶</a></h2> <p>Git hooks are scripts invoked by Git in connection to certain commands. ProMod3 currently provides one for <strong class="command">commit</strong>. It is installed by</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> cp extras/pre_commit/pre-commit .git/hooks/ +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> cp extras/pre_commit/pre-commit .git/hooks/ </pre></div> </div> <p>Its task is applying coding standards and doing a bunch of other checks on the files involved in a commit. Everything around the script is hosted in <code class="file docutils literal"><span class="pre">extras/pre_commit/</span></code>. The checks can be manually executed with</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> python .git/hooks/pre-commit +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> python .git/hooks/pre-commit </pre></div> </div> <p>If you ever have to skip the hook,</p> -<div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> git commit --no-verify +<div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> git commit --no-verify </pre></div> </div> <p>does the trick. <strong>But</strong> checks are always run on the complete file containing @@ -173,7 +175,7 @@ is invoked on unit test code, where we may go a little bit less restrictive.</p> everything together that belongs together’. That is, code, documentation and extra data should be gathered on a per-module basis immediately in the repository root. The directory structure of your module should look like this:</p> -<div class="highlight-text"><div class="highlight"><pre>promod3.git/ Project folder +<div class="highlight-text"><div class="highlight"><pre><span></span>promod3.git/ Project folder your_module/ Module directory CMakeLists.txt CMake configuration data/ Extra data (if needed) @@ -205,13 +207,13 @@ repository root. The directory structure of your module should look like this:</ <p>Additionally to the module directories there are a few extra folders:</p> <ul class="simple"> <li><code class="file docutils literal"><span class="pre">actions</span></code>: Scripts callable as <code class="docutils literal"><span class="pre">pm</span> <span class="pre"><ACTION_NAME></span></code>. -See <a class="reference internal" href="contributing.html#how-to-start-your-own-action"><span>here</span></a> for details.</li> +See <a class="reference internal" href="contributing.html#how-to-start-your-own-action"><span class="std std-ref">here</span></a> for details.</li> <li><code class="file docutils literal"><span class="pre">cmake_support</span></code>: Helper functions for CMake. -See <a class="reference internal" href="cmake/index.html#pm3-cmake-doc"><span>here</span></a> for details.</li> +See <a class="reference internal" href="cmake/index.html#pm3-cmake-doc"><span class="std std-ref">here</span></a> for details.</li> <li><code class="file docutils literal"><span class="pre">doc</span></code>: High-level documentation, test scripts (<code class="file docutils literal"><span class="pre">doc/tests</span></code>) and a copy of the generated html documentation (<code class="file docutils literal"><span class="pre">doc/html</span></code>). The latter must be kept up-to-date at least on the <code class="docutils literal"><span class="pre">master</span></code> branch. -See <a class="reference internal" href="contributing.html#writing-documentation"><span>here</span></a> for details.</li> +See <a class="reference internal" href="contributing.html#writing-documentation"><span class="std std-ref">here</span></a> for details.</li> <li><code class="file docutils literal"><span class="pre">extras</span></code>: Extra data and information that doesn’t fit anywhere else (e.g. Git hooks or scripts to recreate the binary files).</li> <li><code class="file docutils literal"><span class="pre">scripts</span></code>: Input for scripts that end up in <code class="file docutils literal"><span class="pre">stage/bin</span></code></li> @@ -226,7 +228,7 @@ Python modules are declared there as well as which files belong to the documentation. CMake is a rather complex topic (unfortunately all usable build systems seem to be) so we skip a detailed view, here, and just advice you to go by example. There is a tiny bit of documentation on our additions to -CMake <a class="reference internal" href="cmake/index.html#pm3-cmake-doc"><span>here</span></a>. If you really need to make changes to the +CMake <a class="reference internal" href="cmake/index.html#pm3-cmake-doc"><span class="std std-ref">here</span></a>. If you really need to make changes to the build system, other than adding new files and modules, you have to dive into CMake documentation all by yourself and on your own responsibility. You have been warned.</p> @@ -284,9 +286,6 @@ modules from there, use the binaries from <code class="file docutils literal"><s <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -297,8 +296,8 @@ modules from there, use the binaries from <code class="file docutils literal"><s ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="_sources/dev_setup.txt" diff --git a/doc/html/developers.html b/doc/html/developers.html index 930ffb34..e1c550bb 100644 --- a/doc/html/developers.html +++ b/doc/html/developers.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Documentation For Developers — ProMod3 1.2.0 documentation</title> + <title>Documentation For Developers — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: './', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,15 +24,17 @@ <script type="text/javascript" src="_static/underscore.js"></script> <script type="text/javascript" src="_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="index.html" /> <link rel="next" title="ProMod3 Setup" href="dev_setup.html" /> <link rel="prev" title="SetCompoundsChemlib()" href="core/setcompoundschemlib.html" /> + <link rel="stylesheet" href="_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -115,9 +117,6 @@ new features.</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -128,8 +127,8 @@ new features.</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="_sources/developers.txt" diff --git a/doc/html/genindex.html b/doc/html/genindex.html index a375c1a3..97e9e9d6 100644 --- a/doc/html/genindex.html +++ b/doc/html/genindex.html @@ -7,7 +7,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Index — ProMod3 1.2.0 documentation</title> + <title>Index — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="_static/pygments.css" type="text/css" /> @@ -15,7 +15,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: './', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -25,13 +25,15 @@ <script type="text/javascript" src="_static/underscore.js"></script> <script type="text/javascript" src="_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="index.html" /> + <link rel="stylesheet" href="_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -3874,9 +3876,6 @@ <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -3887,8 +3886,8 @@ ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> </div> diff --git a/doc/html/gettingstarted.html b/doc/html/gettingstarted.html index 383cc28b..f28f4800 100644 --- a/doc/html/gettingstarted.html +++ b/doc/html/gettingstarted.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Getting Started — ProMod3 1.2.0 documentation</title> + <title>Getting Started — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: './', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="_static/underscore.js"></script> <script type="text/javascript" src="_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="index.html" /> <link rel="up" title="Documentation For Users" href="users.html" /> <link rel="next" title="ProMod3 Actions" href="actions/index.html" /> <link rel="prev" title="Documentation For Users" href="users.html" /> + <link rel="stylesheet" href="_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -47,22 +49,22 @@ <p>First steps to get ProMod3 up and running:</p> <ol class="arabic simple"> <li>Obtain all dependencies and compile ProMod3 with <code class="docutils literal"><span class="pre">cmake</span></code> and <code class="docutils literal"><span class="pre">make</span></code> -(see <a class="reference internal" href="buildsystem.html#building-promod"><span>here</span></a>).</li> +(see <a class="reference internal" href="buildsystem.html#building-promod"><span class="std std-ref">here</span></a>).</li> <li>Ensure that you have a <code class="docutils literal"><span class="pre">stage/bin</span></code> folder which includes a <code class="docutils literal"><span class="pre">pm</span></code> executable. For convenience, add the folder to your <code class="docutils literal"><span class="pre">PATH</span></code> env. variable.</li> <li>You can now execute ProMod3 by running the following in your terminal:</li> </ol> <blockquote> -<div><div class="highlight-console"><div class="highlight"><pre><span class="gp">$</span> pm <COMMAND> +<div><div class="highlight-console"><div class="highlight"><pre><span></span><span class="gp">$</span> pm <COMMAND> </pre></div> </div> <p>Here <code class="docutils literal"><span class="pre"><COMMAND></span></code> can be:</p> <ul> -<li><p class="first">a predefined “action” (see <a class="reference internal" href="actions/index.html#promod-actions"><span>here</span></a>)</p> +<li><p class="first">a predefined “action” (see <a class="reference internal" href="actions/index.html#promod-actions"><span class="std std-ref">here</span></a>)</p> </li> <li><p class="first">the path to a python script, such as the following example:</p> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span> -<span class="kn">from</span> <span class="nn">promod3</span> <span class="kn">import</span> <span class="n">loop</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">io</span> +<span class="kn">from</span> <span class="nn">promod3</span> <span class="k">import</span> <span class="n">loop</span> <span class="c1"># generate backbone with dihedrals of a helix and store it</span> <span class="n">sequence</span> <span class="o">=</span> <span class="s2">"HELLYEAH"</span> @@ -139,9 +141,6 @@ not set, 1 thread will be used by default.</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -152,8 +151,8 @@ not set, 1 thread will be used by default.</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="_sources/gettingstarted.txt" diff --git a/doc/html/index.html b/doc/html/index.html index 34717b01..01e2cbfa 100644 --- a/doc/html/index.html +++ b/doc/html/index.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>ProMod3 — ProMod3 1.2.0 documentation</title> + <title>ProMod3 — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: './', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,14 +24,16 @@ <script type="text/javascript" src="_static/underscore.js"></script> <script type="text/javascript" src="_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="#" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="#" /> <link rel="next" title="Documentation For Users" href="users.html" /> + <link rel="stylesheet" href="_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -111,9 +113,6 @@ algorithms.</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -124,8 +123,8 @@ algorithms.</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="_sources/index.txt" diff --git a/doc/html/license.html b/doc/html/license.html index 3a642030..6fe3a3ca 100644 --- a/doc/html/license.html +++ b/doc/html/license.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>License — ProMod3 1.2.0 documentation</title> + <title>License — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: './', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,15 +24,17 @@ <script type="text/javascript" src="_static/underscore.js"></script> <script type="text/javascript" src="_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="index.html" /> <link rel="next" title="References" href="references.html" /> <link rel="prev" title="Using Binary Files In ProMod3" href="portableIO.html" /> + <link rel="stylesheet" href="_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -41,7 +43,7 @@ <div class="section" id="license"> <h1>License<a class="headerlink" href="#license" title="Permalink to this headline">¶</a></h1> -<div class="highlight-python"><div class="highlight"><pre> +<div class="highlight-default"><div class="highlight"><pre><span></span> Apache License Version 2.0, January 2004 http://www.apache.org/licenses/ @@ -284,9 +286,6 @@ doc/Copyright_cmake.py.txt <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -297,8 +296,8 @@ doc/Copyright_cmake.py.txt ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="_sources/license.txt" diff --git a/doc/html/loop/all_atom.html b/doc/html/loop/all_atom.html index 7dc41f2f..0566e8bf 100644 --- a/doc/html/loop/all_atom.html +++ b/doc/html/loop/all_atom.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Handling All Atom Positions — ProMod3 1.2.0 documentation</title> + <title>Handling All Atom Positions — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="loop - Loop Handling" href="index.html" /> <link rel="next" title="Generate ost.mol.mm systems" href="mm_system_creation.html" /> <link rel="prev" title="Structural Data" href="structure_db.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -47,8 +49,8 @@ positions of all their heavy atoms and an environment (<a class="reference internal" href="#promod3.loop.AllAtomEnv" title="promod3.loop.AllAtomEnv"><code class="xref py py-class docutils literal"><span class="pre">AllAtomEnv</span></code></a>) to handle changes during loop modelling.</p> <p>The example below showcases some operations on the two classes:</p> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">geom</span> -<span class="kn">from</span> <span class="nn">promod3</span> <span class="kn">import</span> <span class="n">loop</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">geom</span> +<span class="kn">from</span> <span class="nn">promod3</span> <span class="k">import</span> <span class="n">loop</span> <span class="c1"># load example (has res. numbering starting at 1)</span> <span class="n">ent</span> <span class="o">=</span> <span class="n">io</span><span class="o">.</span><span class="n">LoadPDB</span><span class="p">(</span><span class="s2">"data/1CRN.pdb"</span><span class="p">)</span> @@ -1334,9 +1336,6 @@ when residue is N terminal.</td> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -1347,8 +1346,8 @@ when residue is N terminal.</td> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/loop/all_atom.txt" diff --git a/doc/html/loop/backbone.html b/doc/html/loop/backbone.html index 357d1bd3..9d5e222b 100644 --- a/doc/html/loop/backbone.html +++ b/doc/html/loop/backbone.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Representing Loops — ProMod3 1.2.0 documentation</title> + <title>Representing Loops — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="loop - Loop Handling" href="index.html" /> <link rel="next" title="Sampling Dihedral Angles" href="torsion_sampler.html" /> <link rel="prev" title="loop - Loop Handling" href="index.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -46,9 +48,9 @@ <a class="reference internal" href="#promod3.loop.BackboneList" title="promod3.loop.BackboneList"><code class="xref py py-class docutils literal"><span class="pre">BackboneList</span></code></a>. It provides a way to store the backbone positions of residues. They provide structural manipulations, they can be manipulated and converted from, to, or inserted to a <a class="reference external" href="https://www.openstructure.org/docs/dev/mol/base/entity/#ost.mol.EntityHandle" title="(in OpenStructure v1.8.0)"><code class="xref py py-class docutils literal"><span class="pre">ost.mol.EntityHandle</span></code></a>.</p> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span> -<span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">conop</span> -<span class="kn">from</span> <span class="nn">promod3</span> <span class="kn">import</span> <span class="n">loop</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">io</span> +<span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">conop</span> +<span class="kn">from</span> <span class="nn">promod3</span> <span class="k">import</span> <span class="n">loop</span> <span class="n">sequence</span> <span class="o">=</span> <span class="s2">"AAAAAAAA"</span> @@ -58,11 +60,11 @@ converted from, to, or inserted to a <a class="reference external" href="https:/ <span class="c1"># let's have a look at the set dihedral angles</span> <span class="k">for</span> <span class="n">i</span> <span class="ow">in</span> <span class="nb">range</span><span class="p">(</span><span class="nb">len</span><span class="p">(</span><span class="n">bb_list</span><span class="p">)):</span> - <span class="k">print</span> <span class="s2">"Looking at position </span><span class="si">%d</span><span class="s2">"</span> <span class="o">%</span> <span class="n">i</span> + <span class="nb">print</span> <span class="s2">"Looking at position </span><span class="si">%d</span><span class="s2">"</span> <span class="o">%</span> <span class="n">i</span> <span class="k">if</span> <span class="n">i</span> <span class="o">></span> <span class="mi">0</span><span class="p">:</span> - <span class="k">print</span> <span class="s2">"phi: </span><span class="si">%.4f</span><span class="s2">"</span> <span class="o">%</span> <span class="n">bb_list</span><span class="o">.</span><span class="n">GetPhiTorsion</span><span class="p">(</span><span class="n">i</span><span class="p">)</span> + <span class="nb">print</span> <span class="s2">"phi: </span><span class="si">%.4f</span><span class="s2">"</span> <span class="o">%</span> <span class="n">bb_list</span><span class="o">.</span><span class="n">GetPhiTorsion</span><span class="p">(</span><span class="n">i</span><span class="p">)</span> <span class="k">if</span> <span class="n">i</span> <span class="o"><</span> <span class="nb">len</span><span class="p">(</span><span class="n">bb_list</span><span class="p">)</span><span class="o">-</span><span class="mi">1</span><span class="p">:</span> - <span class="k">print</span> <span class="s2">"psi: </span><span class="si">%.4f</span><span class="s2">"</span> <span class="o">%</span> <span class="n">bb_list</span><span class="o">.</span><span class="n">GetPsiTorsion</span><span class="p">(</span><span class="n">i</span><span class="p">)</span> + <span class="nb">print</span> <span class="s2">"psi: </span><span class="si">%.4f</span><span class="s2">"</span> <span class="o">%</span> <span class="n">bb_list</span><span class="o">.</span><span class="n">GetPsiTorsion</span><span class="p">(</span><span class="n">i</span><span class="p">)</span> <span class="c1"># we now use a TorsionSampler to set random dihedral angles</span> @@ -996,9 +998,6 @@ backbone list.</td> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -1009,8 +1008,8 @@ backbone list.</td> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/loop/backbone.txt" diff --git a/doc/html/loop/index.html b/doc/html/loop/index.html index ab4e5e12..7564641e 100644 --- a/doc/html/loop/index.html +++ b/doc/html/loop/index.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>loop - Loop Handling — ProMod3 1.2.0 documentation</title> + <title>loop - Loop Handling — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="Documentation For Users" href="../users.html" /> <link rel="next" title="Representing Loops" href="backbone.html" /> <link rel="prev" title="Other Scoring Functions" href="../scoring/other_scoring_functions.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -45,8 +47,8 @@ <p>Tools and algorithms for loop handling. This module provides ways for representation of peptides and to obtain fragments to potentially use as loops. The following example should give you an idea of what can be done:</p> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">seq</span> -<span class="kn">from</span> <span class="nn">promod3</span> <span class="kn">import</span> <span class="n">loop</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">seq</span> +<span class="kn">from</span> <span class="nn">promod3</span> <span class="k">import</span> <span class="n">loop</span> <span class="c1"># load an example structure</span> <span class="n">prot</span> <span class="o">=</span> <span class="n">io</span><span class="o">.</span><span class="n">LoadPDB</span><span class="p">(</span><span class="s1">'data/1CRN.pdb'</span><span class="p">)</span> @@ -64,26 +66,26 @@ loops. The following example should give you an idea of what can be done:</p> <span class="c1"># extract potential loops from fragment database based on geometry</span> <span class="n">frag_db</span> <span class="o">=</span> <span class="n">loop</span><span class="o">.</span><span class="n">LoadFragDB</span><span class="p">()</span> <span class="n">fragments</span> <span class="o">=</span> <span class="n">frag_db</span><span class="o">.</span><span class="n">SearchDB</span><span class="p">(</span><span class="n">n_stem</span><span class="p">,</span> <span class="n">c_stem</span><span class="p">,</span> <span class="n">frag_length</span><span class="p">)</span> -<span class="k">print</span> <span class="s2">"Num. fragments found in FragDB: </span><span class="si">%d</span><span class="s2">"</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">fragments</span><span class="p">)</span> +<span class="nb">print</span> <span class="s2">"Num. fragments found in FragDB: </span><span class="si">%d</span><span class="s2">"</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">fragments</span><span class="p">)</span> <span class="c1"># compare with reference</span> <span class="n">struct_db</span> <span class="o">=</span> <span class="n">loop</span><span class="o">.</span><span class="n">LoadStructureDB</span><span class="p">()</span> <span class="k">for</span> <span class="n">i</span> <span class="ow">in</span> <span class="nb">range</span><span class="p">(</span><span class="nb">len</span><span class="p">(</span><span class="n">fragments</span><span class="p">)):</span> <span class="c1"># get structure from structural database</span> <span class="n">bb_list</span> <span class="o">=</span> <span class="n">struct_db</span><span class="o">.</span><span class="n">GetBackboneList</span><span class="p">(</span><span class="n">n_stem</span><span class="p">,</span> <span class="n">c_stem</span><span class="p">,</span> <span class="n">fragments</span><span class="p">[</span><span class="n">i</span><span class="p">],</span> <span class="n">frag_seq</span><span class="p">)</span> - <span class="n">ca_rmsd</span> <span class="o">=</span> <span class="n">bb_list</span><span class="o">.</span><span class="n">CARMSD</span><span class="p">(</span><span class="n">ref_backbone</span><span class="p">,</span> <span class="bp">True</span><span class="p">)</span> - <span class="k">print</span> <span class="s2">"-> fragment </span><span class="si">%d</span><span class="s2"> has CA RMSD of </span><span class="si">%.3f</span><span class="s2">"</span> <span class="o">%</span> <span class="p">(</span><span class="n">i</span><span class="p">,</span> <span class="n">ca_rmsd</span><span class="p">)</span> + <span class="n">ca_rmsd</span> <span class="o">=</span> <span class="n">bb_list</span><span class="o">.</span><span class="n">CARMSD</span><span class="p">(</span><span class="n">ref_backbone</span><span class="p">,</span> <span class="kc">True</span><span class="p">)</span> + <span class="nb">print</span> <span class="s2">"-> fragment </span><span class="si">%d</span><span class="s2"> has CA RMSD of </span><span class="si">%.3f</span><span class="s2">"</span> <span class="o">%</span> <span class="p">(</span><span class="n">i</span><span class="p">,</span> <span class="n">ca_rmsd</span><span class="p">)</span> <span class="c1"># extract potential loops from fragment database based on sequence</span> <span class="n">fragger</span> <span class="o">=</span> <span class="n">loop</span><span class="o">.</span><span class="n">Fragger</span><span class="p">(</span><span class="n">frag_seq</span><span class="p">)</span> <span class="c1"># for simplicity we just use a sequence similarity score</span> <span class="n">fragger</span><span class="o">.</span><span class="n">AddSeqSimParameters</span><span class="p">(</span><span class="mf">1.0</span><span class="p">,</span> <span class="n">seq</span><span class="o">.</span><span class="n">alg</span><span class="o">.</span><span class="n">BLOSUM62</span><span class="p">)</span> <span class="n">fragger</span><span class="o">.</span><span class="n">Fill</span><span class="p">(</span><span class="n">struct_db</span><span class="p">,</span> <span class="mf">1.0</span><span class="p">,</span> <span class="mi">5</span><span class="p">)</span> -<span class="k">print</span> <span class="s2">"Num. fragments found in Fragger: </span><span class="si">%d</span><span class="s2">"</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">fragger</span><span class="p">)</span> +<span class="nb">print</span> <span class="s2">"Num. fragments found in Fragger: </span><span class="si">%d</span><span class="s2">"</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">fragger</span><span class="p">)</span> <span class="c1"># compare fraggers with reference</span> <span class="k">for</span> <span class="n">i</span> <span class="ow">in</span> <span class="nb">range</span><span class="p">(</span><span class="nb">len</span><span class="p">(</span><span class="n">fragger</span><span class="p">)):</span> - <span class="n">ca_rmsd</span> <span class="o">=</span> <span class="n">fragger</span><span class="p">[</span><span class="n">i</span><span class="p">]</span><span class="o">.</span><span class="n">CARMSD</span><span class="p">(</span><span class="n">ref_backbone</span><span class="p">,</span> <span class="bp">True</span><span class="p">)</span> - <span class="k">print</span> <span class="s2">"-> fragment </span><span class="si">%d</span><span class="s2"> has CA RMSD of </span><span class="si">%.3f</span><span class="s2">"</span> <span class="o">%</span> <span class="p">(</span><span class="n">i</span><span class="p">,</span> <span class="n">ca_rmsd</span><span class="p">)</span> + <span class="n">ca_rmsd</span> <span class="o">=</span> <span class="n">fragger</span><span class="p">[</span><span class="n">i</span><span class="p">]</span><span class="o">.</span><span class="n">CARMSD</span><span class="p">(</span><span class="n">ref_backbone</span><span class="p">,</span> <span class="kc">True</span><span class="p">)</span> + <span class="nb">print</span> <span class="s2">"-> fragment </span><span class="si">%d</span><span class="s2"> has CA RMSD of </span><span class="si">%.3f</span><span class="s2">"</span> <span class="o">%</span> <span class="p">(</span><span class="n">i</span><span class="p">,</span> <span class="n">ca_rmsd</span><span class="p">)</span> </pre></div> </div> <p>Contents:</p> @@ -154,9 +156,6 @@ loops. The following example should give you an idea of what can be done:</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -167,8 +166,8 @@ loops. The following example should give you an idea of what can be done:</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/loop/index.txt" diff --git a/doc/html/loop/load_loop_objects.html b/doc/html/loop/load_loop_objects.html index b8422dc5..ab776961 100644 --- a/doc/html/loop/load_loop_objects.html +++ b/doc/html/loop/load_loop_objects.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Loading Precomputed Objects — ProMod3 1.2.0 documentation</title> + <title>Loading Precomputed Objects — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="loop - Loop Handling" href="index.html" /> <link rel="next" title="core - ProMod3 Core Functionality" href="../core/index.html" /> <link rel="prev" title="Generate ost.mol.mm systems" href="mm_system_creation.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -195,9 +197,6 @@ returned by <a class="reference internal" href="#promod3.loop.LoadStructureDB" t <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -208,8 +207,8 @@ returned by <a class="reference internal" href="#promod3.loop.LoadStructureDB" t ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/loop/load_loop_objects.txt" diff --git a/doc/html/loop/mm_system_creation.html b/doc/html/loop/mm_system_creation.html index 73512c32..d3e6544c 100644 --- a/doc/html/loop/mm_system_creation.html +++ b/doc/html/loop/mm_system_creation.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Generate ost.mol.mm systems — ProMod3 1.2.0 documentation</title> + <title>Generate ost.mol.mm systems — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="loop - Loop Handling" href="index.html" /> <link rel="next" title="Loading Precomputed Objects" href="load_loop_objects.html" /> <link rel="prev" title="Handling All Atom Positions" href="all_atom.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -46,8 +48,8 @@ proteins, we define a system creator for loops (<a class="reference internal" href="#promod3.loop.MmSystemCreator" title="promod3.loop.MmSystemCreator"><code class="xref py py-class docutils literal"><span class="pre">MmSystemCreator</span></code></a>) and a specialized forcefield lookup for amino acids (<a class="reference internal" href="#promod3.loop.ForcefieldLookup" title="promod3.loop.ForcefieldLookup"><code class="xref py py-class docutils literal"><span class="pre">ForcefieldLookup</span></code></a>).</p> <p>The example below showcases the creation and use of an MM system:</p> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">geom</span> -<span class="kn">from</span> <span class="nn">promod3</span> <span class="kn">import</span> <span class="n">loop</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">geom</span> +<span class="kn">from</span> <span class="nn">promod3</span> <span class="k">import</span> <span class="n">loop</span> <span class="c1"># setup system creator</span> <span class="n">ff_lookup</span> <span class="o">=</span> <span class="n">loop</span><span class="o">.</span><span class="n">ForcefieldLookup</span><span class="o">.</span><span class="n">GetDefault</span><span class="p">()</span> @@ -67,8 +69,8 @@ specialized forcefield lookup for amino acids (<a class="reference internal" hre <span class="n">loop_start_indices</span> <span class="o">=</span> <span class="p">[</span><span class="mi">10</span><span class="p">,</span> <span class="mi">20</span><span class="p">]</span> <span class="n">loop_lengths</span> <span class="o">=</span> <span class="p">[</span><span class="mi">6</span><span class="p">,</span> <span class="mi">4</span><span class="p">]</span> <span class="c1"># define which of the res_indices is terminal</span> -<span class="n">is_n_ter</span> <span class="o">=</span> <span class="p">[</span><span class="bp">True</span><span class="p">]</span> <span class="o">+</span> <span class="p">[</span><span class="bp">False</span><span class="p">]</span> <span class="o">*</span> <span class="p">(</span><span class="n">num_residues</span> <span class="o">-</span> <span class="mi">1</span><span class="p">)</span> -<span class="n">is_c_ter</span> <span class="o">=</span> <span class="p">[</span><span class="bp">False</span><span class="p">]</span> <span class="o">*</span> <span class="p">(</span><span class="n">num_residues</span> <span class="o">-</span> <span class="mi">1</span><span class="p">)</span> <span class="o">+</span> <span class="p">[</span><span class="bp">True</span><span class="p">]</span> +<span class="n">is_n_ter</span> <span class="o">=</span> <span class="p">[</span><span class="kc">True</span><span class="p">]</span> <span class="o">+</span> <span class="p">[</span><span class="kc">False</span><span class="p">]</span> <span class="o">*</span> <span class="p">(</span><span class="n">num_residues</span> <span class="o">-</span> <span class="mi">1</span><span class="p">)</span> +<span class="n">is_c_ter</span> <span class="o">=</span> <span class="p">[</span><span class="kc">False</span><span class="p">]</span> <span class="o">*</span> <span class="p">(</span><span class="n">num_residues</span> <span class="o">-</span> <span class="mi">1</span><span class="p">)</span> <span class="o">+</span> <span class="p">[</span><span class="kc">True</span><span class="p">]</span> <span class="c1"># get disulfid bridges</span> <span class="n">disulfid_bridges</span> <span class="o">=</span> <span class="n">mm_sys</span><span class="o">.</span><span class="n">GetDisulfidBridges</span><span class="p">(</span><span class="n">all_atoms</span><span class="p">,</span> <span class="n">res_indices</span><span class="p">)</span> <span class="c1"># setup MM system</span> @@ -77,9 +79,9 @@ specialized forcefield lookup for amino acids (<a class="reference internal" hre <span class="c1"># run simulation</span> <span class="n">sim</span> <span class="o">=</span> <span class="n">mm_sys</span><span class="o">.</span><span class="n">GetSimulation</span><span class="p">()</span> -<span class="k">print</span> <span class="s2">"Potential energy before: </span><span class="si">%g</span><span class="s2">"</span> <span class="o">%</span> <span class="n">sim</span><span class="o">.</span><span class="n">GetPotentialEnergy</span><span class="p">()</span> +<span class="nb">print</span> <span class="s2">"Potential energy before: </span><span class="si">%g</span><span class="s2">"</span> <span class="o">%</span> <span class="n">sim</span><span class="o">.</span><span class="n">GetPotentialEnergy</span><span class="p">()</span> <span class="n">sim</span><span class="o">.</span><span class="n">ApplySD</span><span class="p">(</span><span class="mf">0.01</span><span class="p">,</span> <span class="mi">100</span><span class="p">)</span> -<span class="k">print</span> <span class="s2">"Potential energy after: </span><span class="si">%g</span><span class="s2">"</span> <span class="o">%</span> <span class="n">sim</span><span class="o">.</span><span class="n">GetPotentialEnergy</span><span class="p">()</span> +<span class="nb">print</span> <span class="s2">"Potential energy after: </span><span class="si">%g</span><span class="s2">"</span> <span class="o">%</span> <span class="n">sim</span><span class="o">.</span><span class="n">GetPotentialEnergy</span><span class="p">()</span> <span class="c1"># extract new loop positions and store it</span> <span class="n">mm_sys</span><span class="o">.</span><span class="n">ExtractLoopPositions</span><span class="p">(</span><span class="n">all_atoms</span><span class="p">,</span> <span class="n">res_indices</span><span class="p">)</span> @@ -512,7 +514,7 @@ less machine-dependent).</p> <tr class="field-odd field"><th class="field-name">Return type:</th><td class="field-body"><a class="reference internal" href="#promod3.loop.ForcefieldLookup" title="promod3.loop.ForcefieldLookup"><code class="xref py py-class docutils literal"><span class="pre">ForcefieldLookup</span></code></a></td> </tr> <tr class="field-even field"><th class="field-name">Raises:</th><td class="field-body"><a class="reference external" href="https://docs.python.org/2.7/library/exceptions.html#exceptions.RuntimeError" title="(in Python v2.7)"><code class="xref py py-exc docutils literal"><span class="pre">RuntimeError</span></code></a> if file cannot be opened or if -file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> for details).</td> +file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details).</td> </tr> </tbody> </table> @@ -524,7 +526,7 @@ file cannot be parsed (see <a class="reference internal" href="../portableIO.htm <dt id="promod3.loop.ForcefieldLookup.SavePortable"> <code class="descname">SavePortable</code><span class="sig-paren">(</span><em>filename</em><span class="sig-paren">)</span><a class="headerlink" href="#promod3.loop.ForcefieldLookup.SavePortable" title="Permalink to this definition">¶</a></dt> <dd><p>Saves a raw / portable binary representation. Use portable files for -distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> +distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details.</p> <table class="docutils field-list" frame="void" rules="none"> <col class="field-name" /> @@ -1584,9 +1586,6 @@ False, False)</em>.</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -1597,8 +1596,8 @@ False, False)</em>.</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/loop/mm_system_creation.txt" diff --git a/doc/html/loop/structure_db.html b/doc/html/loop/structure_db.html index 1393cd8e..6f0cff9e 100644 --- a/doc/html/loop/structure_db.html +++ b/doc/html/loop/structure_db.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Structural Data — ProMod3 1.2.0 documentation</title> + <title>Structural Data — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="loop - Loop Handling" href="index.html" /> <link rel="next" title="Handling All Atom Positions" href="all_atom.html" /> <link rel="prev" title="Sampling Dihedral Angles" href="torsion_sampler.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -173,8 +175,8 @@ implement your own accessor object, thats the information you want to store.</p> <h2>The Structure Database<a class="headerlink" href="#the-structure-database" title="Permalink to this headline">¶</a></h2> <p>The following code example demonstrates how to create a structural database and fill it with content.</p> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">promod3</span> <span class="kn">import</span> <span class="n">loop</span> -<span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">seq</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="kn">from</span> <span class="nn">promod3</span> <span class="k">import</span> <span class="n">loop</span> +<span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">seq</span> <span class="kn">import</span> <span class="nn">os</span> <span class="c1"># StructureDB where all data get extracted</span> @@ -327,7 +329,7 @@ less machine-dependent).</p> <tr class="field-odd field"><th class="field-name">Return type:</th><td class="field-body"><a class="reference internal" href="#promod3.loop.StructureDB" title="promod3.loop.StructureDB"><code class="xref py py-class docutils literal"><span class="pre">StructureDB</span></code></a></td> </tr> <tr class="field-even field"><th class="field-name">Raises:</th><td class="field-body"><a class="reference external" href="https://docs.python.org/2.7/library/exceptions.html#exceptions.RuntimeError" title="(in Python v2.7)"><code class="xref py py-exc docutils literal"><span class="pre">RuntimeError</span></code></a> if file cannot be opened or if -file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> for details).</td> +file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details).</td> </tr> </tbody> </table> @@ -339,7 +341,7 @@ file cannot be parsed (see <a class="reference internal" href="../portableIO.htm <dt id="promod3.loop.StructureDB.SavePortable"> <code class="descname">SavePortable</code><span class="sig-paren">(</span><em>filename</em><span class="sig-paren">)</span><a class="headerlink" href="#promod3.loop.StructureDB.SavePortable" title="Permalink to this definition">¶</a></dt> <dd><p>Saves a raw / portable binary representation. Use portable files for -distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> +distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details.</p> <table class="docutils field-list" frame="void" rules="none"> <col class="field-name" /> @@ -810,8 +812,8 @@ between the N-stem C atom and the C-stem N atom). It can therefore be searched for fragments matching a certain geometry of N and C stems. The bins are accessed through a hash table, making searching the database ultra fast.</p> <p>This example illustrates how to create a custom FragDB based on a StructureDB:</p> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span> -<span class="kn">from</span> <span class="nn">promod3</span> <span class="kn">import</span> <span class="n">loop</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">io</span> +<span class="kn">from</span> <span class="nn">promod3</span> <span class="k">import</span> <span class="n">loop</span> <span class="c1"># let's load the default structure_db </span> <span class="n">structure_db</span> <span class="o">=</span> <span class="n">loop</span><span class="o">.</span><span class="n">StructureDB</span><span class="o">.</span><span class="n">LoadPortable</span><span class="p">(</span><span class="s2">"data/port_str_db.dat"</span><span class="p">)</span> @@ -880,7 +882,7 @@ less machine-dependent).</p> <tr class="field-odd field"><th class="field-name">Return type:</th><td class="field-body"><a class="reference internal" href="#promod3.loop.FragDB" title="promod3.loop.FragDB"><code class="xref py py-class docutils literal"><span class="pre">FragDB</span></code></a></td> </tr> <tr class="field-even field"><th class="field-name">Raises:</th><td class="field-body"><a class="reference external" href="https://docs.python.org/2.7/library/exceptions.html#exceptions.RuntimeError" title="(in Python v2.7)"><code class="xref py py-exc docutils literal"><span class="pre">RuntimeError</span></code></a> if file cannot be opened or if -file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> for details).</td> +file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details).</td> </tr> </tbody> </table> @@ -892,7 +894,7 @@ file cannot be parsed (see <a class="reference internal" href="../portableIO.htm <dt id="promod3.loop.FragDB.SavePortable"> <code class="descname">SavePortable</code><span class="sig-paren">(</span><em>filename</em><span class="sig-paren">)</span><a class="headerlink" href="#promod3.loop.FragDB.SavePortable" title="Permalink to this definition">¶</a></dt> <dd><p>Saves a raw / portable binary representation. Use portable files for -distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> +distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details.</p> <table class="docutils field-list" frame="void" rules="none"> <col class="field-name" /> @@ -1120,8 +1122,8 @@ fragment from the <a class="reference internal" href="#promod3.loop.StructureDB" in between them. The scores are calculated as L1 distances between the profile columns. In this case, the amino acid frequencies extracted from structural alignments are used.</li> </ul> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">seq</span> -<span class="kn">from</span> <span class="nn">promod3</span> <span class="kn">import</span> <span class="n">loop</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">seq</span> +<span class="kn">from</span> <span class="nn">promod3</span> <span class="k">import</span> <span class="n">loop</span> <span class="c1"># load an example structure</span> <span class="n">prot</span> <span class="o">=</span> <span class="n">io</span><span class="o">.</span><span class="n">LoadPDB</span><span class="p">(</span><span class="s1">'data/1CRN.pdb'</span><span class="p">)</span> @@ -1151,13 +1153,13 @@ In this case, the amino acid frequencies extracted from structural alignments ar <span class="c1"># let's see how good the fragments are...</span> <span class="n">below_three</span> <span class="o">=</span> <span class="mi">0</span> <span class="k">for</span> <span class="n">i</span> <span class="ow">in</span> <span class="nb">range</span><span class="p">(</span><span class="nb">len</span><span class="p">(</span><span class="n">fragger</span><span class="p">)):</span> - <span class="n">ca_rmsd</span> <span class="o">=</span> <span class="n">fragger</span><span class="p">[</span><span class="n">i</span><span class="p">]</span><span class="o">.</span><span class="n">CARMSD</span><span class="p">(</span><span class="n">ref_backbone</span><span class="p">,</span><span class="bp">True</span><span class="p">)</span> - <span class="k">print</span> <span class="s2">"Fragment </span><span class="si">%d</span><span class="s2"> has CA RMSD of </span><span class="si">%.3f</span><span class="s2">"</span> <span class="o">%</span> <span class="p">(</span><span class="n">i</span><span class="p">,</span> <span class="n">ca_rmsd</span><span class="p">)</span> + <span class="n">ca_rmsd</span> <span class="o">=</span> <span class="n">fragger</span><span class="p">[</span><span class="n">i</span><span class="p">]</span><span class="o">.</span><span class="n">CARMSD</span><span class="p">(</span><span class="n">ref_backbone</span><span class="p">,</span><span class="kc">True</span><span class="p">)</span> + <span class="nb">print</span> <span class="s2">"Fragment </span><span class="si">%d</span><span class="s2"> has CA RMSD of </span><span class="si">%.3f</span><span class="s2">"</span> <span class="o">%</span> <span class="p">(</span><span class="n">i</span><span class="p">,</span> <span class="n">ca_rmsd</span><span class="p">)</span> <span class="k">if</span> <span class="n">ca_rmsd</span> <span class="o"><</span> <span class="mf">3.0</span><span class="p">:</span> <span class="n">below_three</span> <span class="o">+=</span> <span class="mi">1</span> <span class="n">fraction</span> <span class="o">=</span> <span class="nb">float</span><span class="p">(</span><span class="n">below_three</span><span class="p">)</span><span class="o">/</span><span class="nb">len</span><span class="p">(</span><span class="n">fragger</span><span class="p">)</span> -<span class="k">print</span> <span class="s2">"Fraction of fragments below 3A: </span><span class="si">%.2f</span><span class="s2">"</span> <span class="o">%</span> <span class="n">fraction</span> +<span class="nb">print</span> <span class="s2">"Fraction of fragments below 3A: </span><span class="si">%.2f</span><span class="s2">"</span> <span class="o">%</span> <span class="n">fraction</span> <span class="c1"># add into a cached map with ID based on frag_pos</span> <span class="n">fragger_map</span> <span class="o">=</span> <span class="n">loop</span><span class="o">.</span><span class="n">FraggerMap</span><span class="p">()</span> @@ -1752,9 +1754,6 @@ to <strong>to</strong>, not including <strong>to</strong> itself</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -1765,8 +1764,8 @@ to <strong>to</strong>, not including <strong>to</strong> itself</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/loop/structure_db.txt" diff --git a/doc/html/loop/torsion_sampler.html b/doc/html/loop/torsion_sampler.html index 123e1b9f..fa5416d4 100644 --- a/doc/html/loop/torsion_sampler.html +++ b/doc/html/loop/torsion_sampler.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Sampling Dihedral Angles — ProMod3 1.2.0 documentation</title> + <title>Sampling Dihedral Angles — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="loop - Loop Handling" href="index.html" /> <link rel="next" title="Structural Data" href="structure_db.html" /> <link rel="prev" title="Representing Loops" href="backbone.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -55,14 +57,14 @@ most methods which need to access a specific distribution can either take 3 residue names or an index as input.</p> <p>As a showcase example, we randomly sample from a given torsion sample and store the resulting samples as a scatter plot:</p> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">promod3</span> <span class="kn">import</span> <span class="n">loop</span> -<span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">conop</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="kn">from</span> <span class="nn">promod3</span> <span class="k">import</span> <span class="n">loop</span> +<span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">conop</span> <span class="c1"># this requires matplotlib and numpy</span> <span class="kn">import</span> <span class="nn">matplotlib</span> <span class="c1"># change next line, if you wish to use a GUI-based plot-output</span> <span class="n">matplotlib</span><span class="o">.</span><span class="n">use</span><span class="p">(</span><span class="s2">"Agg"</span><span class="p">)</span> -<span class="kn">import</span> <span class="nn">matplotlib.pyplot</span> <span class="kn">as</span> <span class="nn">plt</span> -<span class="kn">import</span> <span class="nn">numpy</span> <span class="kn">as</span> <span class="nn">np</span> +<span class="kn">import</span> <span class="nn">matplotlib.pyplot</span> <span class="k">as</span> <span class="nn">plt</span> +<span class="kn">import</span> <span class="nn">numpy</span> <span class="k">as</span> <span class="nn">np</span> <span class="c1"># load a default sampler</span> <span class="n">t_sampler</span> <span class="o">=</span> <span class="n">loop</span><span class="o">.</span><span class="n">LoadTorsionSampler</span><span class="p">()</span> @@ -174,7 +176,7 @@ less machine-dependent).</p> </td> </tr> <tr class="field-even field"><th class="field-name">Raises:</th><td class="field-body"><p class="first last"><a class="reference external" href="https://docs.python.org/2.7/library/exceptions.html#exceptions.RuntimeError" title="(in Python v2.7)"><code class="xref py py-exc docutils literal"><span class="pre">RuntimeError</span></code></a> if file cannot be opened or if -file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> for details).</p> +file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details).</p> </td> </tr> </tbody> @@ -187,7 +189,7 @@ file cannot be parsed (see <a class="reference internal" href="../portableIO.htm <dt id="promod3.loop.TorsionSampler.SavePortable"> <code class="descname">SavePortable</code><span class="sig-paren">(</span><em>filename</em><span class="sig-paren">)</span><a class="headerlink" href="#promod3.loop.TorsionSampler.SavePortable" title="Permalink to this definition">¶</a></dt> <dd><p>Saves a raw / portable binary representation. Use portable files for -distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> +distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details.</p> <table class="docutils field-list" frame="void" rules="none"> <col class="field-name" /> @@ -581,9 +583,6 @@ standard amino acid</td> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -594,8 +593,8 @@ standard amino acid</td> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/loop/torsion_sampler.txt" diff --git a/doc/html/modelling/algorithms.html b/doc/html/modelling/algorithms.html index a6d307d1..bc65d5f6 100644 --- a/doc/html/modelling/algorithms.html +++ b/doc/html/modelling/algorithms.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Modelling Algorithms — ProMod3 1.2.0 documentation</title> + <title>Modelling Algorithms — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="modelling - Protein Modelling" href="index.html" /> <link rel="next" title="sidechain - Sidechain Modelling" href="../sidechain/index.html" /> <link rel="prev" title="Sidechain Reconstruction" href="sidechain_reconstruction.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -403,9 +405,6 @@ with the keys of the scores in <strong>scorer</strong></li> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -416,8 +415,8 @@ with the keys of the scores in <strong>scorer</strong></li> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/modelling/algorithms.txt" diff --git a/doc/html/modelling/gap_handling.html b/doc/html/modelling/gap_handling.html index 186d5fed..d273996b 100644 --- a/doc/html/modelling/gap_handling.html +++ b/doc/html/modelling/gap_handling.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Handling Gaps — ProMod3 1.2.0 documentation</title> + <title>Handling Gaps — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="modelling - Protein Modelling" href="index.html" /> <link rel="next" title="Handling Loop Candidates" href="loop_candidates.html" /> <link rel="prev" title="Model Checking" href="model_checking.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -299,7 +301,7 @@ False if no new extension possible.</p> <dt id="promod3.modelling.GapExtender"> <em class="property">class </em><code class="descclassname">promod3.modelling.</code><code class="descname">GapExtender</code><span class="sig-paren">(</span><em>gap</em>, <em>seqres</em><span class="sig-paren">)</span><a class="headerlink" href="#promod3.modelling.GapExtender" title="Permalink to this definition">¶</a></dt> <dd><p>The extender cycles through the following steps:</p> -<div class="highlight-none"><div class="highlight"><pre> - +<div class="highlight-none"><div class="highlight"><pre><span></span> - -- -- --- @@ -644,9 +646,6 @@ gaps of different chains or an N-terminal gap with a C-terminal gap.</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -657,8 +656,8 @@ gaps of different chains or an N-terminal gap with a C-terminal gap.</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/modelling/gap_handling.txt" diff --git a/doc/html/modelling/index.html b/doc/html/modelling/index.html index aaf344b9..a3ac0b9c 100644 --- a/doc/html/modelling/index.html +++ b/doc/html/modelling/index.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>modelling - Protein Modelling — ProMod3 1.2.0 documentation</title> + <title>modelling - Protein Modelling — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="Documentation For Users" href="../users.html" /> <link rel="next" title="Modelling Pipeline" href="pipeline.html" /> <link rel="prev" title="Singularity" href="../container/singularity.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -49,8 +51,8 @@ capabilities to extract useful template data for the target and to fill the remaining structural data to create a full model of the target. In its simplest form, you can use a target-template alignment and a template structure to create a model fully automatically as follows:</p> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span> -<span class="kn">from</span> <span class="nn">promod3</span> <span class="kn">import</span> <span class="n">modelling</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">io</span> +<span class="kn">from</span> <span class="nn">promod3</span> <span class="k">import</span> <span class="n">modelling</span> <span class="c1"># get raw model</span> <span class="n">tpl</span> <span class="o">=</span> <span class="n">io</span><span class="o">.</span><span class="n">LoadPDB</span><span class="p">(</span><span class="s1">'data/1crn_cut.pdb'</span><span class="p">)</span> @@ -149,9 +151,6 @@ a model fully automatically as follows:</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -162,8 +161,8 @@ a model fully automatically as follows:</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/modelling/index.txt" diff --git a/doc/html/modelling/loop_candidates.html b/doc/html/modelling/loop_candidates.html index f9a06ae8..de65ccf2 100644 --- a/doc/html/modelling/loop_candidates.html +++ b/doc/html/modelling/loop_candidates.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Handling Loop Candidates — ProMod3 1.2.0 documentation</title> + <title>Handling Loop Candidates — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="modelling - Protein Modelling" href="index.html" /> <link rel="next" title="Fitting Loops Into Gaps" href="loop_closing.html" /> <link rel="prev" title="Handling Gaps" href="gap_handling.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -48,8 +50,8 @@ filled manually or generated using static filling functions using the functionality from the <a class="reference internal" href="../loop/structure_db.html#promod3.loop.FragDB" title="promod3.loop.FragDB"><code class="xref py py-class docutils literal"><span class="pre">FragDB</span></code></a> or Monte Carlo algorithms. Once it contains candidates you can apply closing, scoring or clustering algorithms on all loop candidates. Example:</p> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span> -<span class="kn">from</span> <span class="nn">promod3</span> <span class="kn">import</span> <span class="n">loop</span><span class="p">,</span> <span class="n">scoring</span><span class="p">,</span> <span class="n">modelling</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">io</span> +<span class="kn">from</span> <span class="nn">promod3</span> <span class="k">import</span> <span class="n">loop</span><span class="p">,</span> <span class="n">scoring</span><span class="p">,</span> <span class="n">modelling</span> <span class="c1"># let's load a crambin structure from the pdb</span> <span class="n">crambin</span> <span class="o">=</span> <span class="n">io</span><span class="o">.</span><span class="n">LoadPDB</span><span class="p">(</span><span class="s1">'data/1CRN.pdb'</span><span class="p">)</span> @@ -182,10 +184,10 @@ original state once the sampling is done.</p> <li><strong>num_loops</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#int" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">int</span></code></a>) – Number of loop candidates to return</li> <li><strong>steps</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#int" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">int</span></code></a>) – Number of MC steps to perform for each loop candidate generated</li> -<li><strong>sampler</strong> (<a class="reference internal" href="monte_carlo.html#mc-sampler-object"><span>Sampler Object</span></a>) – Used to generate a new configuration at each MC step</li> -<li><strong>closer</strong> (<a class="reference internal" href="monte_carlo.html#mc-closer-object"><span>Closer Object</span></a>) – Used to close the loop after each MC step</li> -<li><strong>scorer</strong> (<a class="reference internal" href="monte_carlo.html#mc-scorer-object"><span>Scorer Object</span></a>) – Used to score the generated configurations at each MC step</li> -<li><strong>cooler</strong> (<a class="reference internal" href="monte_carlo.html#mc-cooler-object"><span>Cooler Object</span></a>) – Controls the temperature profile of the simulated annealing</li> +<li><strong>sampler</strong> (<a class="reference internal" href="monte_carlo.html#mc-sampler-object"><span class="std std-ref">Sampler Object</span></a>) – Used to generate a new configuration at each MC step</li> +<li><strong>closer</strong> (<a class="reference internal" href="monte_carlo.html#mc-closer-object"><span class="std std-ref">Closer Object</span></a>) – Used to close the loop after each MC step</li> +<li><strong>scorer</strong> (<a class="reference internal" href="monte_carlo.html#mc-scorer-object"><span class="std std-ref">Scorer Object</span></a>) – Used to score the generated configurations at each MC step</li> +<li><strong>cooler</strong> (<a class="reference internal" href="monte_carlo.html#mc-cooler-object"><span class="std std-ref">Cooler Object</span></a>) – Controls the temperature profile of the simulated annealing</li> <li><strong>random_seed</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#int" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">int</span></code></a>) – Seed to feed the random number generator for accepting/rejecting proposed monte carlo steps. For every monte carlo run, the random number generator @@ -997,8 +999,8 @@ gap for a model. This shows the combined usage of <a class="reference internal" keep a consistent modelling environment, <a class="reference internal" href="#promod3.modelling.LoopCandidates" title="promod3.modelling.LoopCandidates"><code class="xref py py-class docutils literal"><span class="pre">LoopCandidates</span></code></a> with its scoring routines, <a class="reference internal" href="#promod3.modelling.ScoreContainer" title="promod3.modelling.ScoreContainer"><code class="xref py py-class docutils literal"><span class="pre">ScoreContainer</span></code></a> for keeping track of scores and <a class="reference internal" href="#promod3.modelling.ScoringWeights" title="promod3.modelling.ScoringWeights"><code class="xref py py-class docutils literal"><span class="pre">ScoringWeights</span></code></a> to combine scores:</p> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">seq</span> -<span class="kn">from</span> <span class="nn">promod3</span> <span class="kn">import</span> <span class="n">modelling</span><span class="p">,</span> <span class="n">loop</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">seq</span> +<span class="kn">from</span> <span class="nn">promod3</span> <span class="k">import</span> <span class="n">modelling</span><span class="p">,</span> <span class="n">loop</span> <span class="c1"># setup raw model</span> <span class="n">tpl</span> <span class="o">=</span> <span class="n">io</span><span class="o">.</span><span class="n">LoadPDB</span><span class="p">(</span><span class="s1">'data/1crn_cut.pdb'</span><span class="p">)</span> @@ -1008,7 +1010,7 @@ scoring routines, <a class="reference internal" href="#promod3.modelling.ScoreCo <span class="n">seq</span><span class="o">.</span><span class="n">CreateSequence</span><span class="p">(</span><span class="s1">'tpl'</span><span class="p">,</span> <span class="n">seq_tpl</span><span class="p">))</span> <span class="n">aln</span><span class="o">.</span><span class="n">AttachView</span><span class="p">(</span><span class="mi">1</span><span class="p">,</span> <span class="n">tpl</span><span class="o">.</span><span class="n">CreateFullView</span><span class="p">())</span> <span class="n">mhandle</span> <span class="o">=</span> <span class="n">modelling</span><span class="o">.</span><span class="n">BuildRawModel</span><span class="p">(</span><span class="n">aln</span><span class="p">)</span> -<span class="k">print</span><span class="p">(</span><span class="s2">"Number of gaps in raw model: </span><span class="si">%d</span><span class="s2">"</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">mhandle</span><span class="o">.</span><span class="n">gaps</span><span class="p">))</span> +<span class="nb">print</span><span class="p">(</span><span class="s2">"Number of gaps in raw model: </span><span class="si">%d</span><span class="s2">"</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">mhandle</span><span class="o">.</span><span class="n">gaps</span><span class="p">))</span> <span class="c1"># setup default scorers for modelling handle</span> <span class="n">modelling</span><span class="o">.</span><span class="n">SetupDefaultBackboneScoring</span><span class="p">(</span><span class="n">mhandle</span><span class="p">)</span> @@ -1021,7 +1023,7 @@ scoring routines, <a class="reference internal" href="#promod3.modelling.ScoreCo <span class="c1"># get data for gap to close</span> <span class="n">gap</span> <span class="o">=</span> <span class="n">mhandle</span><span class="o">.</span><span class="n">gaps</span><span class="p">[</span><span class="mi">0</span><span class="p">]</span><span class="o">.</span><span class="n">Copy</span><span class="p">()</span> -<span class="k">print</span><span class="p">(</span><span class="s2">"Gap to close: </span><span class="si">%s</span><span class="s2">"</span> <span class="o">%</span> <span class="nb">str</span><span class="p">(</span><span class="n">gap</span><span class="p">))</span> +<span class="nb">print</span><span class="p">(</span><span class="s2">"Gap to close: </span><span class="si">%s</span><span class="s2">"</span> <span class="o">%</span> <span class="nb">str</span><span class="p">(</span><span class="n">gap</span><span class="p">))</span> <span class="n">n_stem</span> <span class="o">=</span> <span class="n">gap</span><span class="o">.</span><span class="n">before</span> <span class="n">c_stem</span> <span class="o">=</span> <span class="n">gap</span><span class="o">.</span><span class="n">after</span> <span class="n">start_resnum</span> <span class="o">=</span> <span class="n">n_stem</span><span class="o">.</span><span class="n">GetNumber</span><span class="p">()</span><span class="o">.</span><span class="n">GetNum</span><span class="p">()</span> @@ -1030,19 +1032,19 @@ scoring routines, <a class="reference internal" href="#promod3.modelling.ScoreCo <span class="c1"># get loop candidates from FragDB</span> <span class="n">candidates</span> <span class="o">=</span> <span class="n">modelling</span><span class="o">.</span><span class="n">LoopCandidates</span><span class="o">.</span><span class="n">FillFromDatabase</span><span class="p">(</span>\ <span class="n">n_stem</span><span class="p">,</span> <span class="n">c_stem</span><span class="p">,</span> <span class="n">gap</span><span class="o">.</span><span class="n">full_seq</span><span class="p">,</span> <span class="n">frag_db</span><span class="p">,</span> <span class="n">structure_db</span><span class="p">)</span> -<span class="k">print</span><span class="p">(</span><span class="s2">"Number of loop candidates: </span><span class="si">%d</span><span class="s2">"</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">candidates</span><span class="p">))</span> +<span class="nb">print</span><span class="p">(</span><span class="s2">"Number of loop candidates: </span><span class="si">%d</span><span class="s2">"</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">candidates</span><span class="p">))</span> <span class="c1"># all scores will be kept in a score container which we update</span> <span class="n">all_scores</span> <span class="o">=</span> <span class="n">modelling</span><span class="o">.</span><span class="n">ScoreContainer</span><span class="p">()</span> <span class="c1"># the keys used to identify scores are globally defined</span> -<span class="k">print</span><span class="p">(</span><span class="s2">"Stem RMSD key = '</span><span class="si">%s</span><span class="s2">'"</span> \ +<span class="nb">print</span><span class="p">(</span><span class="s2">"Stem RMSD key = '</span><span class="si">%s</span><span class="s2">'"</span> \ <span class="o">%</span> <span class="n">modelling</span><span class="o">.</span><span class="n">ScoringWeights</span><span class="o">.</span><span class="n">GetStemRMSDsKey</span><span class="p">())</span> -<span class="k">print</span><span class="p">(</span><span class="s2">"Profile keys = ['</span><span class="si">%s</span><span class="s2">', '</span><span class="si">%s</span><span class="s2">']"</span> \ +<span class="nb">print</span><span class="p">(</span><span class="s2">"Profile keys = ['</span><span class="si">%s</span><span class="s2">', '</span><span class="si">%s</span><span class="s2">']"</span> \ <span class="o">%</span> <span class="p">(</span><span class="n">modelling</span><span class="o">.</span><span class="n">ScoringWeights</span><span class="o">.</span><span class="n">GetSequenceProfileScoresKey</span><span class="p">(),</span> <span class="n">modelling</span><span class="o">.</span><span class="n">ScoringWeights</span><span class="o">.</span><span class="n">GetStructureProfileScoresKey</span><span class="p">()))</span> -<span class="k">print</span><span class="p">(</span><span class="s2">"Backbone scoring keys = </span><span class="si">%s</span><span class="s2">"</span> \ +<span class="nb">print</span><span class="p">(</span><span class="s2">"Backbone scoring keys = </span><span class="si">%s</span><span class="s2">"</span> \ <span class="o">%</span> <span class="nb">str</span><span class="p">(</span><span class="n">modelling</span><span class="o">.</span><span class="n">ScoringWeights</span><span class="o">.</span><span class="n">GetBackboneScoringKeys</span><span class="p">()))</span> -<span class="k">print</span><span class="p">(</span><span class="s2">"All atom scoring keys = </span><span class="si">%s</span><span class="s2">"</span> \ +<span class="nb">print</span><span class="p">(</span><span class="s2">"All atom scoring keys = </span><span class="si">%s</span><span class="s2">"</span> \ <span class="o">%</span> <span class="nb">str</span><span class="p">(</span><span class="n">modelling</span><span class="o">.</span><span class="n">ScoringWeights</span><span class="o">.</span><span class="n">GetAllAtomScoringKeys</span><span class="p">()))</span> <span class="c1"># get stem RMSDs for each candidate (i.e. how well does it fit?)</span> @@ -1051,7 +1053,7 @@ scoring routines, <a class="reference internal" href="#promod3.modelling.ScoreCo <span class="c1"># close the candidates with CCD</span> <span class="n">orig_indices</span> <span class="o">=</span> <span class="n">candidates</span><span class="o">.</span><span class="n">ApplyCCD</span><span class="p">(</span><span class="n">n_stem</span><span class="p">,</span> <span class="n">c_stem</span><span class="p">,</span> <span class="n">torsion_sampler</span><span class="p">)</span> -<span class="k">print</span><span class="p">(</span><span class="s2">"Number of closed loop candidates: </span><span class="si">%d</span><span class="s2">"</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">candidates</span><span class="p">))</span> +<span class="nb">print</span><span class="p">(</span><span class="s2">"Number of closed loop candidates: </span><span class="si">%d</span><span class="s2">"</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">candidates</span><span class="p">))</span> <span class="c1"># get subset of previously computed scores</span> <span class="n">all_scores</span> <span class="o">=</span> <span class="n">all_scores</span><span class="o">.</span><span class="n">Extract</span><span class="p">(</span><span class="n">orig_indices</span><span class="p">)</span> @@ -1068,20 +1070,20 @@ scoring routines, <a class="reference internal" href="#promod3.modelling.ScoreCo <span class="n">candidates</span><span class="o">.</span><span class="n">CalculateAllAtomScores</span><span class="p">(</span><span class="n">all_scores</span><span class="p">,</span> <span class="n">mhandle</span><span class="p">,</span> <span class="n">start_resnum</span><span class="p">)</span> <span class="c1"># use default weights to combine scores</span> -<span class="n">weights</span> <span class="o">=</span> <span class="n">modelling</span><span class="o">.</span><span class="n">ScoringWeights</span><span class="o">.</span><span class="n">GetWeights</span><span class="p">(</span><span class="n">with_db</span><span class="o">=</span><span class="bp">True</span><span class="p">,</span> - <span class="n">with_aa</span><span class="o">=</span><span class="bp">True</span><span class="p">)</span> +<span class="n">weights</span> <span class="o">=</span> <span class="n">modelling</span><span class="o">.</span><span class="n">ScoringWeights</span><span class="o">.</span><span class="n">GetWeights</span><span class="p">(</span><span class="n">with_db</span><span class="o">=</span><span class="kc">True</span><span class="p">,</span> + <span class="n">with_aa</span><span class="o">=</span><span class="kc">True</span><span class="p">)</span> <span class="n">scores</span> <span class="o">=</span> <span class="n">all_scores</span><span class="o">.</span><span class="n">LinearCombine</span><span class="p">(</span><span class="n">weights</span><span class="p">)</span> <span class="c1"># rank them (best = lowest "score")</span> <span class="n">arg_sorted_scores</span> <span class="o">=</span> <span class="nb">sorted</span><span class="p">([(</span><span class="n">v</span><span class="p">,</span><span class="n">i</span><span class="p">)</span> <span class="k">for</span> <span class="n">i</span><span class="p">,</span><span class="n">v</span> <span class="ow">in</span> <span class="nb">enumerate</span><span class="p">(</span><span class="n">scores</span><span class="p">)])</span> -<span class="k">print</span><span class="p">(</span><span class="s2">"Ranked candidates: score, index"</span><span class="p">)</span> +<span class="nb">print</span><span class="p">(</span><span class="s2">"Ranked candidates: score, index"</span><span class="p">)</span> <span class="k">for</span> <span class="n">v</span><span class="p">,</span><span class="n">i</span> <span class="ow">in</span> <span class="n">arg_sorted_scores</span><span class="p">:</span> - <span class="k">print</span><span class="p">(</span><span class="s2">"</span><span class="si">%g</span><span class="s2">, </span><span class="si">%d</span><span class="s2">"</span> <span class="o">%</span> <span class="p">(</span><span class="n">v</span><span class="p">,</span><span class="n">i</span><span class="p">))</span> + <span class="nb">print</span><span class="p">(</span><span class="s2">"</span><span class="si">%g</span><span class="s2">, </span><span class="si">%d</span><span class="s2">"</span> <span class="o">%</span> <span class="p">(</span><span class="n">v</span><span class="p">,</span><span class="n">i</span><span class="p">))</span> <span class="c1"># insert best into model, update scorers and clear gaps</span> <span class="n">best_candidate</span> <span class="o">=</span> <span class="n">candidates</span><span class="p">[</span><span class="n">arg_sorted_scores</span><span class="p">[</span><span class="mi">0</span><span class="p">][</span><span class="mi">1</span><span class="p">]]</span> <span class="n">modelling</span><span class="o">.</span><span class="n">InsertLoopClearGaps</span><span class="p">(</span><span class="n">mhandle</span><span class="p">,</span> <span class="n">best_candidate</span><span class="p">,</span> <span class="n">gap</span><span class="p">)</span> -<span class="k">print</span><span class="p">(</span><span class="s2">"Number of gaps in closed model: </span><span class="si">%d</span><span class="s2">"</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">mhandle</span><span class="o">.</span><span class="n">gaps</span><span class="p">))</span> +<span class="nb">print</span><span class="p">(</span><span class="s2">"Number of gaps in closed model: </span><span class="si">%d</span><span class="s2">"</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">mhandle</span><span class="o">.</span><span class="n">gaps</span><span class="p">))</span> <span class="n">io</span><span class="o">.</span><span class="n">SavePDB</span><span class="p">(</span><span class="n">mhandle</span><span class="o">.</span><span class="n">model</span><span class="p">,</span> <span class="s2">"model.pdb"</span><span class="p">)</span> </pre></div> </div> @@ -1131,9 +1133,6 @@ scoring routines, <a class="reference internal" href="#promod3.modelling.ScoreCo <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -1144,8 +1143,8 @@ scoring routines, <a class="reference internal" href="#promod3.modelling.ScoreCo ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/modelling/loop_candidates.txt" diff --git a/doc/html/modelling/loop_closing.html b/doc/html/modelling/loop_closing.html index 7db018c1..52ebde20 100644 --- a/doc/html/modelling/loop_closing.html +++ b/doc/html/modelling/loop_closing.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Fitting Loops Into Gaps — ProMod3 1.2.0 documentation</title> + <title>Fitting Loops Into Gaps — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="modelling - Protein Modelling" href="index.html" /> <link rel="next" title="Generating Loops De Novo" href="monte_carlo.html" /> <link rel="prev" title="Handling Loop Candidates" href="loop_candidates.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -469,8 +471,8 @@ means no cutoff.</td> <a class="reference internal" href="sidechain_reconstruction.html#promod3.modelling.SidechainReconstructor" title="promod3.modelling.SidechainReconstructor"><code class="xref py py-class docutils literal"><span class="pre">SidechainReconstructor</span></code></a>, it may be desired to quickly relax the loop. The <a class="reference internal" href="#promod3.modelling.AllAtomRelaxer" title="promod3.modelling.AllAtomRelaxer"><code class="xref py py-class docutils literal"><span class="pre">AllAtomRelaxer</span></code></a> class takes care of that.</p> <p>Example usage:</p> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span> -<span class="kn">from</span> <span class="nn">promod3</span> <span class="kn">import</span> <span class="n">modelling</span><span class="p">,</span> <span class="n">loop</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">io</span> +<span class="kn">from</span> <span class="nn">promod3</span> <span class="k">import</span> <span class="n">modelling</span><span class="p">,</span> <span class="n">loop</span> <span class="c1"># load example (has res. numbering starting at 1)</span> <span class="n">prot</span> <span class="o">=</span> <span class="n">io</span><span class="o">.</span><span class="n">LoadPDB</span><span class="p">(</span><span class="s1">'data/1CRN.pdb'</span><span class="p">)</span> @@ -491,7 +493,7 @@ quickly relax the loop. The <a class="reference internal" href="#promod3.modelli <span class="n">relaxer</span> <span class="o">=</span> <span class="n">modelling</span><span class="o">.</span><span class="n">AllAtomRelaxer</span><span class="p">(</span><span class="n">sc_result</span><span class="p">,</span> <span class="n">mm_sys</span><span class="p">)</span> <span class="c1"># relax loop</span> <span class="n">pot_e</span> <span class="o">=</span> <span class="n">relaxer</span><span class="o">.</span><span class="n">Run</span><span class="p">(</span><span class="n">sc_result</span><span class="p">,</span> <span class="mi">300</span><span class="p">,</span> <span class="mf">0.1</span><span class="p">)</span> -<span class="k">print</span> <span class="s2">"Potential energy after: </span><span class="si">%g</span><span class="s2">"</span> <span class="o">%</span> <span class="n">pot_e</span> +<span class="nb">print</span> <span class="s2">"Potential energy after: </span><span class="si">%g</span><span class="s2">"</span> <span class="o">%</span> <span class="n">pot_e</span> <span class="c1"># update environment with solution</span> <span class="n">env</span><span class="o">.</span><span class="n">SetEnvironment</span><span class="p">(</span><span class="n">sc_result</span><span class="o">.</span><span class="n">env_pos</span><span class="p">)</span> <span class="c1"># store all positions of environment</span> @@ -634,9 +636,6 @@ the one given in the constructor.</td> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -647,8 +646,8 @@ the one given in the constructor.</td> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/modelling/loop_closing.txt" diff --git a/doc/html/modelling/model_checking.html b/doc/html/modelling/model_checking.html index 72ee3c89..906b67d1 100644 --- a/doc/html/modelling/model_checking.html +++ b/doc/html/modelling/model_checking.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Model Checking — ProMod3 1.2.0 documentation</title> + <title>Model Checking — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="modelling - Protein Modelling" href="index.html" /> <link rel="next" title="Handling Gaps" href="gap_handling.html" /> <link rel="prev" title="Modelling Pipeline" href="pipeline.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -153,7 +155,7 @@ See <a class="reference internal" href="#promod3.modelling.FilterCandidates" tit <code class="descclassname">promod3.modelling.</code><code class="descname">RunMolProbity</code><span class="sig-paren">(</span><em>target_pdb</em>, <em>molprobity_bin=None</em><span class="sig-paren">)</span><a class="reference internal" href="../_modules/promod3/modelling/_molprobity.html#RunMolProbity"><span class="viewcode-link">[source]</span></a><a class="headerlink" href="#promod3.modelling.RunMolProbity" title="Permalink to this definition">¶</a></dt> <dd><p>Run <code class="docutils literal"><span class="pre">MolProbity</span></code> from <code class="docutils literal"><span class="pre">Phenix</span></code> on a given PDB file.</p> <p>MolProbity score computation: (formula from molprobity source code)</p> -<div class="highlight-python"><div class="highlight"><pre><span class="n">clashscore</span> <span class="o">=</span> <span class="n">result</span><span class="p">[</span><span class="s2">"Clashscore"</span><span class="p">]</span> +<div class="highlight-python"><div class="highlight"><pre><span></span><span class="n">clashscore</span> <span class="o">=</span> <span class="n">result</span><span class="p">[</span><span class="s2">"Clashscore"</span><span class="p">]</span> <span class="n">rota_out</span> <span class="o">=</span> <span class="n">result</span><span class="p">[</span><span class="s2">"Rotamer outliers"</span><span class="p">]</span> <span class="n">rama_iffy</span> <span class="o">=</span> <span class="mf">100.</span> <span class="o">-</span> <span class="n">result</span><span class="p">[</span><span class="s2">"Ramachandran favored"</span><span class="p">]</span> <span class="n">mpscore</span> <span class="o">=</span> <span class="p">((</span> <span class="mf">0.426</span> <span class="o">*</span> <span class="n">math</span><span class="o">.</span><span class="n">log</span><span class="p">(</span><span class="mi">1</span> <span class="o">+</span> <span class="n">clashscore</span><span class="p">)</span> <span class="p">)</span> <span class="o">+</span> @@ -274,9 +276,6 @@ executable is not found.</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -287,8 +286,8 @@ executable is not found.</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/modelling/model_checking.txt" diff --git a/doc/html/modelling/monte_carlo.html b/doc/html/modelling/monte_carlo.html index ff74d9bd..8186f355 100644 --- a/doc/html/modelling/monte_carlo.html +++ b/doc/html/modelling/monte_carlo.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Generating Loops De Novo — ProMod3 1.2.0 documentation</title> + <title>Generating Loops De Novo — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="modelling - Protein Modelling" href="index.html" /> <link rel="next" title="Sidechain Reconstruction" href="sidechain_reconstruction.html" /> <link rel="prev" title="Fitting Loops Into Gaps" href="loop_closing.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -47,19 +49,19 @@ novo structure candidates for loops or N-/C-Termini. Every iteration of the sampling process consists basically of four steps and we define objects for each step:</p> <ul class="simple"> -<li><a class="reference internal" href="#mc-sampler-object"><span>Sampler Object</span></a>: Propose new conformation</li> -<li><a class="reference internal" href="#mc-closer-object"><span>Closer Object</span></a>: Adapt new conformation to the environment</li> -<li><a class="reference internal" href="#mc-scorer-object"><span>Scorer Object</span></a>: Score the new conformation</li> -<li><a class="reference internal" href="#mc-cooler-object"><span>Cooler Object</span></a>: Accept/Reject new conformation based on the score and +<li><a class="reference internal" href="#mc-sampler-object"><span class="std std-ref">Sampler Object</span></a>: Propose new conformation</li> +<li><a class="reference internal" href="#mc-closer-object"><span class="std std-ref">Closer Object</span></a>: Adapt new conformation to the environment</li> +<li><a class="reference internal" href="#mc-scorer-object"><span class="std std-ref">Scorer Object</span></a>: Score the new conformation</li> +<li><a class="reference internal" href="#mc-cooler-object"><span class="std std-ref">Cooler Object</span></a>: Accept/Reject new conformation based on the score and a temperature controlled Metropolis criterion</li> </ul> <p>These steps can be arbitrarily combined to generate custom Monte Carlo sampling pipelines. This combination either happens manually or by using the convenient <a class="reference internal" href="#promod3.modelling.SampleMonteCarlo" title="promod3.modelling.SampleMonteCarlo"><code class="xref py py-func docutils literal"><span class="pre">SampleMonteCarlo()</span></code></a> function. For example, here we show how to apply Monte Carlo sampling to the N-terminal part of crambin:</p> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span> -<span class="kn">from</span> <span class="nn">promod3</span> <span class="kn">import</span> <span class="n">loop</span><span class="p">,</span> <span class="n">scoring</span><span class="p">,</span> <span class="n">modelling</span> -<span class="kn">import</span> <span class="nn">numpy</span> <span class="kn">as</span> <span class="nn">np</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">io</span> +<span class="kn">from</span> <span class="nn">promod3</span> <span class="k">import</span> <span class="n">loop</span><span class="p">,</span> <span class="n">scoring</span><span class="p">,</span> <span class="n">modelling</span> +<span class="kn">import</span> <span class="nn">numpy</span> <span class="k">as</span> <span class="nn">np</span> <span class="c1"># setup protein</span> <span class="n">prot</span> <span class="o">=</span> <span class="n">io</span><span class="o">.</span><span class="n">LoadPDB</span><span class="p">(</span><span class="s1">'data/1CRN.pdb'</span><span class="p">)</span> @@ -104,7 +106,7 @@ Carlo sampling to the N-terminal part of crambin:</p> <span class="c1"># shake it!</span> <span class="n">modelling</span><span class="o">.</span><span class="n">SampleMonteCarlo</span><span class="p">(</span><span class="n">mc_sampler</span><span class="p">,</span> <span class="n">mc_closer</span><span class="p">,</span> <span class="n">mc_scorer</span><span class="p">,</span> - <span class="n">mc_cooler</span><span class="p">,</span> <span class="mi">10000</span><span class="p">,</span> <span class="n">bb_list</span><span class="p">,</span> <span class="bp">False</span><span class="p">,</span> <span class="mi">0</span><span class="p">)</span> + <span class="n">mc_cooler</span><span class="p">,</span> <span class="mi">10000</span><span class="p">,</span> <span class="n">bb_list</span><span class="p">,</span> <span class="kc">False</span><span class="p">,</span> <span class="mi">0</span><span class="p">)</span> <span class="c1"># save down the result</span> <span class="n">io</span><span class="o">.</span><span class="n">SavePDB</span><span class="p">(</span><span class="n">bb_list</span><span class="o">.</span><span class="n">ToEntity</span><span class="p">(),</span> <span class="s2">"sampled_frag.pdb"</span><span class="p">)</span> @@ -127,12 +129,12 @@ accepted proposal.</p> <col class="field-body" /> <tbody valign="top"> <tr class="field-odd field"><th class="field-name">Parameters:</th><td class="field-body"><ul class="first last simple"> -<li><strong>sampler</strong> (<a class="reference internal" href="#mc-sampler-object"><span>Sampler Object</span></a>) – Sampler object capable of initializing and altering +<li><strong>sampler</strong> (<a class="reference internal" href="#mc-sampler-object"><span class="std std-ref">Sampler Object</span></a>) – Sampler object capable of initializing and altering conformations.</li> -<li><strong>closer</strong> (<a class="reference internal" href="#mc-closer-object"><span>Closer Object</span></a>) – Closer object to adapt a new conformation to +<li><strong>closer</strong> (<a class="reference internal" href="#mc-closer-object"><span class="std std-ref">Closer Object</span></a>) – Closer object to adapt a new conformation to the environment.</li> -<li><strong>scorer</strong> (<a class="reference internal" href="#mc-scorer-object"><span>Scorer Object</span></a>) – Scorer object to score new loop conformations.</li> -<li><strong>cooler</strong> (<a class="reference internal" href="#mc-cooler-object"><span>Cooler Object</span></a>) – Cooler object to control the temperature of the +<li><strong>scorer</strong> (<a class="reference internal" href="#mc-scorer-object"><span class="std std-ref">Scorer Object</span></a>) – Scorer object to score new loop conformations.</li> +<li><strong>cooler</strong> (<a class="reference internal" href="#mc-cooler-object"><span class="std std-ref">Cooler Object</span></a>) – Cooler object to control the temperature of the Monte Carlo trajectory.</li> <li><strong>steps</strong> (<a class="reference external" href="https://docs.python.org/2.7/library/functions.html#int" title="(in Python v2.7)"><code class="xref py py-class docutils literal"><span class="pre">int</span></code></a>) – Number of Monte Carlo iterations to be performed.</li> <li><strong>bb_list</strong> (<a class="reference internal" href="../loop/backbone.html#promod3.loop.BackboneList" title="promod3.loop.BackboneList"><code class="xref py py-class docutils literal"><span class="pre">BackboneList</span></code></a>) – The chosen conformation gets stored here.</li> @@ -185,7 +187,7 @@ parameter. Sequence / length stay the same.</td> <dt id="promod3.modelling.SamplerBase.ProposeStep"> <code class="descname">ProposeStep</code><span class="sig-paren">(</span><em>actual_positions</em>, <em>proposed_positions</em><span class="sig-paren">)</span><a class="headerlink" href="#promod3.modelling.SamplerBase.ProposeStep" title="Permalink to this definition">¶</a></dt> <dd><p>Takes current positions and proposes a new conformation. There is no -guarantee on maintining any special RT state. The <a class="reference internal" href="#mc-closer-object"><span>Closer Object</span></a> +guarantee on maintining any special RT state. The <a class="reference internal" href="#mc-closer-object"><span class="std std-ref">Closer Object</span></a> is supposed to sort that out.</p> <table class="docutils field-list" frame="void" rules="none"> <col class="field-name" /> @@ -931,9 +933,6 @@ internal counter to 0</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -944,8 +943,8 @@ internal counter to 0</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/modelling/monte_carlo.txt" diff --git a/doc/html/modelling/pipeline.html b/doc/html/modelling/pipeline.html index 3fee1ffc..7d998f48 100644 --- a/doc/html/modelling/pipeline.html +++ b/doc/html/modelling/pipeline.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Modelling Pipeline — ProMod3 1.2.0 documentation</title> + <title>Modelling Pipeline — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="modelling - Protein Modelling" href="index.html" /> <link rel="next" title="Model Checking" href="model_checking.html" /> <link rel="prev" title="modelling - Protein Modelling" href="index.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -59,8 +61,8 @@ heuristics)</li> with the <a class="reference internal" href="#promod3.modelling.BuildFromRawModel" title="promod3.modelling.BuildFromRawModel"><code class="xref py py-func docutils literal"><span class="pre">BuildFromRawModel()</span></code></a> function. If you want to run and tweak the internal steps, you can start with the following code and adapt it to your purposes:</p> -<div class="highlight-python" id="modelling-steps-example"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span> -<span class="kn">from</span> <span class="nn">promod3</span> <span class="kn">import</span> <span class="n">modelling</span><span class="p">,</span> <span class="n">loop</span> +<div class="highlight-default" id="modelling-steps-example"><div class="highlight"><pre><span></span><span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">io</span> +<span class="kn">from</span> <span class="nn">promod3</span> <span class="k">import</span> <span class="n">modelling</span><span class="p">,</span> <span class="n">loop</span> <span class="c1"># setup</span> <span class="n">merge_distance</span> <span class="o">=</span> <span class="mi">4</span> @@ -394,7 +396,7 @@ the resulting model will always start its residue numbering at 1)</li> <dd><p>Build a model starting with a raw model (see <a class="reference internal" href="#promod3.modelling.BuildRawModel" title="promod3.modelling.BuildRawModel"><code class="xref py py-func docutils literal"><span class="pre">BuildRawModel()</span></code></a>).</p> <p>This function implements a recommended pipeline to generate complete models from a raw model. The steps are shown in detail in the code example -<a class="reference internal" href="#modelling-steps-example"><span>above</span></a>. If you wish to use your own +<a class="reference internal" href="#modelling-steps-example"><span class="std std-ref">above</span></a>. If you wish to use your own pipeline, you can use that code as a starting point for your own custom modelling pipeline. For reproducibility, we recommend that you keep copies of custom pipelines.</p> @@ -734,8 +736,8 @@ Before diving into the more demanding tasks in modeling, those may be closed already in the raw-model. After closure some checks are done to see if the solution is stereochemically sensible.</p> <p>Closed gaps are removed from <code class="xref py py-attr docutils literal"><span class="pre">mhandle.gaps</span></code>.</p> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">seq</span> -<span class="kn">from</span> <span class="nn">promod3</span> <span class="kn">import</span> <span class="n">modelling</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">seq</span> +<span class="kn">from</span> <span class="nn">promod3</span> <span class="k">import</span> <span class="n">modelling</span> <span class="c1"># setup</span> <span class="n">tpl</span> <span class="o">=</span> <span class="n">io</span><span class="o">.</span><span class="n">LoadPDB</span><span class="p">(</span><span class="s1">'data/gly.pdb'</span><span class="p">)</span> @@ -744,9 +746,9 @@ solution is stereochemically sensible.</p> <span class="n">aln</span><span class="o">.</span><span class="n">AttachView</span><span class="p">(</span><span class="mi">1</span><span class="p">,</span> <span class="n">tpl</span><span class="o">.</span><span class="n">CreateFullView</span><span class="p">())</span> <span class="n">mhandle</span> <span class="o">=</span> <span class="n">modelling</span><span class="o">.</span><span class="n">BuildRawModel</span><span class="p">(</span><span class="n">aln</span><span class="p">)</span> <span class="c1"># close small deletion</span> -<span class="k">print</span> <span class="s1">'Number of gaps before: </span><span class="si">%d</span><span class="s1">'</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">mhandle</span><span class="o">.</span><span class="n">gaps</span><span class="p">)</span> +<span class="nb">print</span> <span class="s1">'Number of gaps before: </span><span class="si">%d</span><span class="s1">'</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">mhandle</span><span class="o">.</span><span class="n">gaps</span><span class="p">)</span> <span class="n">modelling</span><span class="o">.</span><span class="n">CloseSmallDeletions</span><span class="p">(</span><span class="n">mhandle</span><span class="p">)</span> -<span class="k">print</span> <span class="s1">'Number of gaps after: </span><span class="si">%d</span><span class="s1">'</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">mhandle</span><span class="o">.</span><span class="n">gaps</span><span class="p">)</span> +<span class="nb">print</span> <span class="s1">'Number of gaps after: </span><span class="si">%d</span><span class="s1">'</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">mhandle</span><span class="o">.</span><span class="n">gaps</span><span class="p">)</span> </pre></div> </div> <table class="docutils field-list" frame="void" rules="none"> @@ -801,8 +803,8 @@ stretch of original gaps and the deleted region. Original gaps will be removed. Stem residues count to the gap, so <strong>A-A-A</strong> has a distance of 0.</p> <p>IMPORTANT: we assume here that <em>mhandle</em> stores gaps sequentially. Non-sequential gaps are ignored!</p> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">seq</span> -<span class="kn">from</span> <span class="nn">promod3</span> <span class="kn">import</span> <span class="n">modelling</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">seq</span> +<span class="kn">from</span> <span class="nn">promod3</span> <span class="k">import</span> <span class="n">modelling</span> <span class="c1"># setup</span> <span class="n">tpl</span> <span class="o">=</span> <span class="n">io</span><span class="o">.</span><span class="n">LoadPDB</span><span class="p">(</span><span class="s1">'data/1crn_cut.pdb'</span><span class="p">)</span> @@ -813,9 +815,9 @@ Non-sequential gaps are ignored!</p> <span class="n">aln</span><span class="o">.</span><span class="n">AttachView</span><span class="p">(</span><span class="mi">1</span><span class="p">,</span> <span class="n">tpl</span><span class="o">.</span><span class="n">CreateFullView</span><span class="p">())</span> <span class="n">mhandle</span> <span class="o">=</span> <span class="n">modelling</span><span class="o">.</span><span class="n">BuildRawModel</span><span class="p">(</span><span class="n">aln</span><span class="p">)</span> <span class="c1"># merge gaps</span> -<span class="k">print</span> <span class="s1">'Number of gaps before: </span><span class="si">%d</span><span class="s1">'</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">mhandle</span><span class="o">.</span><span class="n">gaps</span><span class="p">)</span> +<span class="nb">print</span> <span class="s1">'Number of gaps before: </span><span class="si">%d</span><span class="s1">'</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">mhandle</span><span class="o">.</span><span class="n">gaps</span><span class="p">)</span> <span class="n">modelling</span><span class="o">.</span><span class="n">MergeGapsByDistance</span><span class="p">(</span><span class="n">mhandle</span><span class="p">,</span> <span class="mi">0</span><span class="p">)</span> -<span class="k">print</span> <span class="s1">'Number of gaps after: </span><span class="si">%d</span><span class="s1">'</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">mhandle</span><span class="o">.</span><span class="n">gaps</span><span class="p">)</span> +<span class="nb">print</span> <span class="s1">'Number of gaps after: </span><span class="si">%d</span><span class="s1">'</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">mhandle</span><span class="o">.</span><span class="n">gaps</span><span class="p">)</span> </pre></div> </div> <table class="docutils field-list" frame="void" rules="none"> @@ -845,8 +847,8 @@ both in this resnum range.</li> database. Do not expect a gap being filled in between its actual stem residues. This function cannot fill gaps at C- or N-terminal.</p> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">seq</span> -<span class="kn">from</span> <span class="nn">promod3</span> <span class="kn">import</span> <span class="n">modelling</span><span class="p">,</span> <span class="n">loop</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">seq</span> +<span class="kn">from</span> <span class="nn">promod3</span> <span class="k">import</span> <span class="n">modelling</span><span class="p">,</span> <span class="n">loop</span> <span class="c1"># setup</span> <span class="n">tpl</span> <span class="o">=</span> <span class="n">io</span><span class="o">.</span><span class="n">LoadPDB</span><span class="p">(</span><span class="s1">'data/1crn_cut.pdb'</span><span class="p">)</span> @@ -857,11 +859,11 @@ This function cannot fill gaps at C- or N-terminal.</p> <span class="n">aln</span><span class="o">.</span><span class="n">AttachView</span><span class="p">(</span><span class="mi">1</span><span class="p">,</span> <span class="n">tpl</span><span class="o">.</span><span class="n">CreateFullView</span><span class="p">())</span> <span class="n">mhandle</span> <span class="o">=</span> <span class="n">modelling</span><span class="o">.</span><span class="n">BuildRawModel</span><span class="p">(</span><span class="n">aln</span><span class="p">)</span> <span class="c1"># close gaps</span> -<span class="k">print</span> <span class="s1">'Number of gaps before: </span><span class="si">%d</span><span class="s1">'</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">mhandle</span><span class="o">.</span><span class="n">gaps</span><span class="p">)</span> +<span class="nb">print</span> <span class="s1">'Number of gaps before: </span><span class="si">%d</span><span class="s1">'</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">mhandle</span><span class="o">.</span><span class="n">gaps</span><span class="p">)</span> <span class="n">modelling</span><span class="o">.</span><span class="n">FillLoopsByDatabase</span><span class="p">(</span><span class="n">mhandle</span><span class="p">,</span> <span class="n">loop</span><span class="o">.</span><span class="n">LoadFragDB</span><span class="p">(),</span> <span class="n">loop</span><span class="o">.</span><span class="n">LoadStructureDB</span><span class="p">(),</span> <span class="n">loop</span><span class="o">.</span><span class="n">LoadTorsionSamplerCoil</span><span class="p">())</span> -<span class="k">print</span> <span class="s1">'Number of gaps after: </span><span class="si">%d</span><span class="s1">'</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">mhandle</span><span class="o">.</span><span class="n">gaps</span><span class="p">)</span> +<span class="nb">print</span> <span class="s1">'Number of gaps after: </span><span class="si">%d</span><span class="s1">'</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">mhandle</span><span class="o">.</span><span class="n">gaps</span><span class="p">)</span> </pre></div> </div> <table class="docutils field-list" frame="void" rules="none"> @@ -951,8 +953,8 @@ more loop candidates to be found.</p> <em>fragger_handles</em> is given) <a class="reference internal" href="../loop/structure_db.html#promod3.loop.Fragger" title="promod3.loop.Fragger"><code class="xref py py-class docutils literal"><span class="pre">Fragger</span></code></a> lists. The latter is only used if the gap length is >= the length of fragments stored.</p> <p>This function cannot fill gaps at C- or N-terminal.</p> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">seq</span> -<span class="kn">from</span> <span class="nn">promod3</span> <span class="kn">import</span> <span class="n">modelling</span><span class="p">,</span> <span class="n">loop</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">seq</span> +<span class="kn">from</span> <span class="nn">promod3</span> <span class="k">import</span> <span class="n">modelling</span><span class="p">,</span> <span class="n">loop</span> <span class="c1"># setup</span> <span class="n">tpl</span> <span class="o">=</span> <span class="n">io</span><span class="o">.</span><span class="n">LoadPDB</span><span class="p">(</span><span class="s1">'data/1crn_cut.pdb'</span><span class="p">)</span> @@ -963,10 +965,10 @@ is only used if the gap length is >= the length of fragments stored.</p> <span class="n">aln</span><span class="o">.</span><span class="n">AttachView</span><span class="p">(</span><span class="mi">1</span><span class="p">,</span> <span class="n">tpl</span><span class="o">.</span><span class="n">CreateFullView</span><span class="p">())</span> <span class="n">mhandle</span> <span class="o">=</span> <span class="n">modelling</span><span class="o">.</span><span class="n">BuildRawModel</span><span class="p">(</span><span class="n">aln</span><span class="p">)</span> <span class="c1"># close gaps</span> -<span class="k">print</span> <span class="s1">'Number of gaps before: </span><span class="si">%d</span><span class="s1">'</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">mhandle</span><span class="o">.</span><span class="n">gaps</span><span class="p">)</span> +<span class="nb">print</span> <span class="s1">'Number of gaps before: </span><span class="si">%d</span><span class="s1">'</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">mhandle</span><span class="o">.</span><span class="n">gaps</span><span class="p">)</span> <span class="n">modelling</span><span class="o">.</span><span class="n">FillLoopsByMonteCarlo</span><span class="p">(</span><span class="n">mhandle</span><span class="p">,</span> <span class="n">loop</span><span class="o">.</span><span class="n">LoadTorsionSamplerCoil</span><span class="p">())</span> -<span class="k">print</span> <span class="s1">'Number of gaps after: </span><span class="si">%d</span><span class="s1">'</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">mhandle</span><span class="o">.</span><span class="n">gaps</span><span class="p">)</span> +<span class="nb">print</span> <span class="s1">'Number of gaps after: </span><span class="si">%d</span><span class="s1">'</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">mhandle</span><span class="o">.</span><span class="n">gaps</span><span class="p">)</span> </pre></div> </div> <table class="docutils field-list" frame="void" rules="none"> @@ -1059,8 +1061,8 @@ but we do not assume that the resulting termini are of high quality!</p> <em>fragger_handles</em> is given) <a class="reference internal" href="../loop/structure_db.html#promod3.loop.Fragger" title="promod3.loop.Fragger"><code class="xref py py-class docutils literal"><span class="pre">Fragger</span></code></a> lists. The latter is only used if the gap length is >= the length of fragments stored.</p> <p>Terminal gaps of length 1 are ignored by this function!</p> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">seq</span> -<span class="kn">from</span> <span class="nn">promod3</span> <span class="kn">import</span> <span class="n">modelling</span><span class="p">,</span> <span class="n">loop</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">seq</span> +<span class="kn">from</span> <span class="nn">promod3</span> <span class="k">import</span> <span class="n">modelling</span><span class="p">,</span> <span class="n">loop</span> <span class="c1"># setup</span> <span class="n">tpl</span> <span class="o">=</span> <span class="n">io</span><span class="o">.</span><span class="n">LoadPDB</span><span class="p">(</span><span class="s1">'data/gly.pdb'</span><span class="p">)</span> @@ -1071,10 +1073,10 @@ is only used if the gap length is >= the length of fragments stored.</p> <span class="n">aln</span><span class="o">.</span><span class="n">AttachView</span><span class="p">(</span><span class="mi">1</span><span class="p">,</span> <span class="n">tpl</span><span class="o">.</span><span class="n">CreateFullView</span><span class="p">())</span> <span class="n">mhandle</span> <span class="o">=</span> <span class="n">modelling</span><span class="o">.</span><span class="n">BuildRawModel</span><span class="p">(</span><span class="n">aln</span><span class="p">)</span> <span class="c1"># close gaps</span> -<span class="k">print</span> <span class="s1">'Number of gaps before: </span><span class="si">%d</span><span class="s1">'</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">mhandle</span><span class="o">.</span><span class="n">gaps</span><span class="p">)</span> +<span class="nb">print</span> <span class="s1">'Number of gaps before: </span><span class="si">%d</span><span class="s1">'</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">mhandle</span><span class="o">.</span><span class="n">gaps</span><span class="p">)</span> <span class="n">modelling</span><span class="o">.</span><span class="n">ModelTermini</span><span class="p">(</span><span class="n">mhandle</span><span class="p">,</span> <span class="n">loop</span><span class="o">.</span><span class="n">LoadTorsionSamplerCoil</span><span class="p">())</span> -<span class="k">print</span> <span class="s1">'Number of gaps after: </span><span class="si">%d</span><span class="s1">'</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">mhandle</span><span class="o">.</span><span class="n">gaps</span><span class="p">)</span> +<span class="nb">print</span> <span class="s1">'Number of gaps after: </span><span class="si">%d</span><span class="s1">'</span> <span class="o">%</span> <span class="nb">len</span><span class="p">(</span><span class="n">mhandle</span><span class="o">.</span><span class="n">gaps</span><span class="p">)</span> </pre></div> </div> <table class="docutils field-list" frame="void" rules="none"> @@ -1236,9 +1238,6 @@ CHARMM one (see <a class="reference internal" href="#promod3.modelling.BuildFrom <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -1249,8 +1248,8 @@ CHARMM one (see <a class="reference internal" href="#promod3.modelling.BuildFrom ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/modelling/pipeline.txt" diff --git a/doc/html/modelling/sidechain_reconstruction.html b/doc/html/modelling/sidechain_reconstruction.html index e23cb25c..67bb2f71 100644 --- a/doc/html/modelling/sidechain_reconstruction.html +++ b/doc/html/modelling/sidechain_reconstruction.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Sidechain Reconstruction — ProMod3 1.2.0 documentation</title> + <title>Sidechain Reconstruction — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="modelling - Protein Modelling" href="index.html" /> <link rel="next" title="Modelling Algorithms" href="algorithms.html" /> <link rel="prev" title="Generating Loops De Novo" href="monte_carlo.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -50,21 +52,21 @@ and used to reconstruct sidechains of single loops</li> </ul> <p>Example usage:</p> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">mol</span> -<span class="kn">from</span> <span class="nn">promod3</span> <span class="kn">import</span> <span class="n">modelling</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">mol</span> +<span class="kn">from</span> <span class="nn">promod3</span> <span class="k">import</span> <span class="n">modelling</span> <span class="c1"># load a protein </span> <span class="n">prot</span> <span class="o">=</span> <span class="n">io</span><span class="o">.</span><span class="n">LoadPDB</span><span class="p">(</span><span class="s1">'data/1CRN.pdb'</span><span class="p">)</span> <span class="c1"># get only amino acids</span> -<span class="n">prot</span> <span class="o">=</span> <span class="n">mol</span><span class="o">.</span><span class="n">CreateEntityFromView</span><span class="p">(</span><span class="n">prot</span><span class="o">.</span><span class="n">Select</span><span class="p">(</span><span class="s2">"peptide=true"</span><span class="p">),</span> <span class="bp">True</span><span class="p">)</span> +<span class="n">prot</span> <span class="o">=</span> <span class="n">mol</span><span class="o">.</span><span class="n">CreateEntityFromView</span><span class="p">(</span><span class="n">prot</span><span class="o">.</span><span class="n">Select</span><span class="p">(</span><span class="s2">"peptide=true"</span><span class="p">),</span> <span class="kc">True</span><span class="p">)</span> <span class="n">io</span><span class="o">.</span><span class="n">SavePDB</span><span class="p">(</span><span class="n">prot</span><span class="p">,</span> <span class="s1">'sidechain_test_orig.pdb'</span><span class="p">)</span> <span class="c1"># reconstruct sidechains</span> -<span class="n">modelling</span><span class="o">.</span><span class="n">ReconstructSidechains</span><span class="p">(</span><span class="n">prot</span><span class="p">,</span> <span class="n">keep_sidechains</span><span class="o">=</span><span class="bp">False</span><span class="p">)</span> +<span class="n">modelling</span><span class="o">.</span><span class="n">ReconstructSidechains</span><span class="p">(</span><span class="n">prot</span><span class="p">,</span> <span class="n">keep_sidechains</span><span class="o">=</span><span class="kc">False</span><span class="p">)</span> <span class="n">io</span><span class="o">.</span><span class="n">SavePDB</span><span class="p">(</span><span class="n">prot</span><span class="p">,</span> <span class="s1">'sidechain_test_rec.pdb'</span><span class="p">)</span> </pre></div> </div> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span> -<span class="kn">from</span> <span class="nn">promod3</span> <span class="kn">import</span> <span class="n">loop</span><span class="p">,</span> <span class="n">modelling</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">io</span> +<span class="kn">from</span> <span class="nn">promod3</span> <span class="k">import</span> <span class="n">loop</span><span class="p">,</span> <span class="n">modelling</span> <span class="c1"># load example (has res. numbering starting at 1)</span> <span class="n">prot</span> <span class="o">=</span> <span class="n">io</span><span class="o">.</span><span class="n">LoadPDB</span><span class="p">(</span><span class="s1">'data/1CRN.pdb'</span><span class="p">)</span> @@ -74,7 +76,7 @@ and used to reconstruct sidechains of single loops</li> <span class="c1"># initialize AllAtom environment and sidechain reconstructor</span> <span class="n">env</span> <span class="o">=</span> <span class="n">loop</span><span class="o">.</span><span class="n">AllAtomEnv</span><span class="p">(</span><span class="n">seqres_str</span><span class="p">)</span> <span class="n">env</span><span class="o">.</span><span class="n">SetInitialEnvironment</span><span class="p">(</span><span class="n">prot</span><span class="p">)</span> -<span class="n">sc_rec</span> <span class="o">=</span> <span class="n">modelling</span><span class="o">.</span><span class="n">SidechainReconstructor</span><span class="p">(</span><span class="n">keep_sidechains</span><span class="o">=</span><span class="bp">False</span><span class="p">)</span> +<span class="n">sc_rec</span> <span class="o">=</span> <span class="n">modelling</span><span class="o">.</span><span class="n">SidechainReconstructor</span><span class="p">(</span><span class="n">keep_sidechains</span><span class="o">=</span><span class="kc">False</span><span class="p">)</span> <span class="n">sc_rec</span><span class="o">.</span><span class="n">AttachEnvironment</span><span class="p">(</span><span class="n">env</span><span class="p">)</span> <span class="c1"># reconstruct subset (res. num. 6..10)</span> @@ -430,9 +432,6 @@ in the environment (same length as <em>env_pos.res_indices</em>)</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -443,8 +442,8 @@ in the environment (same length as <em>env_pos.res_indices</em>)</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/modelling/sidechain_reconstruction.txt" diff --git a/doc/html/objects.inv b/doc/html/objects.inv index cdfa24d07cd63593a84b28cff1ae7a355f70aca6..f48241f38276d2e99ac3e7e82e959edb969244eb 100644 GIT binary patch delta 7421 zcmaE8w8?6MEu-;7JDYm%$&bw@HN5{N+BKu|#@*(W?bT_?Z)SU~dbMh1RmPE`itk4n zJf^UidtP9Oy!&Z=ybZ@b%}$p^-x9WWsqAAp=%OTizTudm*P-|TiC>Dme*~6Wa25*9 zdFI%&?@>I{-vfUp|NG6Z^sX*mZnMR&)A7%{BQJQJ&pgLuqnGP2x%`Zgef_dTxkP&x zNh$UVoX3}XCd;!*E<AZ6rH3nX{$Cr#$hJx|qpzMS`}8~&GhRN-@qIkyndgb??lSHv z_Wu6+_dM-9x7Wi@@?Ya)9fN+>UmNwj?KFkOpMG8J7bUzVU*}flwCq_QdY(FNJC(6# z=^lM{cAw-q8-w@X;M%zFpya01JxOBqlUZE#@B6dQ@kzY9Z?T5E<Ub|7MGf6NZ&POW zu-7JP*xF5OIr7B+jEX{s!1L6s%G>>C|E^XzJ$1U`vx_fc>-FZyW@fPS9KQX5!J~Sa zqJ*yR;>*vzi3zF4mo<m>K5(h^k@#_0>eFf)<xhQzjnUK81J=ljnXz_!J+<L(^}CF= zC-vzuhM5oLJdKtvtC}SE=97xD;XR{YZj0t|o&Hj5AId-Bi9y@87<UOxwean;-)FVg zJ=o59%iW@+`M%MllsG*p)v_XGN2#r66mM~7yjoSVr)Sx>6q)s!sfzEn2~9V-z9fdN zPNCj|>6DS%x5_s4009oQjf-;x6ZLx@xP-scTzaYANhh#KK<~-y4^E9np#m$nSri<2 zqmiRz@JYIrsm(>BO33Hb13~wd+gAJ92glpL&k#F*r_-wZckGje*Eg?jJ|}GSP+F|Z zRP@tR|4Dwn|Bvu*?+M)I<@C|)W`>Vcz1y1!O2?}2e7kk_b81w5!S64XNBJss?7oD> zy)dhnePc22OFeJ6pry*EpzT}P7l^Cf<h&hx(e+%+1<T_bGxn}dYJZyVt;=}y*S-&D zjPAFqi(f3C-)Pz0w<53e^eqMb7>=Z;%BMp`PJZ}mR=Hk#uUGG)6Yh`V_HT*udV9Z9 zzUAV&uKtwTgOMMvZ|ex!p~|P1EcdTDarK*ugqwm(*cZ02xEdU&cgys@+$^+lif7Q> z*@4#|ue1n!vFKQ<$^kQv+vaONF)v*p8hCZVqW|m-Du+UZo=G&gU7l>~`a{Mi!pz_T zFW0_znM@z*F5Oz=U{Kyt7^vKOkoDlfiE@G|`{sR)h<hBc!6`VgLf_DCLHMbP-TB#C z1=T7GEVw?;i{_i9dvVRv9Ub-AZxZ-B3zAy4rHV8hJ*vu|uCU|@iwo1i3Wrq+775e- zO}(ckc~ULn_Y9R1(Fp;c+|1Xief+DL@}*(&$p&|?{m)jWep+RlQJU$S)_CY0W1?q) zh~W;8;BCAP2_L^0cNy9gioQ2&KEAHM<EWv`ce6vsMB5qf)ieEb`EKvXZ12omKYw9k zYbE0`rpNOxeBV{i%4y2Vz|nSo)$E#mHtW<6`ONv~QE@FZ^4rm~+LvBEydK^r^v^Bw zPHxii4Yy{_@{3wu=6~<lq>IuDeTqD6?a2zvg?BuT^v=>u>W#cD{N{dYZE|nLHnlxB zgyr6Pf3AtJ5GvDCk?DSvu;QUWo(jhakGb{SEXNDxd2EWy&3c@7Iq=)Iy!PgAHES3C z+rKix^396n`HhCAd^+nhTbOE&Us$+*f2D}ex%h)s-?(CA*9N<$wysLi)v*!Qn7>z6 zM454$?@AYj`l~{mKRjRiBq+r2J-x4UKf3tZH<s$P8%n)wvX>v(T;^rNu>44K*2cXy zM|GCU)bEcl-@3j;S-mYqJ^D<5{UeR866aUf4sW{q=`V-+TE^cO1*V)zWhm=8;L|#% z??7Qz^d6q#PtPl^1`FSjn`C~Avu)>0<wxzmy*sBL6r6a(zsv8?xr}!jVw`U!zr0;L z<7)Qthwh))8a3^DRbBo5eL33h_o+hbZQmw_{em*BsoTBkpPxRy@w|V`j<t0MHq28m z=PYxcT&KG!LAUi*+onnKo08wZzO~{06V>?2D;g&ce9W5VcR$5Tq3FEGiIq=GeT8IF zp6uQ5VcY!m=b}&bRm_@jAl%q|XSYqb(UN@@Vvb24cVx`J+tFF~J=jI&pzAtL-lNtn zPdc32l#VCe5u0jIq+VZtK0u<gK5^>neLrq!d$t;7$*!1p`i;){KAxCxz8y=Yg)Ul8 zl!@V(6Kkp@*Hy)^*0Xe-bZVAI!D@frz+b^%*5(!{9BX{`&7*M9p4y@ZU%r2wU$l{B z%C)d9s(zN8yNnkxo_G+y<#1WhJ|!EABOE=q?X%O2GBXs;acQJy$oyKyQ6Cj({)6}F z#RoRL)@BbYzqnbwGg{CQ9c#G2`>7s3|BsLJ^;Z1<XKwISZt?fa2d;!!7gTTKQ24EQ z(!e|5Nr34*7hksZdWVJU*KW}N|M}ITDcdd1dURZE*mro+w<Wr4x|7_yoGK=(tbG0Z z>bsXGd8@r6)xr}GU$*_yr+7O2)2p4V^^dJGm)W$Ro$`F&%ujbrg6B<6J5_wir}CZd zzUPM?Rm&$k+XhJQ(%m)L%yqeFh|Q(rr6P~Nbv5-Dp6_7n={V=X*jsr1WMlWis-;H` znN2oPatt(_!|B!E(JXpnJ<t5Sl6sAd<EirE+jeJ0G`(Nu^o=W|*;ihdzpP+&INuId z3*~y&D@=1HC+9LsSmop`<EeZ-rHG%^IC0(bxx42rp7vJe6URpBNfmpUe=JTYic{tB zWN8n`*9b^^FRFdT_R**7$&s1Mn$EeVJl2@LXvynL{}<M0PQU!SHYIMyiN4Ur@9tTT zFY&vlDO*Tve6VBZ%rh1y<_(fFL*CAKw3hGCj$A=!rF!-oP7`?r{(s!Sc(hW5?di&$ zIY;$O8WKL6SnQk;rnaMci~7V5_Zn`Lt8}el*tC1ghNZ`JHz!s;{kJSwabNub$%(v6 z^G{07XfC&X%(+x7G<eCh-AmItRPGpwr>;&oy<_Lbr4cvpN*%UScj#Iact<L9y<@P+ zu_gM?w1qDF+GeW7*3T_JHc`HN)9hUuq8mQt&2E+HtlszM>E*xgEl&K9bjw_p>)0Cl zEntq@4988^rnpS7+1eY|;q39uw$GzMXVXuSYOO_)ryJTfy%enFPPvw0*HxV^CggkU zwBbFI`)(SOwa@Rd@zp$?@N?Pf-)$2wted=#{hqPESVWVQvhqpBX<Ga1m-i`J*hIXw z`yKH17OT6s;vx})J*5*=@9;)c+)*kyUv-_u_gPh6cHe{NEBCQ@{59nbY*W-ZIc@Tk zhXvaIlpU*g-^reRkk5sUWAdFoz088r-zvA}?x?N*&*Hhb=MU$R$!T-c4xRY6K6_Jo zkwr#u@`9NGl5a!v8P@q~Tr2u^EUbQ8R8i#FD@~%4IEoMC7AxC1HqBJnTFuLF;O5U* z^JAaCIL-ZFEt8!U@5sIF<DRu|1XzB`&6GS8HFfg4+|EU{>$Y`oZxz-3%eH*4-i3+> zA6A`vspFs<cHCFxrk23ADZ*FZyEg3G((U#9>F>_JJ4!FuK9a7inxuQYNMS)QlLYSy z<$A@cPp|jL_Pw-jGdVxmdetp~)qzcHJaM^8m+hSwWV1B$&9^!ej+y)37T5mQI#G1^ z!uEI8zHYhwPq+ouTy}^|2#E{m54dvZtzEdhTH#W41CyjI#wXEd%v9F#r8Owt?=D}? z-u9?bbDO}Oe;?|!BHz6W<UPr-dREazZwrMf<;J}A%T7LzntSqqckX$Wg8jAgd!)8~ znml3Gc}Ks>fV)rrI^J^K^h3T+>9SxtU$n;hIE%uCHRp2n?>;Q}>z>J1QSZ_pY=Tes zwyX1QoO1ulJ665>muBrdEgbP+=e`9W3xt<7isW!FJ9Kp_hosA8r>N@qg9q|s4#{qs zFS{u|W@D<3r|{1DP$s_Xm2UU%HL%_YpK5lI`FxSzqJT2ycNey+S8gqp3U>AJ>^jO{ zGm*{xlSjwZ3)<V0)?SykHdbI@OA5Twr6hOwn@p?ZhFn8mqc`jwu3xlH-L#42HfBHX zl(Oa|)5&{+?D6kaF2@;OeW?{6V6|ov`;=eqQ(7)AeXkM!M(5?OKlL1^7RQutIVh+X z9bi3Ae6a@8lZ~^JUi~Urt6`|X<(SDbai!2=GryySTGjJ!KVNb)VfXU0ehZ#@md*A! z+~h2Abgl4LyY=Z;pG3W5v%g%<mEiPBfur=Mz_hsuXYzzuC+@ucer17xP$l1tFqzeV zN;4MBy1SHFW5=9)&2;7uvnRi)uD>n5wQAGRRUhZ2@Le-v-gbm%^VStiDkick_ZoaX z&7V?Sx^Uf=iTfwMd9haUKo!@$y=&GpUlVj?Kh?5lMm+DND3cFU)h}5cE+})^YA4mn z#KpL9lQ1)f*7M(AOSt>j>-b*VWZ}5s?%d3?ca5~nRlgd|iE8?+A+$Ek@OIvVr|WYQ z>!UU-{bxAgVD`d<oz3SX4Q1BdJ{;cm<cj0Mf^?k=rBa&gen<C5J6bf&*v!PyxXWF} zEdSQwN}Y4zbMJ73NbC@Bnma-5_oXK?^@Rry-&{X!=aXfp8F_xLZ{HgGLzh9Jaq|<A znHv`~{Ag5VJ;Yig63<|`_1s~-@X~<)mnMGnSowjs{(QQJ;Hma?$4i&JWHe--e!t<v z(?EymyC$nO>udfH`5@)mIA>>9_BFQR@}yU4Czj5+_DAaZBO{s9#vXIJGW^mCzIfFZ zM=9<w`Z8(m#jh6YOszOImvOz%TDO(CvZyU?O0nREhZ{1vWjhNGm1T)sH9T7MS>-dA zp30YVXPXnmz0cPBzC0kle_nTLf9;_~J&rNwCzTYhnt#sZrgzAm<*RNdT6L(Xh<#l1 z>eYTx#tRQqj!)kIWd_Se_LK3?e}$<v>{9=5^Wm9^9d`P%r+!^>3fR#<xjdZd%mc+e zJjEVulZCPlJ}j=+SY<C`Xtp@3;6%u8{R5J|U#&RobJtyN5I*oxo~PdG@>HeGuYAn2 zR+gS`P~LX_gYvdtJ^CGd=h-;d?B49j`ufcp*<0mD@3hAqeG#h}K3zeU^Yg(q?(@rM zY!WbL=!@C*!$sM$cT&o7t-OtI_S~Mx%$ctwRr55g_QP(Ql|}3m*ITW((my?EmFTCg zz}4DcHwF~EZu}(0zJ}}C%mmSZm-Vq5olpEc*&M#}wr|Y;Ysv->9Qg~ZzPu4=5fxkZ ze!)>$xx_6=r>>?oC{}wPVBY_B&QrF7S7mo*OTG7OI`~p9B9M8;G$H0IiLpJ^4ZW{Q zD-D{fS-+e6@Ez}Ip0SE+d6`rWkM3XY`4%DHZ!B1I>-3I^m!<9${SI=Q@p=2Jx5vfa z*FOtb^zu}h&eHYfw^w>>zkllYfvBgoOSV<ZuWPy2uCeg@N3RzLwHHP$xORu(kY3E| zy1eYTd1B9HOtd*9wuOqn+3{&c_|=Zj*V>GQXMJSjK4EGg%e>ode?uhm{j+bT%xf`r znwGfn`n3J)&2GPXzq)B!&*XCZrScjR3hX~@E}naUuU<t>UOVvStQEJ^-Y_qH<=o@B z_0*5#6ysS7C5$VpJ{{*=ekS+rlAN8Vj6`JeCzl_}P-@p^*Wq1o;#T~GLocLH)ZCC_ zUzfh>Sj+2~T6YAlW@g`fawYKjufAoBrNY}zU2)P=f0ACX$u4<<ir<2}d&L)=IDg2) zvAKHNl<iCHJ`@GY*BgAlDR`YTY-d%T7t`Lkr5wu~zyDbK!nb+JzNdjtivO^iY_IoE zjn=AhJ9}vA#&5I38@+eFbt!y%XqoWQ;I#X#TLo&~_=%aVxyHk5H)FEgy&~tOz0=a? zem!HuGAY3?xLEz+%uPF9v-`BI=23oni9xKo{nd&Ozn|>*!BSfkQ{S<$es5`m>YST7 z>;XaP-(?fZ-j~@-Fe(W1y}nue!zaBTfh-Y^rH*hf6qzugD5<>GVg2q_lPO#FeauuS ztF92^ur7JTA~EmqqwOBPj~K3;ViUZVX7=&Iw@u#ViQ2P+9=u7J&Yi6sT@&$}V?|S* zZqjX$vg1DzFV_BU=$oE!Oj^&(d2RjAeaREUr|nuhWmCtUOY5_rtvNb3`+3eoXWqHG z--Eo<&p$s<!@BS4<?H9O_s)4zXY0T2!j$FCb;>gLXBzG~9Vw^nvTj+4zMC$ae0cS7 zuZ;2!O#xrGOkVinJlEc(nl>R@=ka+*%6?vVj6bH^vR;LyX9~|pWgW2<Z;S7|h<%^U zu(AHUrS$dgi2E@;+G>aO+C(m&6ko(?{Xw+xNC{)JVT<gioF55|cG8wT4<GRyToJ*! zYu)uCtzTVzr&ea{@CpoM)OHc(ijmZ^@Nms|bU@3Imphd49RFM&rpEAwjm@gT7ZXGs ze1A^(ZGC-j&g=%qqvebedCo`H-*a{Rw&j=Pbq%BXXzeR$YEB&i=Ym4d$T%F?d#71y zk=hl93#JP@+17IUnuPeS2tGKg$xLL6=8D6NvzpBKR%m7<G|pm*obvowdG)L7U+1=) zRvh2Bo$Wgdw|MWt)U?CKTb`LdZz}&4u=ex<Q_Vk8jF00Mq{^?Yw3d0s*rrl-@6`c= zu-RpY0?*FWHmE<c@16PVZQIXA$4TGsKfJB~|E5HzEgOBsN{nwWY~Hp-)+!|V_R7G^ zr?)pY>D@Dv*-~=5K)sdw`RS643-0*{^FKIW(&!-P%gyuTa>eWWW&QKbk3O24c-v#M za$4QT>G?W;TniR!F*p8}+W1m*XEXB}p;)tstuNf0!+O_oG`zaVU(dQq$@as(zl_J4 zt@X~8)MhVWC|!G!_3~ytv5@1lDj5F0Vrnc|&AQEWf7;*R;=JuUt1`>BSLW@E+Iva% ztlTVX?r@pSD|%bfKW*5v^X7w+<?^*EzuTJ10|amOC!9RD?$LVgNSTwemkK!ES&D9d zYQJ!O#M}Vs1JjQ0FFxaU^my~)`m$^lmW}(pq9#8r*i$ei_}1JlCew2JHpE|k(koNc zX0`A|#iIq?p^MH)y(*rw`)=@BJKnVCRxTSqR`&evxmmJg`ulDZ=|65lm*#FXn5wJ( zVvmZo&bwz4ESlwu1ofU<uQTF3+NyU`zqLtSqsa5F(Vw=aZ;G45emu8X$2HwKu-&h| zbelt!MOCwIWV-3YGlH?f6Xz|S_2A%jmh+yzAMRXZ;g3tVt<bGl`YPFRR>Z?aW>UJ@ z4<78fadHoby1^R#o@bg4r`K5U&3fL%eXsA@j;W%xwnlg6g=92`OCLM@@B#1SXH2V? zH{N=sp<TxJBJ0`gJ*9@ZzR@~@;ZrU|+}n9*=ZSiu-j@pw+uOEHV4w3+-IJkXD&s1y z+P3Ds9yXWuFWBR_kts(|*f6I>{k9eJ1h;n+)gsD7{ja~9wCwxI4V#2Z!_s&6o>cjK zyGMjcK$D%pw!pMtFBj9CsGU~1kJ{7}ER5R{vX^-;C^?eRa-+>a=0@cc>)#nQ?DD<u zA1FVQtx4HkUo3R<-5s}W);}al*yWnvJ!oD(ck+Ym=Vm`{9b}KU{^60yE_34z1M_Uz zfP~G(A~)X1u$ozKZ#>Iqw&A8FS5BE8(`?z2gw2OF?mRg;Z{dU2vXU~PI}R-u&2nB` zzQ^t(Px&>j{#Q%&?+YwF{?Ds;!uEBpI@fs?^PFbpagE8?Hd(4(X4b4z_ZT;Qo$%yC z!O764>DCf26J#zO6j*ZjqB}ct|AXYd1&4e6+@!Q$<WAZsJi$xrTF}+qt9Ca1ejxS# zfUS_Q;G2eN2R1d#iW82gC{USy%ld<(LwynB-#1LZ%nLGZmDD-joFikmv*F(pre8N% zul%cC`En9#<=y?(CDSAC7gyHXRPTJG^x9MTmC_HV>66x;`LsQ<y|9*tRqfaR$S1bv zW`5YDx9xDirs|{}{1c+`c;7A9a#sJf-HWUxzg5p(5j^DlRz-jQmz9-YWPW}vw5>~v zYpZ;=_|=BKqNIdEUw`f|&VTOBl#1}*74uS6^Ha*(Ymw2+3%FS-OCGMe9c(3A_Pc&= z$|do$JNIxg`aXW-cU#E+`CCpApL@6MI;TIA-2W|AoZGm&MDhKyPZAqdW`EZC<EphF zD)y?!y2)&XEAq3Ch4)-$U4KqgcBaijZsE6np3$MRTmv(|{J8ERG?~3h@6=D{$3c@P zp0Ahv`RB&=MCJMNKlk<i*2?r~{<%p1Va@3mlj}D`6|Y@ebM4}>gI|`eIw!4`Z8%*^ zzkH3^30ucGDo>Wn+t-F|;CNf8QpmGEQH@`Cm2cm@=PHw8O}KOYW^-Qg)vHcRn*3;4 z#l1Zz)_n7^ef@UH-4;eK7uM&F|1S62$4$I=?D22ydG?Fe^X%=u_Ug;a=kx3LX*m`h z5VXA#zj)7z`1+*We{)zja=hIgzo%^H$G!iX&+k=Es`&TGEdF#{V`RcN-XD%Cf4d@^ zFYQ_$DE)Q!v<=#OD_5^9)Zl#nG>vsno8YOU6RruGho{6vyk+eDvWmNFan9C1+txmL zRux#WRomE7`FlI_vO_wXr`@>4JNH9(<(in4Au7}FCe`Vb#8wN+)_Z-fV+_9A?Eh?$ znrz{eZwy~j=dP<rS-3yh!n`|RBG>zOE;lB~e*E)Ic5`r<&ixI~g*Ud<t(bYT`;+q8 zr}KHYJX`WH{Rp3C(xI&xm$SZ`Z2q^wp}YR+_Q=Z?)2tM}*XeLgc-onvxM972<NKNe z`_#9z%-v_Bub(Y<JkkL?mS5kj+~@k|s^T}BU=7i8*Pb1Vy8q++f1x`zj}I;AjQaom zbg6~Qdl$Q3_rq<v?mzYGIb^>6>4rTw)>yr2FrMiY^7o2Kd+4M`S&`nwJ0-lf?+Vg4 zdn#-kJGVBNVV~v#qvd-||Lgzyen=(yM9O-n+dh?@`Mc6P=BBaF36TnSIvYCIvA)!& ztHNmV*MPadTMqx?Hhn)sYQ?&<wzY+23OAiRe2%a`@r^tyB%=DaHRbc{M;C84cDXrz z`^-K0&-T;zUwG`-HF|i-V`aDS*;en*x{)Gw>C5j(U2|KqfBF4q>qDMb{@btg_0QAj zpe>V_UmW^5zoRZ_W%^vJ`=-Y>-*4?dxjuXPzWPObS7^+y`*&Ql_er?hy_dUJFoYK< z_o#e(ULW&OgR|h$7Mr80f5ZBJ_0P2NT60Hn(Z`a%ZGOe^a}F5ByIzcWXJ>dn$Ztz& zc)xV`p2LRbT){2DZ97*KO!}(vPW+^G{K8$Ugiq~nt(@X{>dcEJMORLRA76A4G`3Q~ zez|gy2D@$j9o2nC(@IUJo4$6nUvRSUP4@f~{7)Dr1U|Of^}AzbQ|Fwbp6652PtR~W z9WiA?)rN%P;)Z4N@2s!<I(z8OwB3qlp9bd4n)s5n+)lsmPgZi&ckW4locER8G~VmQ zH*v+=!VMfsr&3iGaV=b#k>39-YITY0LrsCD7gZ*Bg)@sr%KO(F9ba%YAZzJEmPv7! zvK*c+*02hA7%cm^?a<e|*IECkyz8(^d3Wa5`JFG>%lr<l%z7$5<yz$2TUT~14W2H( z)m@plcIwHS4;HTaduQL|@YR1-W<}4HxZlYASF+~qFJY-__f4njI>d|?zhw&8Uvsfz zrEcx7ooCat?t2{J{dH?ixPDuGhVM~Bu?44|vz?#+(t2*Gf9P9vvvV<PGtY0^VYj;` zEW!TAo0CnSH@z;nXT!Kj=sCCXv?BTX@X(wUYNq`?y6g2r9<_SznQ%i+UBg!QOz)?^ zsnP52Dn2yQ4|%g~g8ucK|IvzbR~%?|jE&-{wcB%rd)2O0s{dDod~Q=YlsfzV%HaB1 z`AL^d4g7^~RW+))raWeHXZ^x`+5bYq*Do1=wq7<3WC&5&A8@pmbqUYsP$s+8cRH&& zx6I*LDDmw5%?ob9U!SC#FJ2|Xm7A`eQXap+?!|$3j>X0mi#C3~wd};^g{Cj2e^fi~ zTcLYi_V8`n?lUn)=X?ske0p;zPrmj-v2^p9`1&Wl&ic(E6GM9<3UXex?Mq{_F0Jq8 zt2oxLvGl#hB)?b7{ioZWf5)@HZQJkX>}SvJy1#RdkZw|u$kS7kXKlTv{$=y3rQF4) zeMZ^7M_&4ep1nA8wx#~6)rr?`B`mNn{hK}QSy7<z+)(3NGh?s%ukqijB^x~1SXN&s z^6sr><-c2g74GO;_(f%1zuH{Z(zdy$)?8)VmR755{(Pew^C`~2&G!Nyex9(&dr@S} z@|!;wuB?0UK;hb+ZBITgy%uc$c+*U)nClM@W|ri(yPt~|^Nf{vwdF_Xy*ahQeoJ$b e4j=p5{qSSHRiv=>@6R5eU*CK6pW#-$!fgQVQgqA! delta 6437 zcmdmF_0VX7Eu+yyJDd9G;>Tvw8t(rN-;uREYyOfYmp4aG-t#hPyKVAKu9qQY^CAQ| zJv%%b7(Gh0_t!B_m{K9`DN`XgX`1IFYlVt}hT?+Hks^vxf0~*OaL;(pYH`fuz!m%Z zKLx9f@BeX=xqSZS{q+i;-hKaR*m>yxuiJOuOpf=~k2qCpqqp|_3(n6+y6Yn*wB6ti zXgbEYspavdBNN;Iv=~?!Nu~$g64zg<;<>@YZJFKaBZntFX?mvT7pBt{>BYR!>XC-Z z?%hBBoVHsU`7X8S*hhXQ^}3HU=G$INS*afSXwROyGn1yVq?@OGHTf*MSn1))`8q;k zxid3PA7tFjq5kKN-nXs@-NGgx$^04a^(~7&eEt2i;ibs6znra_ULV3M1%EoFod`@d zlKV1s@sAyfQ(T_tpAkL4KT%-%l~>!uMZdE<KI1lbyp#G+^LLDe<)#BX5-i^jGEVq* zh{+&Irv3TXzqTrVd*4XCmQw8aH^bn=S*}m3_b3z{ns7kZUsL4t!Ar{+Hr}%^tM+eK z^{72o&l)cFZsr9|)2pF8_dPS6l=eK$@jo<;>-6T|ackriz8JKb#kWdiF1xUO_4};0 zI-&0(Z=Gar9L%>|*g5-@Tj%_@9szE;8#~Hs#cpfKnkR0wlyuiVR-rI!?GfFxx<Th^ z&xhNKFsgE@?>0Fotii$Jd{!gc<%hQVjI^oMUMsH%6xX}(Z{prLeQ&@5pQkR<B4sQR zil&$eO8o3~WMozno%?IDQN@wOIXACn*&FY^cmLv<`IQq&-~HQt#yR`^I-XbRDx30W zXkQCCaecpsjp<)EnRk}yHIB?b%}!?c$kaOi5m45P+Vytn?7yi|bp^YBZhFveGD*H_ zwVuiB{cL42{$F{;>lG~nN>|>z#eAW7a!%{ptoKS!&0aV?@Yr_mdQ$t-eEle<uCF#X zjlFI7=gq0UpUbvPTz1nM)qPjkN*}ffua=vse<)z*`tM&t!m8#<wJvObvbQXA>6FO- ze*YBan1<G<yw>*nw13;q=}J6>1(L-d=gUZ^9%nt>r()}=s-n@t80J-9JxeY|pm?gv zxkZwxw)46sx9VlbIMn1cnbaQ6u3I4T#p{ZxM*n|?2}@>sHHk1^h^R4Je!`A@`ZQji zEiV6l_XRe555AVh*i@+yb3#g!SC50Q?@N!u=dY98Ud?J~dOC~iaCPqo#=VAmuQsk- zdEo8DhDQ=-s`FSgwxw*I_UO)f!}@01z?+>DZ%s2`m^NX0%$$Y^FC;rynhG039E%R< z{FUCloYPY+;&(^Dwhx{QDi+Varu6Z#<%2g3FH;T}C%@0knepeA+!d#&$&m{-xI0LE z?Z3o6JyS22Ss=phZ<7*_e~gRunTH!!D?bWkIlh;_@S<otqg@@_KbL-cN9O$w%<&8A z8+TSR9%FiJ_M&=cJu9a!7lQ!L{7~zkHMMcREuwYDj0HUxr`~*O&c5VqTl{^CMM>u? zuH+;g-|%YYEWaq-Ila5hQnpxiBy-F?_fW#4UEW-1;}v7q9z*Tork}glOgq*go_uJv z<-?nMOn%=zG;xF7^a35PhK0LgcT7}JP`>({qp$v94o9r+wWWpIUuqObKTp_i7r$Ej zpSkGjHrdTDqZ7{Xuur>g;bK?!;Kc>Gd^y(O&*24T)vW9Krmftx$tiS`l-NAZDd(>- z9QA0(3|=L0ApUC;%bz8wY6b#&?XU9Zz3Z{mE^gWxHlxfd=CNOA_8rYaMk`glknXq3 z44)Ya|G2uNer0WPwyB|t<?N(gk2)4>tdb7eCfD|M+Vj>K*Vx{;I|r<p#yG?9Pm<P? z5|+NC%a5K$OxS;H^}KlxzPWr~^N^=Isjox)O`ht!-|j9e+&?QMCYzLtbhA9;*>?Z= z=Bl$6k37B!%=mLzBIwE!fB(9SS#H6Z{5`)b{0k&v4r%r3%e&Ukv*5m&`?aQTb7j%? z1aG(7TTe8YPS28F;Z^6+w|0H@p?j;n=e-M5p4IU9tI6DLC#N_(nWi}*_@uU*<~QM@ zQ@VRzKG**IOiSRr#z$M*;@}%6K8Lnl5<jivp&~#1?PgiShw^bf9jZIdm?k#Xv^U5U z9tg~c?76#WlH0pCZ!Nf-e%9-+DYAVgU%hZefZJNev(Jp8Pj6ObzCMLH@8vF+Eq*HO z;!Nq`+=Bj<whh;o7+vo(3RSsrb$Qo{H^E!h=5A0p*7R(f$Hql_a*G~(`Tlc$)<%{o z*WxmZWw?dR(p{J*9NeGLoV&DUX>~z|fW-FNYiCk|t~<;T3^;qiVvDb!$)a^1>*bav zKDXgDHWSR;q2Bw>XhFyCHAxQBPdQ7;eE4ji8&LmObjGiai!bjOZoSGAGhdhKMBO6J zXCkd)p~=eGMir$m=l#fTsr|d(TzcuAqlHdPYuLZ&PTR6N$1r1}jj_mq*($EFwt92U z9^<P%U9l)E@$lu?l0y@ouC91`r>StQN$|S*qiLtM-uKyAHcRumm+{l6%w;jZ#qMuS z{CKy2<3ha^ymy~HTv95xrRkIVtsT>9?t}$?u*>V0aOhv*&b6ZdwmSPc_Ux%bp0|A- zP54oHbc33Pof2bM!v4aVxU`P}7Y?LKi<{lKqI+<2uwpdptAoq>r?Fe_xT?i|hv|z4 z<5q^+qMmwP2KV-_MW-f|PYZgxFu-R<cINZ8;xC)#I!h_-Q@N5WdqAEw__J1`$0f^_ zD(6nEZ*hiBwn_`@Y~!`gh6K!aH|r}p?JebZd%=4H{poM>mwr-8DeK|db2nIe`o7!7 z(gzQA{67A*$mnsvU52!jpuNdmyDdB(Z*!G7DU-nLs@L$N{`_)NjdQAk8vf@~PnR!b zWD)mop8Pp8b<%EUYoSy3qy>IAwk#BMX!S0Rjw(6r6Y(y!{_;wJ^VSbqR<vC*eo}Jg zp!B&L3vMjPI&~#$`xO>JEuP}SOi>@n(@Qmvo_IG+;+Z95&=elkp1`M4Ca%d{Uw+oO z2DPkIKf6TxbCuPn<iPs0VDYI;an;+eI`KWV_5b_n#ykEu>WkV74KFWSa7SymMwjy$ z#Yk;8Cy#me-1HAHs(cn~KjO}I^N!29Zy8~y7ADs0a*t;g%{H0;bnm=Ym&qTqdd&T{ zD|%fyWo+J?d`vi^PViM+k<bj*m(dS&Kc_URzA!X$;@=SR)z(<v=|J<>`gfcCugC6w z@Zyqd2-B|Zd`2y|8Bfb?FS$GUnyKUDo$H>?QvR7aCzff+KQVTVg96i1v^~xgZkYOC zaR0v8cNfw&Fb47+T9W5J`O3~+wL)(l@72}ZakwO*UeEY(ie!3-)Xi_DzR!FZ+1F<A zm<VevUi*sofN9~;thswPPF*`CCe(OueL`zMCSOZt-V^l&GrWUrvltlsewE*qIDcB~ z70dmH5y8o<rZ;YtZr4)a_+&dNi6gskW=X!+l((NtcUJ^Q+`F{C@Xjq(DgHNcS1sqV zt~mN@2j?uEnoMuji-r13UzX;ESef7T?Rh-SvEO6O)t8>jWDYkrSaBtoEa++Jcrv|` zudn_Fr}M1mCmUB;9m$xofT=k=dTD0<a|!=Uso59%xfD<4RV(eb=P-&d{<8L`-{ipC z%0Io9a88Wn@>q3ZrMpJfy|?dH^H1KfO8tUqQWk?q^qK1_yX4L=IM+>ie~wSaRW>+B zamU+te?vCiy8GBlg?UZZuI{=<W+zwU%L%jYTz}=mR(~(6TCMT++utc6+o#TNIg`Yf zb*h<f@^<S?^OK+IEqJ;eVhV2@dittYSX}SC=<WAb7B2T!FZ*}u5@Wo5%A&6ymgr4; zXMT0@f$7^#mRW1IvVJ?-bnGy<Iq#B$Y=gJ!^p>1fm@O7``!^TczAc>FPt<KZQMdJI z*gloTS*uxO)?8|NTmSt4)0x#?b6+&2TdF25IMl%RYg=G=_Hx76PQ%WPe;V^IJ@C-u z+#pva>bB-;R&E-b%7O+7k*&*49N%E+o@|v9eI%pFR{rAz-bG)YWooRks1Q?14i)qG z)_0@6KES8==#}NGYg`Mrd&vd7krm`U6n#H%Z-jnkM4igh$hFo{j|J-EqXLZQNiQ^D zdGayUuC#VnSd4)J*TD#mi7UC?^5=9dj&Pm-`uUQX3A2}<^;@viWasiz8y+yY6`nql zGyi&=spP5H$Kqv43~EbwngXVqK0GOT>`hppz|7tM<xcZ4g+6ac?Mj}qpN%(U^Xw7^ z*6`1|S92IP+N{2DTW|f<$+}^k+v@`@BUbXv5E4EUzKLtX0*)oy4t>!-AAa^~@2(*C ze}0n|?`~p95B?w*TKjfGpN5Tr-c#2k1CPwW<Kgo>vUv{A6#V)tLxo#|p=Ff<n?T6f z@7bK({p)o?ui4l;Zjd`?@+{9Xc=n`SoPE3pGbK)iY0uBS{_&G@^bDz-d4FG=co3jb zAMx%%@ihMS^tTVC-LqaT2-zXWZQ`SR^}xzM<=UL?0>#sq6$AP`4m{I+{m|z5^VNQN zEbAmJ#GU3(SeBHT)wh4ogGW!y565&VJz;43bN%wEGk>Qs2po?r{B&kUAj7XlaV{6} z50Q0@N4{F|Z;qMj_}1I~nDW#^;Z=6AT?LgH7VGK_efc|X?)<~nvc8XLm#E(?o_$Ln z1Ru~A`IYrdOD|Gd=S`>PY=zlHS)a4lbbA*pIj68uYmwE=gO{|op3Q81pmp7wb@A!C znA{SfpfgwZYL~9nJrQjD<xq%6J1=`^bcSb-=(f<sEBZCVW~+;?PjGg6eaD8QY~PhV z8nQngoqv`zvp(58Vw$1H_0LXG^G+`}_I;<Cb?=!}*$h6VDK3}hUtRdG`Xz(xxip)v z+R~F1o+*4?t-sBP@rq63d7f~Y&KI5D?VI*&5fFKoShY!YfrL%V^gx+OiA!6u3Vz&? z|MZIAy{9YC)FNfh*Z2lwsr1(hdv@&dWA<w}P+#=ICth@B{P~jl<hH2qOcqJMne3Bh z&;7_M_+ib21Bd2@YDH|=T#|9WVJH9Eu8X^Z*6BEws&w(E+5CEwaE$p3qea%uM{TWH zQmUTk!uKCFsCYhsnRA-r=liXJJoh|bnwAUv)cU;cd8%ZPajT3$mT7=|F{`<phJN9J zRS7dW!x*>TdurYC#a~Y5O8wn+k8W+3Yh*0{#<1MEx?Q1XgTcmTsqNJ*7duvl&1T&7 z#+1?j(Z0fI(k$lOPu4|jQ5I>w9J^r=n}M!4Prv~y`R@$USF=AQuzfFj_kM;<UnhfM zX!x9anH!9@e9^BF3wXHEFLLShjmpc-cBFn^%9VKS{wmWx-TP-39Z{N+8|f8YZ*qH; z$L{;5{vL>WTDN4|ZuxaB@7gsM{{HCo;*j>jxCLQ%84jI^&92K!j+1)+TqZ=DLt<N) z_?aEAW`y7E=)TovEIjKY7x#+n02a16UNH+InD3u?GsVNHe?sMi_gkO7T{k;->+w|! zRFkVdC4FmT>ikfn|B{<2dV+_2*rIKw4@+m)Z{VLYOE$@8-Rd5DH?wrkE`#vp>h*I9 zj=jC+ckFq$isQeJ^X74+hwz4%MMybJT)JPOb))Txnj1pwdPbp1hg_F^%In~}C1qxr z8WR5|L&_lgkXUEjiPY9VOn&FiNvK@m+OqRIlgLk3Db0+6)6+gJyP{qgd4>H<?ZzWp zo36&%TGy*Ke%mYClzBn+-t&tl9<S_po&6u!FWmXIT5ERDL*po&7|HDYN3Ry{%(0#r zzkB0LmwzD}-yibgvNKcX7GHCVhxg*l$zu0v&Q9qKOP{;-j19}AfH}+3{10(I4%{qn zAi2)Cr(`<Yh8xl$-mUl5jvrIcn4J9Ex#aCyW}SuUn`Iq5>wE8(H{4u%`=i6D11C#& z&D+^<ee#ob#f09~0{J_F9Gvuocb{giI;*>6;gYSr{>&R+AKvV6W1X=2fe%b#`(3Mq z*cXI_b$l?}+||Bqy6-OD=*X!|>FTp%BBUc9AHL=8Ai5=6@b$6{mdE(J^KP@3>}g5b z^DxagWcGV&G0P2Ce3!=5cb(9yjWABvS+{<!acjA0$+A1qx^pe#89tl-u$#T_-ukau zlYSS>i(0tSul<i3OP$8C4|(a8YXr8=y0lMXuS8AETUqUeat~M+rd{^iwZ~rh%e12( z0`68t>7>@4*)3<kL3i1I4-N@UP9gUQoq*fvJ1<J#yUvjGz0|C&J3=@AmuUUuMDy6L zmrtbcwMbSpC>zE)Eay*bds8aUb7Aki!xDOa0zF-^4u=;_3%<zAG&T5Q!PG}ytZM{9 zH40L99CFlh5@iqL^om%)b-}*Gh?6Cb@fhDUAJ^tk2HU63Z{NqfOPy`Ob8G+Sg9X`2 z^;`A0jFwM5zr!tY<5s84G^G}fyOF!<#Wphtd|dHuLE8#WRe=)U6^k6RokV#<g-?ZS zShj$VHJ9sDLBp~Ieau;0S`iDDIf$m-|B>hYS4z%C=b*G~b#g)X=7P%-chbVD+K%mc z74yN3=jslgtjUMkIV8R_nf}f=Q(Q3Nm&BwOySkZ=N95n)bk{u>)2O(u^}f%odsg{& zSL*l6x387|pL(bzBYCyXi?nTy?75lJB`c0?3tYTxdOj;_?4DAKjF;CQhH;6n)4zPA z>08>WiiUqa!W>r?uWW4mW%BM-`SYKrt>X7w&XtZVI&$aq|4&@p^};bLPdPl;=9W|C zn)iTVwaaAQFx^`h7lba>WLi+Q#kp~n2lt-b`i74W>fOZCckK%eXxJ6@wCQD}F!!qD zP@9H2(?*9~q0F;q-B0=(T$)#2`1RVGcaL`dO!|0CW|~cCx!As<F4tU@7bg$b?2LJQ z<D^`z+U~9<^8m%0y$LH5!v9_G)#-aumTAGV-T$cXPw6jxUpcqh<y8Kel~i}mUQT9f zq_Sei+t5oh*0j|>PIb3TJL~D4eDkQ_H*L4?PbL&yDR4b5Y`r@|JY-|ruKv#ta=gB- zG`2o0@blPn!93%%%M<f<oxZ&0<Gg@Nb2b`GU90wDPZ0a*-I{EUtLA2;O#j@nerDSv zr|EC5#~jq;$_?5s^L}Eyy~{O*|C8LV9}*3?vMzWo?*u)*?;BLJ*Q(Wjk-2Cp`Z8)2 zr(TV3!P+Y<*YkV}9+qBfz20QL%wB9s=hWCMUW-$C-pmoVo++Nhb@<n*NGawmXJ#cY ztUR~#!P|_^>aC0N-TPio=JNeeb-2PpW>4a&9S2@TI{21Od2Y>aVp_aD@2*euB{AnC z4MI|<Uu(~qt#flmS=o=}zXe`3Y_5Of`G`4bYV)et`FZL3Q~I~)Ypf6GVTeAmlwbPM z$!+TxG?c%e(Fj}k=;f{2g{i+&ByM&Zt=@R|SW3{x-4dEC3Py|!RYFw{sviEfFnjgt zN@up4W5H30rj;}IF@(DJw05lLJiafo|Bm7JW3m<bcN)LXkgYg>ZR4YxR%N!)?DyD9 z>krfhu;2Sxw8kR7FZTKA#`1kK75*m~%W`BKjvr$z%8~Kz>rFnnvG9$R8Q+@Z#}P$2 zGSYp$%x`a4NU*-1^3LMZeR+@PD-Jc-tqqYDoA=?Bj?kS5Z5u7G`buXJ`P<rO9q&qY z%~)^Y#u>&g;kAFm4Zl^z8ChDl8B@}oC*3`)+FXC?e2KxOLl#R~6+OBa_lvQ~9Xu}M z*e<=c$0Tmycaw+d3RADF*}1O#`ZKO~&FMeXA5QA<NN3-|^2~Be$E*W~{wn{Bx!=go z^lLKj3vuZS`<tB~XFV66qI=@uX5JV6W((qT9M0~aK2LAv<nXt<oy})HwVi%^^K)*+ z&3@W(;s?#0yy}-3>F@6@l{j3hVQ}$(;>3Q7r<<miZkBDEbobHW+J-BquRRd++WjL{ zrg>jq$^K)Vc1}B1&lQ=jZX0HE%e}5Tu6O>-=?N1nUQ|UKPfbdw)158$g7wFh8B!5` zR`Ds`L03-R+PZn0m4i9Qs~3k{jf1RY%l^+*S*1UVt5lRp%Khiu`dzB?&fON&n6Yd7 z-4oNrIwgK>+8k-vU9#-mu~!m?v+i`N{BYG=5EmQjIZyTLVujsv4euHDr9Y}#_u|Bp zDQCIz%e`)8FP-^xs+#nFDbGi*9M0cN{dZx<m6Ru+-z(3T|7}+D<g@bqa`y=eQ~rE; z{9NBEv7^jl&+OWLk1P6jTJ2qKQZHROeNw<tm$aFGSE*evZ{=!raqUX|_vh}k&AnU7 z=hwKT9u=tjb-CZ3Z$fxwjroJ0%2m%_sI2|-^YeN8|27JY-olFB4xj!%|8|+tO7QE8 z|9llwe!kz;*p)QxlEc?$t2+NAz5L66b8+OQH{aKIm<6A_*Y_iDYW$ALb3OWg{JhK< zT>sZ~^@T@SY`ZVFbJbW)NKq3G{NLgFwJ_8EN?TrL%#+{Rp6{mpTs)u8r_N9G`Xtw% z-*4yFq})&ITyyA^!L*w*mu}*!U%dIwF|)YX=o3LDZztC7u1+pr=T-YXf99`uU#0h+ zK9j_5mH$R<k-62^<@QVViX1L^D*Lvj{?DJ!_G}vO>aEq)%O<TdYLHG^vcdlU<8O;6 z+JFA~^QQ5(-^{-~O<mttD*lwbx87<lo1vH=)5{Xo2`BmtCH=L|rD-nw@~NG3NzPnf zMlHFoOMV?Ybol<(1$uE`P1c|OI@8ZaTj;#Vwxy?zK94L^USB#h?deqgzI|u@aO{0N zbImQ&*wE>x%YNp!*3bNtU-(>3@Ob(9-@B)B9j@*Ayg?+<^ySa5%dazioE`A3%yY#S zp>qCTSGKBGZQMWe?mW@hV_d73F5U4&V}0i$hKy+Y%c-UeMVV|ROdmZHj{HqFO)S&Z zcQUU|=;r$|*<#U*xdAIyU4DLk`|FN?_{Rok7I2I4nZCGh5$NVxdn{zFq`33pH@DtL YZrWXHd2{*xJ{{R<hySy$kdC|#0Jo7zzW@LL diff --git a/doc/html/portableIO.html b/doc/html/portableIO.html index 6f774206..4fb4577a 100644 --- a/doc/html/portableIO.html +++ b/doc/html/portableIO.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Using Binary Files In ProMod3 — ProMod3 1.2.0 documentation</title> + <title>Using Binary Files In ProMod3 — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: './', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="_static/underscore.js"></script> <script type="text/javascript" src="_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="index.html" /> <link rel="up" title="Documentation For Developers" href="developers.html" /> <link rel="next" title="License" href="license.html" /> <link rel="prev" title="ProMod3‘s Share Of CMake" href="cmake/index.html" /> + <link rel="stylesheet" href="_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -109,7 +111,7 @@ Generally, we store any data-structure value-by-value as fixed-width types!</p> </ul> <p>Each serializable class must define a <code class="docutils literal"><span class="pre">Serialize</span></code> function that accepts sinks and sources, such as:</p> -<div class="highlight-cpp"><div class="highlight"><pre><span class="k">template</span> <span class="o"><</span><span class="k">typename</span> <span class="n">DS</span><span class="o">></span> +<div class="highlight-cpp"><div class="highlight"><pre><span></span><span class="k">template</span> <span class="o"><</span><span class="k">typename</span> <span class="n">DS</span><span class="o">></span> <span class="kt">void</span> <span class="n">Serialize</span><span class="p">(</span><span class="n">DS</span><span class="o">&</span> <span class="n">ds</span><span class="p">)</span> <span class="p">{</span> <span class="c1">// serialize element-by-element</span> <span class="p">}</span> @@ -117,7 +119,7 @@ and sources, such as:</p> </div> <p>Or if this is not possible for an object of type <code class="docutils literal"><span class="pre">T</span></code>, we need to define global functions such as:</p> -<div class="highlight-cpp"><div class="highlight"><pre><span class="kr">inline</span> <span class="kt">void</span> <span class="nf">Serialize</span><span class="p">(</span><span class="n">core</span><span class="o">::</span><span class="n">PortableBinaryDataSource</span><span class="o">&</span> <span class="n">ds</span><span class="p">,</span> <span class="n">T</span><span class="o">&</span> <span class="n">t</span><span class="p">)</span> <span class="p">{</span> <span class="p">}</span> +<div class="highlight-cpp"><div class="highlight"><pre><span></span><span class="kr">inline</span> <span class="kt">void</span> <span class="nf">Serialize</span><span class="p">(</span><span class="n">core</span><span class="o">::</span><span class="n">PortableBinaryDataSource</span><span class="o">&</span> <span class="n">ds</span><span class="p">,</span> <span class="n">T</span><span class="o">&</span> <span class="n">t</span><span class="p">)</span> <span class="p">{</span> <span class="p">}</span> <span class="kr">inline</span> <span class="kt">void</span> <span class="nf">Serialize</span><span class="p">(</span><span class="n">core</span><span class="o">::</span><span class="n">PortableBinaryDataSink</span><span class="o">&</span> <span class="n">ds</span><span class="p">,</span> <span class="n">T</span> <span class="n">t</span><span class="p">)</span> <span class="p">{</span> <span class="p">}</span> </pre></div> </div> @@ -144,7 +146,7 @@ serialize the values manually and convert each element appropriately.</li> <h2>Code Example<a class="headerlink" href="#code-example" title="Permalink to this headline">¶</a></h2> <p>Here is an example of a class which provides functionality for portable and non-portable I/O:</p> -<div class="highlight-cpp"><div class="highlight"><pre><span class="c1">// includes for this class</span> +<div class="highlight-cpp"><div class="highlight"><pre><span></span><span class="c1">// includes for this class</span> <span class="cp">#include</span> <span class="cpf"><boost/shared_ptr.hpp></span><span class="cp"></span> <span class="cp">#include</span> <span class="cpf"><iostream></span><span class="cp"></span> <span class="cp">#include</span> <span class="cpf"><fstream></span><span class="cp"></span> @@ -469,9 +471,6 @@ in the <code class="file docutils literal"><span class="pre">extras/data_generat <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -482,8 +481,8 @@ in the <code class="file docutils literal"><span class="pre">extras/data_generat ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="_sources/portableIO.txt" diff --git a/doc/html/py-modindex.html b/doc/html/py-modindex.html index fbef0d90..dfe91145 100644 --- a/doc/html/py-modindex.html +++ b/doc/html/py-modindex.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Python Module Index — ProMod3 1.2.0 documentation</title> + <title>Python Module Index — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: './', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="_static/underscore.js"></script> <script type="text/javascript" src="_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="index.html" /> + <link rel="stylesheet" href="_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -123,9 +125,6 @@ <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -136,8 +135,8 @@ ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> </div> diff --git a/doc/html/references.html b/doc/html/references.html index 30d6dfc7..c6a96646 100644 --- a/doc/html/references.html +++ b/doc/html/references.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>References — ProMod3 1.2.0 documentation</title> + <title>References — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: './', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,15 +24,17 @@ <script type="text/javascript" src="_static/underscore.js"></script> <script type="text/javascript" src="_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="index.html" /> <link rel="next" title="Changelog" href="changelog.html" /> <link rel="prev" title="License" href="license.html" /> + <link rel="stylesheet" href="_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -195,9 +197,6 @@ Fragments. Proteins.</td></tr> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -208,8 +207,8 @@ Fragments. Proteins.</td></tr> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="_sources/references.txt" diff --git a/doc/html/scoring/all_atom_scorers.html b/doc/html/scoring/all_atom_scorers.html index 447f7674..0fce2172 100644 --- a/doc/html/scoring/all_atom_scorers.html +++ b/doc/html/scoring/all_atom_scorers.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>All Atom Scorers — ProMod3 1.2.0 documentation</title> + <title>All Atom Scorers — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="scoring - Loop Scoring" href="index.html" /> <link rel="next" title="Other Scoring Functions" href="other_scoring_functions.html" /> <link rel="prev" title="Backbone Scorers" href="backbone_scorers.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -319,7 +321,7 @@ less machine-dependent).</p> <tr class="field-odd field"><th class="field-name">Return type:</th><td class="field-body"><a class="reference internal" href="#promod3.scoring.AllAtomInteractionScorer" title="promod3.scoring.AllAtomInteractionScorer"><code class="xref py py-class docutils literal"><span class="pre">AllAtomInteractionScorer</span></code></a></td> </tr> <tr class="field-even field"><th class="field-name">Raises:</th><td class="field-body"><a class="reference external" href="https://docs.python.org/2.7/library/exceptions.html#exceptions.RuntimeError" title="(in Python v2.7)"><code class="xref py py-exc docutils literal"><span class="pre">RuntimeError</span></code></a> if file cannot be opened or if -file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> for details).</td> +file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details).</td> </tr> </tbody> </table> @@ -331,7 +333,7 @@ file cannot be parsed (see <a class="reference internal" href="../portableIO.htm <dt id="promod3.scoring.AllAtomInteractionScorer.SavePortable"> <code class="descname">SavePortable</code><span class="sig-paren">(</span><em>filename</em><span class="sig-paren">)</span><a class="headerlink" href="#promod3.scoring.AllAtomInteractionScorer.SavePortable" title="Permalink to this definition">¶</a></dt> <dd><p>Saves a raw / portable binary representation. Use portable files for -distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> +distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details.</p> <table class="docutils field-list" frame="void" rules="none"> <col class="field-name" /> @@ -478,7 +480,7 @@ less machine-dependent).</p> <tr class="field-odd field"><th class="field-name">Return type:</th><td class="field-body"><a class="reference internal" href="#promod3.scoring.AllAtomPackingScorer" title="promod3.scoring.AllAtomPackingScorer"><code class="xref py py-class docutils literal"><span class="pre">AllAtomPackingScorer</span></code></a></td> </tr> <tr class="field-even field"><th class="field-name">Raises:</th><td class="field-body"><a class="reference external" href="https://docs.python.org/2.7/library/exceptions.html#exceptions.RuntimeError" title="(in Python v2.7)"><code class="xref py py-exc docutils literal"><span class="pre">RuntimeError</span></code></a> if file cannot be opened or if -file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> for details).</td> +file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details).</td> </tr> </tbody> </table> @@ -490,7 +492,7 @@ file cannot be parsed (see <a class="reference internal" href="../portableIO.htm <dt id="promod3.scoring.AllAtomPackingScorer.SavePortable"> <code class="descname">SavePortable</code><span class="sig-paren">(</span><em>filename</em><span class="sig-paren">)</span><a class="headerlink" href="#promod3.scoring.AllAtomPackingScorer.SavePortable" title="Permalink to this definition">¶</a></dt> <dd><p>Saves a raw / portable binary representation. Use portable files for -distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> +distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details.</p> <table class="docutils field-list" frame="void" rules="none"> <col class="field-name" /> @@ -663,9 +665,6 @@ of residues in the input loop. True by default.</td> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -676,8 +675,8 @@ of residues in the input loop. True by default.</td> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/scoring/all_atom_scorers.txt" diff --git a/doc/html/scoring/backbone_score_env.html b/doc/html/scoring/backbone_score_env.html index df2f4d87..a5a744a7 100644 --- a/doc/html/scoring/backbone_score_env.html +++ b/doc/html/scoring/backbone_score_env.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Backbone Score Environment — ProMod3 1.2.0 documentation</title> + <title>Backbone Score Environment — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="scoring - Loop Scoring" href="index.html" /> <link rel="next" title="Backbone Scorers" href="backbone_scorers.html" /> <link rel="prev" title="scoring - Loop Scoring" href="index.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -499,9 +501,6 @@ inconsistent with SEQRES you initialized the DiscoContainer with</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -512,8 +511,8 @@ inconsistent with SEQRES you initialized the DiscoContainer with</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/scoring/backbone_score_env.txt" diff --git a/doc/html/scoring/backbone_scorers.html b/doc/html/scoring/backbone_scorers.html index 06c5f4a4..986fd44d 100644 --- a/doc/html/scoring/backbone_scorers.html +++ b/doc/html/scoring/backbone_scorers.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Backbone Scorers — ProMod3 1.2.0 documentation</title> + <title>Backbone Scorers — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="scoring - Loop Scoring" href="index.html" /> <link rel="next" title="All Atom Scorers" href="all_atom_scorers.html" /> <link rel="prev" title="Backbone Score Environment" href="backbone_score_env.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -343,7 +345,7 @@ less machine-dependent).</p> <tr class="field-odd field"><th class="field-name">Return type:</th><td class="field-body"><a class="reference internal" href="#promod3.scoring.CBPackingScorer" title="promod3.scoring.CBPackingScorer"><code class="xref py py-class docutils literal"><span class="pre">CBPackingScorer</span></code></a></td> </tr> <tr class="field-even field"><th class="field-name">Raises:</th><td class="field-body"><a class="reference external" href="https://docs.python.org/2.7/library/exceptions.html#exceptions.RuntimeError" title="(in Python v2.7)"><code class="xref py py-exc docutils literal"><span class="pre">RuntimeError</span></code></a> if file cannot be opened or if -file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> for details).</td> +file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details).</td> </tr> </tbody> </table> @@ -355,7 +357,7 @@ file cannot be parsed (see <a class="reference internal" href="../portableIO.htm <dt id="promod3.scoring.CBPackingScorer.SavePortable"> <code class="descname">SavePortable</code><span class="sig-paren">(</span><em>filename</em><span class="sig-paren">)</span><a class="headerlink" href="#promod3.scoring.CBPackingScorer.SavePortable" title="Permalink to this definition">¶</a></dt> <dd><p>Saves a raw / portable binary representation. Use portable files for -distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> +distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details.</p> <table class="docutils field-list" frame="void" rules="none"> <col class="field-name" /> @@ -474,7 +476,7 @@ less machine-dependent).</p> <tr class="field-odd field"><th class="field-name">Return type:</th><td class="field-body"><a class="reference internal" href="#promod3.scoring.CBetaScorer" title="promod3.scoring.CBetaScorer"><code class="xref py py-class docutils literal"><span class="pre">CBetaScorer</span></code></a></td> </tr> <tr class="field-even field"><th class="field-name">Raises:</th><td class="field-body"><a class="reference external" href="https://docs.python.org/2.7/library/exceptions.html#exceptions.RuntimeError" title="(in Python v2.7)"><code class="xref py py-exc docutils literal"><span class="pre">RuntimeError</span></code></a> if file cannot be opened or if -file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> for details).</td> +file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details).</td> </tr> </tbody> </table> @@ -486,7 +488,7 @@ file cannot be parsed (see <a class="reference internal" href="../portableIO.htm <dt id="promod3.scoring.CBetaScorer.SavePortable"> <code class="descname">SavePortable</code><span class="sig-paren">(</span><em>filename</em><span class="sig-paren">)</span><a class="headerlink" href="#promod3.scoring.CBetaScorer.SavePortable" title="Permalink to this definition">¶</a></dt> <dd><p>Saves a raw / portable binary representation. Use portable files for -distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> +distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details.</p> <table class="docutils field-list" frame="void" rules="none"> <col class="field-name" /> @@ -650,7 +652,7 @@ less machine-dependent).</p> <tr class="field-odd field"><th class="field-name">Return type:</th><td class="field-body"><a class="reference internal" href="#promod3.scoring.ReducedScorer" title="promod3.scoring.ReducedScorer"><code class="xref py py-class docutils literal"><span class="pre">ReducedScorer</span></code></a></td> </tr> <tr class="field-even field"><th class="field-name">Raises:</th><td class="field-body"><a class="reference external" href="https://docs.python.org/2.7/library/exceptions.html#exceptions.RuntimeError" title="(in Python v2.7)"><code class="xref py py-exc docutils literal"><span class="pre">RuntimeError</span></code></a> if file cannot be opened or if -file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> for details).</td> +file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details).</td> </tr> </tbody> </table> @@ -662,7 +664,7 @@ file cannot be parsed (see <a class="reference internal" href="../portableIO.htm <dt id="promod3.scoring.ReducedScorer.SavePortable"> <code class="descname">SavePortable</code><span class="sig-paren">(</span><em>filename</em><span class="sig-paren">)</span><a class="headerlink" href="#promod3.scoring.ReducedScorer.SavePortable" title="Permalink to this definition">¶</a></dt> <dd><p>Saves a raw / portable binary representation. Use portable files for -distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> +distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details.</p> <table class="docutils field-list" frame="void" rules="none"> <col class="field-name" /> @@ -898,7 +900,7 @@ less machine-dependent).</p> <tr class="field-odd field"><th class="field-name">Return type:</th><td class="field-body"><a class="reference internal" href="#promod3.scoring.HBondScorer" title="promod3.scoring.HBondScorer"><code class="xref py py-class docutils literal"><span class="pre">HBondScorer</span></code></a></td> </tr> <tr class="field-even field"><th class="field-name">Raises:</th><td class="field-body"><a class="reference external" href="https://docs.python.org/2.7/library/exceptions.html#exceptions.RuntimeError" title="(in Python v2.7)"><code class="xref py py-exc docutils literal"><span class="pre">RuntimeError</span></code></a> if file cannot be opened or if -file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> for details).</td> +file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details).</td> </tr> </tbody> </table> @@ -910,7 +912,7 @@ file cannot be parsed (see <a class="reference internal" href="../portableIO.htm <dt id="promod3.scoring.HBondScorer.SavePortable"> <code class="descname">SavePortable</code><span class="sig-paren">(</span><em>filename</em><span class="sig-paren">)</span><a class="headerlink" href="#promod3.scoring.HBondScorer.SavePortable" title="Permalink to this definition">¶</a></dt> <dd><p>Saves a raw / portable binary representation. Use portable files for -distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> +distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details.</p> <table class="docutils field-list" frame="void" rules="none"> <col class="field-name" /> @@ -1053,7 +1055,7 @@ less machine-dependent).</p> <tr class="field-odd field"><th class="field-name">Return type:</th><td class="field-body"><a class="reference internal" href="#promod3.scoring.SSAgreementScorer" title="promod3.scoring.SSAgreementScorer"><code class="xref py py-class docutils literal"><span class="pre">SSAgreementScorer</span></code></a></td> </tr> <tr class="field-even field"><th class="field-name">Raises:</th><td class="field-body"><a class="reference external" href="https://docs.python.org/2.7/library/exceptions.html#exceptions.RuntimeError" title="(in Python v2.7)"><code class="xref py py-exc docutils literal"><span class="pre">RuntimeError</span></code></a> if file cannot be opened or if -file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> for details).</td> +file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details).</td> </tr> </tbody> </table> @@ -1065,7 +1067,7 @@ file cannot be parsed (see <a class="reference internal" href="../portableIO.htm <dt id="promod3.scoring.SSAgreementScorer.SavePortable"> <code class="descname">SavePortable</code><span class="sig-paren">(</span><em>filename</em><span class="sig-paren">)</span><a class="headerlink" href="#promod3.scoring.SSAgreementScorer.SavePortable" title="Permalink to this definition">¶</a></dt> <dd><p>Saves a raw / portable binary representation. Use portable files for -distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> +distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details.</p> <table class="docutils field-list" frame="void" rules="none"> <col class="field-name" /> @@ -1186,7 +1188,7 @@ less machine-dependent).</p> <tr class="field-odd field"><th class="field-name">Return type:</th><td class="field-body"><a class="reference internal" href="#promod3.scoring.TorsionScorer" title="promod3.scoring.TorsionScorer"><code class="xref py py-class docutils literal"><span class="pre">TorsionScorer</span></code></a></td> </tr> <tr class="field-even field"><th class="field-name">Raises:</th><td class="field-body"><a class="reference external" href="https://docs.python.org/2.7/library/exceptions.html#exceptions.RuntimeError" title="(in Python v2.7)"><code class="xref py py-exc docutils literal"><span class="pre">RuntimeError</span></code></a> if file cannot be opened or if -file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> for details).</td> +file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details).</td> </tr> </tbody> </table> @@ -1198,7 +1200,7 @@ file cannot be parsed (see <a class="reference internal" href="../portableIO.htm <dt id="promod3.scoring.TorsionScorer.SavePortable"> <code class="descname">SavePortable</code><span class="sig-paren">(</span><em>filename</em><span class="sig-paren">)</span><a class="headerlink" href="#promod3.scoring.TorsionScorer.SavePortable" title="Permalink to this definition">¶</a></dt> <dd><p>Saves a raw / portable binary representation. Use portable files for -distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> +distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details.</p> <table class="docutils field-list" frame="void" rules="none"> <col class="field-name" /> @@ -1379,9 +1381,6 @@ of residues to be scored. True by default.</td> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -1392,8 +1391,8 @@ of residues to be scored. True by default.</td> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/scoring/backbone_scorers.txt" diff --git a/doc/html/scoring/index.html b/doc/html/scoring/index.html index 2d032be3..000b9b1b 100644 --- a/doc/html/scoring/index.html +++ b/doc/html/scoring/index.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>scoring - Loop Scoring — ProMod3 1.2.0 documentation</title> + <title>scoring - Loop Scoring — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="Documentation For Users" href="../users.html" /> <link rel="next" title="Backbone Score Environment" href="backbone_score_env.html" /> <link rel="prev" title="Subrotamer Optimization" href="../sidechain/subrotamer_optimizer.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -50,8 +52,8 @@ The environment is updated as the modelling proceeds and manages efficient spatial lookups to be used by the attached scorers.</p> <p>In this example, we load a structure, setup a score environment, link a few scorers to it and finally score some loops:</p> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">seq</span> -<span class="kn">from</span> <span class="nn">promod3</span> <span class="kn">import</span> <span class="n">loop</span><span class="p">,</span> <span class="n">scoring</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">io</span><span class="p">,</span> <span class="n">seq</span> +<span class="kn">from</span> <span class="nn">promod3</span> <span class="k">import</span> <span class="n">loop</span><span class="p">,</span> <span class="n">scoring</span> <span class="c1"># load data</span> <span class="n">ent</span> <span class="o">=</span> <span class="n">io</span><span class="o">.</span><span class="n">LoadPDB</span><span class="p">(</span><span class="s2">"data/1CRN.pdb"</span><span class="p">)</span> @@ -70,8 +72,8 @@ scorers to it and finally score some loops:</p> <span class="c1"># calculate scores for 10 residues starting at residue number 23.</span> <span class="c1"># all required structural information comes from the environment</span> <span class="c1"># that can evolve as the modelling proceeds.</span> -<span class="k">print</span> <span class="s2">"Clash-Score"</span><span class="p">,</span> <span class="n">clash_scorer</span><span class="o">.</span><span class="n">CalculateScore</span><span class="p">(</span><span class="mi">23</span><span class="p">,</span> <span class="mi">10</span><span class="p">)</span> -<span class="k">print</span> <span class="s2">"CBeta-Score"</span><span class="p">,</span> <span class="n">cbeta_scorer</span><span class="o">.</span><span class="n">CalculateScore</span><span class="p">(</span><span class="mi">23</span><span class="p">,</span> <span class="mi">10</span><span class="p">)</span> +<span class="nb">print</span> <span class="s2">"Clash-Score"</span><span class="p">,</span> <span class="n">clash_scorer</span><span class="o">.</span><span class="n">CalculateScore</span><span class="p">(</span><span class="mi">23</span><span class="p">,</span> <span class="mi">10</span><span class="p">)</span> +<span class="nb">print</span> <span class="s2">"CBeta-Score"</span><span class="p">,</span> <span class="n">cbeta_scorer</span><span class="o">.</span><span class="n">CalculateScore</span><span class="p">(</span><span class="mi">23</span><span class="p">,</span> <span class="mi">10</span><span class="p">)</span> </pre></div> </div> <p>Contents:</p> @@ -143,9 +145,6 @@ scorers to it and finally score some loops:</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -156,8 +155,8 @@ scorers to it and finally score some loops:</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/scoring/index.txt" diff --git a/doc/html/scoring/other_scoring_functions.html b/doc/html/scoring/other_scoring_functions.html index 11607329..808f5acc 100644 --- a/doc/html/scoring/other_scoring_functions.html +++ b/doc/html/scoring/other_scoring_functions.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Other Scoring Functions — ProMod3 1.2.0 documentation</title> + <title>Other Scoring Functions — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="scoring - Loop Scoring" href="index.html" /> <link rel="next" title="loop - Loop Handling" href="../loop/index.html" /> <link rel="prev" title="All Atom Scorers" href="all_atom_scorers.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -150,9 +152,6 @@ construction algorithm <a class="reference internal" href="../references.html#ca <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -163,8 +162,8 @@ construction algorithm <a class="reference internal" href="../references.html#ca ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/scoring/other_scoring_functions.txt" diff --git a/doc/html/search.html b/doc/html/search.html index bf365f21..385d102b 100644 --- a/doc/html/search.html +++ b/doc/html/search.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Search — ProMod3 1.2.0 documentation</title> + <title>Search — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: './', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -25,7 +25,7 @@ <script type="text/javascript" src="_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> <script type="text/javascript" src="_static/searchtools.js"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="index.html" /> <script type="text/javascript"> jQuery(function() { Search.loadIndex("searchindex.js"); }); </script> @@ -33,12 +33,14 @@ <script type="text/javascript" id="searchindexloader"></script> + <link rel="stylesheet" href="_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -88,8 +90,8 @@ ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> </div> diff --git a/doc/html/searchindex.js b/doc/html/searchindex.js index 66ae0659..97200f95 100644 --- a/doc/html/searchindex.js +++ b/doc/html/searchindex.js @@ -1 +1 @@ -Search.setIndex({envversion:46,filenames:["actions/index","actions/index_dev","buildsystem","changelog","cmake/index","container/docker","container/index","container/singularity","contributing","core/geometry","core/graph_minimizer","core/helper","core/index","core/pm3argparse","core/runtime_profiling","core/setcompoundschemlib","dev_setup","developers","gettingstarted","index","license","loop/all_atom","loop/backbone","loop/index","loop/load_loop_objects","loop/mm_system_creation","loop/structure_db","loop/torsion_sampler","modelling/algorithms","modelling/gap_handling","modelling/index","modelling/loop_candidates","modelling/loop_closing","modelling/model_checking","modelling/monte_carlo","modelling/pipeline","modelling/sidechain_reconstruction","portableIO","references","scoring/all_atom_scorers","scoring/backbone_score_env","scoring/backbone_scorers","scoring/index","scoring/other_scoring_functions","sidechain/disulfid","sidechain/frame","sidechain/graph","sidechain/index","sidechain/loading","sidechain/rotamer","sidechain/rotamer_constructor","sidechain/rotamer_id","sidechain/rotamer_lib","sidechain/subrotamer_optimizer","users"],objects:{"":{"--backbone-independent":[0,7,1,"cmdoption--backbone-independent"],"--keep-sidechains":[0,7,1,"cmdoption--keep-sidechains"],"--no-disulfids":[0,7,1,"cmdoption--no-disulfids"],"--no-subrotamer-optimization":[0,7,1,"cmdoption--no-subrotamer-optimization"],"--rigid-rotamers":[0,7,1,"cmdoption--rigid-rotamers"],"-i":[0,7,1,"cmdoption-i"],"-k":[0,7,1,"cmdoption-k"],"-n":[0,7,1,"cmdoption-n"],"-r":[0,7,1,"cmdoption-r"],"-s":[0,7,1,"cmdoption-s"],"command:add_doc_dependency":[4,0,1,""],"command:add_doc_source":[4,0,1,""],"command:convert_module_data":[4,0,1,""],"command:module":[4,0,1,""],"command:pm_action":[4,0,1,""],"command:promod3_unittest":[4,0,1,""],"command:pymod":[4,0,1,""],test_actions:[1,2,0,"-"]},"promod3.core":{ConstructAtomPos:[9,1,1,""],ConstructCBetaPos:[9,1,1,""],ConstructCTerminalOxygens:[9,1,1,""],EvaluateGromacsPosRule:[9,1,1,""],GraphMinimizer:[10,3,1,""],RotationAroundLine:[9,1,1,""],StaticRuntimeProfiler:[14,3,1,""],StemCoords:[9,3,1,""],StemPairOrientation:[9,3,1,""],helper:[11,2,0,"-"],pm3argparse:[13,2,0,"-"]},"promod3.core.GraphMinimizer":{AStarSolve:[10,4,1,""],AddEdge:[10,4,1,""],AddNode:[10,4,1,""],ApplyDEE:[10,4,1,""],ApplyEdgeDecomposition:[10,4,1,""],MCSolve:[10,4,1,""],NaiveSolve:[10,4,1,""],Prune:[10,4,1,""],Reset:[10,4,1,""],TreeSolve:[10,4,1,""]},"promod3.core.StaticRuntimeProfiler":{Clear:[14,5,1,""],IsEnabled:[14,5,1,""],PrintSummary:[14,5,1,""],Start:[14,5,1,""],StartScoped:[14,5,1,""],Stop:[14,5,1,""]},"promod3.core.StemCoords":{c_coord:[9,6,1,""],ca_coord:[9,6,1,""],n_coord:[9,6,1,""]},"promod3.core.StemPairOrientation":{angle_four:[9,6,1,""],angle_one:[9,6,1,""],angle_three:[9,6,1,""],angle_two:[9,6,1,""],distance:[9,6,1,""]},"promod3.core.helper":{FileExists:[11,1,1,""],FileExtension:[11,1,1,""],FileGzip:[11,1,1,""],MsgErrorAndExit:[11,1,1,""]},"promod3.core.pm3argparse":{PM3ArgumentParser:[13,3,1,""]},"promod3.core.pm3argparse.PM3ArgumentParser":{"__init__":[13,4,1,""],AddAlignment:[13,4,1,""],AddProfile:[13,4,1,""],AddStructure:[13,4,1,""],AssembleParser:[13,4,1,""],Parse:[13,4,1,""],action:[13,6,1,""]},"promod3.loop":{AllAtomEnv:[21,3,1,""],AllAtomEnvPositions:[21,3,1,""],AllAtomPositions:[21,3,1,""],AminoAcidAtom:[21,3,1,""],AminoAcidHydrogen:[21,3,1,""],AminoAcidLookup:[21,3,1,""],BackboneList:[22,3,1,""],CoordInfo:[26,3,1,""],ForcefieldAminoAcid:[25,3,1,""],ForcefieldBondInfo:[25,3,1,""],ForcefieldConnectivity:[25,3,1,""],ForcefieldHarmonicAngleInfo:[25,3,1,""],ForcefieldHarmonicImproperInfo:[25,3,1,""],ForcefieldLJPairInfo:[25,3,1,""],ForcefieldLookup:[25,3,1,""],ForcefieldPeriodicDihedralInfo:[25,3,1,""],ForcefieldUreyBradleyAngleInfo:[25,3,1,""],FragDB:[26,3,1,""],Fragger:[26,3,1,""],FraggerMap:[26,3,1,""],FragmentInfo:[26,3,1,""],LoadFragDB:[24,4,1,""],LoadStructureDB:[24,4,1,""],LoadTorsionSampler:[24,4,1,""],LoadTorsionSamplerCoil:[24,4,1,""],LoadTorsionSamplerExtended:[24,4,1,""],LoadTorsionSamplerHelical:[24,4,1,""],MmSystemCreator:[25,3,1,""],PsipredPrediction:[26,3,1,""],StructureDB:[26,3,1,""],StructureDBDataType:[26,3,1,""],TorsionSampler:[27,3,1,""]},"promod3.loop.AllAtomEnv":{ClearEnvironment:[21,4,1,""],GetAllAtomPositions:[21,4,1,""],GetEnvironment:[21,4,1,""],GetSeqres:[21,4,1,""],SetEnvironment:[21,4,1,""],SetInitialEnvironment:[21,4,1,""]},"promod3.loop.AllAtomEnvPositions":{all_pos:[21,6,1,""],res_indices:[21,6,1,""]},"promod3.loop.AllAtomPositions":{AllAtomPositions:[21,4,1,""],ClearPos:[21,4,1,""],ClearResidue:[21,4,1,""],Copy:[21,4,1,""],Extract:[21,4,1,""],ExtractBackbone:[21,4,1,""],GetAA:[21,4,1,""],GetFirstIndex:[21,4,1,""],GetIndex:[21,4,1,""],GetLastIndex:[21,4,1,""],GetNumAtoms:[21,4,1,""],GetNumResidues:[21,4,1,""],GetOmegaTorsion:[21,4,1,""],GetPhiTorsion:[21,4,1,""],GetPos:[21,4,1,""],GetPsiTorsion:[21,4,1,""],GetSequence:[21,4,1,""],InsertInto:[21,4,1,""],IsAllSet:[21,4,1,""],IsAnySet:[21,4,1,""],IsSet:[21,4,1,""],SetPos:[21,4,1,""],SetResidue:[21,4,1,""],ToEntity:[21,4,1,""]},"promod3.loop.AminoAcidLookup":{GetAA:[21,5,1,""],GetAAA:[21,5,1,""],GetAAH:[21,5,1,""],GetAnchorAtomIndex:[21,5,1,""],GetAtomName:[21,5,1,""],GetAtomNameAmber:[21,5,1,""],GetAtomNameCharmm:[21,5,1,""],GetElement:[21,5,1,""],GetH1Index:[21,5,1,""],GetH2Index:[21,5,1,""],GetH3Index:[21,5,1,""],GetHNIndex:[21,5,1,""],GetHydrogenIndex:[21,5,1,""],GetIndex:[21,5,1,""],GetMaxNumAtoms:[21,5,1,""],GetMaxNumHydrogens:[21,5,1,""],GetNumAtoms:[21,5,1,""],GetNumHydrogens:[21,5,1,""],GetOLC:[21,5,1,""]},"promod3.loop.BackboneList":{"__len__":[22,4,1,""],ApplyTransform:[22,4,1,""],BackboneList:[22,4,1,""],CARMSD:[22,4,1,""],Copy:[22,4,1,""],Extract:[22,4,1,""],GetAA:[22,4,1,""],GetBounds:[22,4,1,""],GetC:[22,4,1,""],GetCA:[22,4,1,""],GetCB:[22,4,1,""],GetN:[22,4,1,""],GetO:[22,4,1,""],GetOLC:[22,4,1,""],GetOmegaTorsion:[22,4,1,""],GetPhiTorsion:[22,4,1,""],GetPsiTorsion:[22,4,1,""],GetSequence:[22,4,1,""],GetTransform:[22,4,1,""],InsertInto:[22,4,1,""],MinCADistance:[22,4,1,""],RMSD:[22,4,1,""],ReconstructCBetaPositions:[22,4,1,""],ReconstructCStemOxygen:[22,4,1,""],ReconstructOxygenPositions:[22,4,1,""],ReplaceFragment:[22,4,1,""],RotateAroundOmegaTorsion:[22,4,1,""],RotateAroundPhiPsiTorsion:[22,4,1,""],RotateAroundPhiTorsion:[22,4,1,""],RotateAroundPsiTorsion:[22,4,1,""],Set:[22,4,1,""],SetAA:[22,4,1,""],SetAroundOmegaTorsion:[22,4,1,""],SetAroundPhiPsiTorsion:[22,4,1,""],SetAroundPhiTorsion:[22,4,1,""],SetAroundPsiTorsion:[22,4,1,""],SetBackrub:[22,4,1,""],SetC:[22,4,1,""],SetCA:[22,4,1,""],SetCB:[22,4,1,""],SetN:[22,4,1,""],SetO:[22,4,1,""],SetOLC:[22,4,1,""],SetSequence:[22,4,1,""],SuperposeOnto:[22,4,1,""],ToDensity:[22,4,1,""],ToEntity:[22,4,1,""],TransOmegaTorsions:[22,4,1,""],append:[22,4,1,""],clear:[22,4,1,""],empty:[22,4,1,""],resize:[22,4,1,""]},"promod3.loop.CoordInfo":{chain_name:[26,6,1,""],id:[26,6,1,""],offset:[26,6,1,""],shift:[26,6,1,""],size:[26,6,1,""],start_resnum:[26,6,1,""]},"promod3.loop.ForcefieldBondInfo":{bond_length:[25,6,1,""],force_constant:[25,6,1,""],index_one:[25,6,1,""],index_two:[25,6,1,""]},"promod3.loop.ForcefieldConnectivity":{harmonic_angles:[25,6,1,""],harmonic_bonds:[25,6,1,""],harmonic_impropers:[25,6,1,""],lj_pairs:[25,6,1,""],periodic_dihedrals:[25,6,1,""],periodic_impropers:[25,6,1,""],urey_bradley_angles:[25,6,1,""]},"promod3.loop.ForcefieldHarmonicAngleInfo":{angle:[25,6,1,""],force_constant:[25,6,1,""],index_one:[25,6,1,""],index_three:[25,6,1,""],index_two:[25,6,1,""]},"promod3.loop.ForcefieldHarmonicImproperInfo":{angle:[25,6,1,""],force_constant:[25,6,1,""],index_four:[25,6,1,""],index_one:[25,6,1,""],index_three:[25,6,1,""],index_two:[25,6,1,""]},"promod3.loop.ForcefieldLJPairInfo":{epsilon:[25,6,1,""],index_one:[25,6,1,""],index_two:[25,6,1,""],sigma:[25,6,1,""]},"promod3.loop.ForcefieldLookup":{GetAA:[25,4,1,""],GetCharges:[25,4,1,""],GetDefault:[25,5,1,""],GetDisulfidConnectivity:[25,4,1,""],GetEpsilons:[25,4,1,""],GetFudgeLJ:[25,4,1,""],GetFudgeQQ:[25,4,1,""],GetHeavyIndex:[25,4,1,""],GetHydrogenIndex:[25,4,1,""],GetInternalConnectivity:[25,4,1,""],GetMasses:[25,4,1,""],GetNumAtoms:[25,4,1,""],GetOXTIndex:[25,4,1,""],GetPeptideBoundConnectivity:[25,4,1,""],GetSigmas:[25,4,1,""],Load:[25,5,1,""],LoadCHARMM:[25,5,1,""],LoadPortable:[25,5,1,""],Save:[25,4,1,""],SavePortable:[25,4,1,""],SetCharges:[25,4,1,""],SetDefault:[25,5,1,""],SetDisulfidConnectivity:[25,4,1,""],SetEpsilons:[25,4,1,""],SetFudgeLJ:[25,4,1,""],SetFudgeQQ:[25,4,1,""],SetInternalConnectivity:[25,4,1,""],SetMasses:[25,4,1,""],SetPeptideBoundConnectivity:[25,4,1,""],SetSigmas:[25,4,1,""]},"promod3.loop.ForcefieldPeriodicDihedralInfo":{force_constant:[25,6,1,""],index_four:[25,6,1,""],index_one:[25,6,1,""],index_three:[25,6,1,""],index_two:[25,6,1,""],multiplicity:[25,6,1,""],phase:[25,6,1,""]},"promod3.loop.ForcefieldUreyBradleyAngleInfo":{angle:[25,6,1,""],angle_force_constant:[25,6,1,""],bond_force_constant:[25,6,1,""],bond_length:[25,6,1,""],index_one:[25,6,1,""],index_three:[25,6,1,""],index_two:[25,6,1,""]},"promod3.loop.FragDB":{AddFragments:[26,4,1,""],GetAngularBinSize:[26,4,1,""],GetDistBinSize:[26,4,1,""],GetNumFragments:[26,4,1,""],GetNumStemPairs:[26,4,1,""],HasFragLength:[26,4,1,""],Load:[26,5,1,""],LoadPortable:[26,5,1,""],MaxFragLength:[26,4,1,""],PrintStatistics:[26,4,1,""],Save:[26,4,1,""],SavePortable:[26,4,1,""],SearchDB:[26,4,1,""]},"promod3.loop.Fragger":{"__getitem__":[26,4,1,""],"__len__":[26,4,1,""],AddSSAgreeParameters:[26,4,1,""],AddSeqIDParameters:[26,4,1,""],AddSeqSimParameters:[26,4,1,""],AddSequenceProfileParameters:[26,4,1,""],AddStructureProfileParameters:[26,4,1,""],AddTorsionProbabilityParameters:[26,4,1,""],Fill:[26,4,1,""],GetFragmentInfo:[26,4,1,""],GetScore:[26,4,1,""]},"promod3.loop.FraggerMap":{"__getitem__":[26,4,1,""],"__setitem__":[26,4,1,""],Contains:[26,4,1,""],Load:[26,4,1,""],LoadBB:[26,4,1,""],Save:[26,4,1,""],SaveBB:[26,4,1,""]},"promod3.loop.FragmentInfo":{chain_index:[26,6,1,""],length:[26,6,1,""],offset:[26,6,1,""]},"promod3.loop.MmSystemCreator":{ExtractLoopPositions:[25,4,1,""],GetCpuPlatformSupport:[25,4,1,""],GetDisulfidBridges:[25,4,1,""],GetForcefieldAminoAcids:[25,4,1,""],GetIndexing:[25,4,1,""],GetLoopLengths:[25,4,1,""],GetLoopStartIndices:[25,4,1,""],GetNumLoopResidues:[25,4,1,""],GetNumResidues:[25,4,1,""],GetSimulation:[25,4,1,""],SetCpuPlatformSupport:[25,4,1,""],SetupSystem:[25,4,1,""],UpdatePositions:[25,4,1,""]},"promod3.loop.PsipredPrediction":{"__len__":[26,4,1,""],Add:[26,4,1,""],Extract:[26,4,1,""],FromHHM:[26,4,1,""],FromHoriz:[26,4,1,""],GetConfidence:[26,4,1,""],GetConfidences:[26,4,1,""],GetPrediction:[26,4,1,""],GetPredictions:[26,4,1,""],PsipredPrediction:[26,4,1,""]},"promod3.loop.StructureDB":{AddCoordinates:[26,4,1,""],GenerateStructureProfile:[26,4,1,""],GetBackboneList:[26,4,1,""],GetCoordIdx:[26,4,1,""],GetCoordInfo:[26,4,1,""],GetDSSPStates:[26,4,1,""],GetDihedralAngles:[26,4,1,""],GetNumCoords:[26,4,1,""],GetResidueDepths:[26,4,1,""],GetSequence:[26,4,1,""],GetSequenceProfile:[26,4,1,""],GetSolventAccessibilitites:[26,4,1,""],GetStructureProfile:[26,4,1,""],GetSubDB:[26,4,1,""],HasData:[26,4,1,""],Load:[26,5,1,""],LoadPortable:[26,5,1,""],PrintStatistics:[26,4,1,""],RemoveCoordinates:[26,4,1,""],Save:[26,4,1,""],SavePortable:[26,4,1,""],SetStructureProfile:[26,4,1,""]},"promod3.loop.TorsionSampler":{Draw:[27,4,1,""],DrawPhiGivenPsi:[27,4,1,""],DrawPsiGivenPhi:[27,4,1,""],ExtractStatistics:[27,4,1,""],GetBinSize:[27,4,1,""],GetBinsPerDimension:[27,4,1,""],GetHistogramIndex:[27,4,1,""],GetHistogramIndices:[27,4,1,""],GetPhiProbabilityGivenPsi:[27,4,1,""],GetProbability:[27,4,1,""],GetPsiProbabilityGivenPhi:[27,4,1,""],Load:[27,5,1,""],LoadPortable:[27,5,1,""],Save:[27,4,1,""],SavePortable:[27,4,1,""],UpdateDistributions:[27,4,1,""]},"promod3.modelling":{AllAtomRelaxer:[32,3,1,""],BackboneRelaxer:[32,3,1,""],BuildFromRawModel:[35,1,1,""],BuildRawModel:[35,1,1,""],BuildSidechains:[35,1,1,""],CCD:[32,3,1,""],CCDCloser:[34,3,1,""],CTerminalCloser:[34,3,1,""],CheckFinalModel:[35,1,1,""],ClearGaps:[29,1,1,""],CloseGaps:[35,1,1,""],CloseLargeDeletions:[35,1,1,""],CloseSmallDeletions:[35,1,1,""],CloserBase:[34,3,1,""],CoolerBase:[34,3,1,""],CountEnclosedGaps:[29,1,1,""],CountEnclosedInsertions:[29,1,1,""],DeNovoCloser:[34,3,1,""],DirtyCCDCloser:[34,3,1,""],ExponentialCooler:[34,3,1,""],FillLoopsByDatabase:[35,1,1,""],FillLoopsByMonteCarlo:[35,1,1,""],FilterCandidates:[33,1,1,""],FilterCandidatesWithSC:[33,1,1,""],FraggerHandle:[28,3,1,""],FragmentSampler:[34,3,1,""],FullGapExtender:[29,3,1,""],GapExtender:[29,3,1,""],GenerateDeNovoTrajectories:[28,1,1,""],GetRingPunches:[33,1,1,""],GetRings:[33,1,1,""],HasRingPunches:[33,1,1,""],InsertLoop:[35,1,1,""],InsertLoopClearGaps:[29,1,1,""],IsAllAtomScoringSetUp:[35,1,1,""],IsBackboneScoringSetUp:[35,1,1,""],KIC:[32,3,1,""],KICCloser:[34,3,1,""],LinearScorer:[34,3,1,""],LoopCandidates:[31,3,1,""],MergeGaps:[29,1,1,""],MergeGapsByDistance:[35,1,1,""],MergeMHandle:[35,1,1,""],MinimizeModelEnergy:[35,1,1,""],ModelTermini:[35,1,1,""],ModellingHandle:[35,3,1,""],NTerminalCloser:[34,3,1,""],PhiPsiSampler:[34,3,1,""],ReconstructSidechains:[36,1,1,""],RemoveTerminalGaps:[35,1,1,""],ReorderGaps:[35,1,1,""],ReportMolProbityScores:[33,1,1,""],RigidBlocks:[28,4,1,""],RunMolProbity:[33,1,1,""],RunMolProbityEntity:[33,1,1,""],SampleMonteCarlo:[34,1,1,""],SamplerBase:[34,3,1,""],ScoreContainer:[31,3,1,""],ScorerBase:[34,3,1,""],ScoringGapExtender:[29,3,1,""],ScoringWeights:[31,3,1,""],SetPsipredPredictions:[35,1,1,""],SetSequenceProfiles:[35,1,1,""],SetupDefaultAllAtomScoring:[35,1,1,""],SetupDefaultBackboneScoring:[35,1,1,""],ShiftExtension:[29,3,1,""],SidechainReconstructionData:[36,3,1,""],SidechainReconstructor:[36,3,1,""],SoftSampler:[34,3,1,""],StructuralGap:[29,3,1,""],StructuralGapList:[29,3,1,""]},"promod3.modelling.AllAtomRelaxer":{GetSystemCreator:[32,4,1,""],Run:[32,4,1,""],UpdatePositions:[32,4,1,""]},"promod3.modelling.BackboneRelaxer":{AddCARestraint:[32,4,1,""],AddCBRestraint:[32,4,1,""],AddCRestraint:[32,4,1,""],AddNRestraint:[32,4,1,""],AddORestraint:[32,4,1,""],GetNonBondedCutoff:[32,4,1,""],Run:[32,4,1,""],SetNonBondedCutoff:[32,4,1,""]},"promod3.modelling.CCD":{CCD:[32,4,1,""],Close:[32,4,1,""]},"promod3.modelling.CCDCloser":{Close:[34,4,1,""]},"promod3.modelling.CTerminalCloser":{Close:[34,4,1,""]},"promod3.modelling.CloserBase":{Close:[34,4,1,""]},"promod3.modelling.CoolerBase":{GetTemperature:[34,4,1,""],Reset:[34,4,1,""]},"promod3.modelling.DeNovoCloser":{Close:[34,4,1,""]},"promod3.modelling.DirtyCCDCloser":{Close:[34,4,1,""]},"promod3.modelling.ExponentialCooler":{GetTemperature:[34,4,1,""],Reset:[34,4,1,""]},"promod3.modelling.FraggerHandle":{Get:[28,4,1,""],GetList:[28,4,1,""],LoadCached:[28,4,1,""],SaveCached:[28,4,1,""]},"promod3.modelling.FragmentSampler":{Initialize:[34,4,1,""],ProposeStep:[34,4,1,""]},"promod3.modelling.FullGapExtender":{Extend:[29,4,1,""]},"promod3.modelling.GapExtender":{Extend:[29,4,1,""]},"promod3.modelling.KIC":{Close:[32,4,1,""],KIC:[32,4,1,""]},"promod3.modelling.KICCloser":{Close:[34,4,1,""]},"promod3.modelling.LinearScorer":{GetScore:[34,4,1,""]},"promod3.modelling.LoopCandidates":{Add:[31,4,1,""],AddFragmentInfo:[31,4,1,""],ApplyCCD:[31,4,1,""],ApplyKIC:[31,4,1,""],CalculateAllAtomScores:[31,4,1,""],CalculateBackboneScores:[31,4,1,""],CalculateSequenceProfileScores:[31,4,1,""],CalculateStemRMSDs:[31,4,1,""],CalculateStructureProfileScores:[31,4,1,""],Extract:[31,4,1,""],FillFromDatabase:[31,5,1,""],FillFromMonteCarloSampler:[31,5,1,""],GetClusteredCandidates:[31,4,1,""],GetClusters:[31,4,1,""],GetFragmentInfo:[31,4,1,""],GetLargestCluster:[31,4,1,""],GetSequence:[31,4,1,""],HasFragmentInfos:[31,4,1,""],Remove:[31,4,1,""]},"promod3.modelling.ModellingHandle":{Copy:[35,4,1,""],all_atom_scorer:[35,6,1,""],all_atom_scorer_env:[35,6,1,""],all_atom_sidechain_env:[35,6,1,""],backbone_scorer:[35,6,1,""],backbone_scorer_env:[35,6,1,""],gaps:[35,6,1,""],model:[35,6,1,""],profiles:[35,6,1,""],psipred_predictions:[35,6,1,""],seqres:[35,6,1,""],sidechain_reconstructor:[35,6,1,""]},"promod3.modelling.NTerminalCloser":{Close:[34,4,1,""]},"promod3.modelling.PhiPsiSampler":{Initialize:[34,4,1,""],ProposeStep:[34,4,1,""]},"promod3.modelling.SamplerBase":{Initialize:[34,4,1,""],ProposeStep:[34,4,1,""]},"promod3.modelling.ScoreContainer":{Contains:[31,4,1,""],Copy:[31,4,1,""],Extend:[31,4,1,""],Extract:[31,4,1,""],Get:[31,4,1,""],GetNumCandidates:[31,4,1,""],IsEmpty:[31,4,1,""],LinearCombine:[31,4,1,""],Set:[31,4,1,""]},"promod3.modelling.ScorerBase":{GetScore:[34,4,1,""]},"promod3.modelling.ScoringGapExtender":{Extend:[29,4,1,""]},"promod3.modelling.ScoringWeights":{GetAllAtomScoringKeys:[31,5,1,""],GetAllAtomWeights:[31,5,1,""],GetBackboneScoringKeys:[31,5,1,""],GetBackboneWeights:[31,5,1,""],GetSequenceProfileScoresKey:[31,5,1,""],GetStemRMSDsKey:[31,5,1,""],GetStructureProfileScoresKey:[31,5,1,""],GetWeights:[31,5,1,""],SetAllAtomScoringKeys:[31,5,1,""],SetBackboneScoringKeys:[31,5,1,""],SetSequenceProfileScoresKey:[31,5,1,""],SetStemRMSDsKey:[31,5,1,""],SetStructureProfileScoresKey:[31,5,1,""],SetWeights:[31,5,1,""]},"promod3.modelling.ShiftExtension":{Extend:[29,4,1,""]},"promod3.modelling.SidechainReconstructionData":{disulfid_bridges:[36,6,1,""],env_pos:[36,6,1,""],is_c_ter:[36,6,1,""],is_n_ter:[36,6,1,""],loop_lengths:[36,6,1,""],loop_start_indices:[36,6,1,""],rotamer_res_indices:[36,6,1,""]},"promod3.modelling.SidechainReconstructor":{AttachEnvironment:[36,4,1,""],Reconstruct:[36,4,1,""]},"promod3.modelling.SoftSampler":{Initialize:[34,4,1,""],ProposeStep:[34,4,1,""]},"promod3.modelling.StructuralGap":{Copy:[29,4,1,""],ExtendAtCTerm:[29,4,1,""],ExtendAtNTerm:[29,4,1,""],GetChain:[29,4,1,""],GetChainIndex:[29,4,1,""],GetChainName:[29,4,1,""],GetLength:[29,4,1,""],IsCTerminal:[29,4,1,""],IsNTerminal:[29,4,1,""],IsTerminal:[29,4,1,""],ShiftCTerminal:[29,4,1,""],after:[29,6,1,""],before:[29,6,1,""],full_seq:[29,6,1,""],length:[29,6,1,""],seq:[29,6,1,""]},"promod3.scoring":{AllAtomClashScorer:[39,3,1,""],AllAtomInteractionScorer:[39,3,1,""],AllAtomOverallScorer:[39,3,1,""],AllAtomPackingScorer:[39,3,1,""],AllAtomScorer:[39,3,1,""],BackboneOverallScorer:[41,3,1,""],BackboneScoreEnv:[40,3,1,""],BackboneScorer:[41,3,1,""],CBPackingScorer:[41,3,1,""],CBetaScorer:[41,3,1,""],ClashScorer:[41,3,1,""],ConstraintFunction:[40,3,1,""],ContactFunction:[40,3,1,""],DiscoContainer:[40,3,1,""],HBondScorer:[41,3,1,""],LoadAllAtomInteractionScorer:[39,1,1,""],LoadAllAtomPackingScorer:[39,1,1,""],LoadCBPackingScorer:[41,1,1,""],LoadCBetaScorer:[41,1,1,""],LoadDefaultAllAtomOverallScorer:[39,1,1,""],LoadDefaultBackboneOverallScorer:[41,1,1,""],LoadHBondScorer:[41,1,1,""],LoadReducedScorer:[41,1,1,""],LoadSSAgreementScorer:[41,1,1,""],LoadTorsionScorer:[41,1,1,""],PairwiseFunction:[40,3,1,""],PairwiseFunctionType:[40,3,1,""],PairwiseScorer:[41,3,1,""],ReducedScorer:[41,3,1,""],SCWRL3DisulfidScore:[43,4,1,""],SCWRL3PairwiseScore:[43,4,1,""],SSAgreementScorer:[41,3,1,""],TorsionScorer:[41,3,1,""]},"promod3.scoring.AllAtomClashScorer":{DoExternalScores:[39,4,1,""],DoInternalScores:[39,4,1,""],DoNormalize:[39,4,1,""]},"promod3.scoring.AllAtomInteractionScorer":{DoExternalScores:[39,4,1,""],DoInternalScores:[39,4,1,""],DoNormalize:[39,4,1,""],Load:[39,5,1,""],LoadPortable:[39,5,1,""],Save:[39,4,1,""],SavePortable:[39,4,1,""],SetEnergy:[39,4,1,""]},"promod3.scoring.AllAtomOverallScorer":{"__getitem__":[39,4,1,""],"__setitem__":[39,4,1,""],AttachEnvironment:[39,4,1,""],CalculateLinearCombination:[39,4,1,""],Contains:[39,4,1,""],Get:[39,4,1,""]},"promod3.scoring.AllAtomPackingScorer":{DoNormalize:[39,4,1,""],Load:[39,5,1,""],LoadPortable:[39,5,1,""],Save:[39,4,1,""],SavePortable:[39,4,1,""],SetEnergy:[39,4,1,""]},"promod3.scoring.AllAtomScorer":{AttachEnvironment:[39,4,1,""],CalculateScore:[39,4,1,""],CalculateScoreProfile:[39,4,1,""]},"promod3.scoring.BackboneOverallScorer":{"__getitem__":[41,4,1,""],"__setitem__":[41,4,1,""],AttachEnvironment:[41,4,1,""],Calculate:[41,4,1,""],CalculateLinearCombination:[41,4,1,""],Contains:[41,4,1,""],Get:[41,4,1,""]},"promod3.scoring.BackboneScoreEnv":{AddPairwiseFunction:[40,4,1,""],ApplyPairwiseFunction:[40,4,1,""],ClearEnvironment:[40,4,1,""],Copy:[40,4,1,""],GetSeqres:[40,4,1,""],Pop:[40,4,1,""],SetEnvironment:[40,4,1,""],SetInitialEnvironment:[40,4,1,""],SetPsipredPrediction:[40,4,1,""],Stash:[40,4,1,""]},"promod3.scoring.BackboneScorer":{AttachEnvironment:[41,4,1,""],CalculateScore:[41,4,1,""],CalculateScoreProfile:[41,4,1,""]},"promod3.scoring.CBPackingScorer":{DoNormalize:[41,4,1,""],Load:[41,5,1,""],LoadPortable:[41,5,1,""],Save:[41,4,1,""],SavePortable:[41,4,1,""],SetEnergy:[41,4,1,""]},"promod3.scoring.CBetaScorer":{DoExternalScores:[41,4,1,""],DoInternalScores:[41,4,1,""],DoNormalize:[41,4,1,""],Load:[41,5,1,""],LoadPortable:[41,5,1,""],Save:[41,4,1,""],SavePortable:[41,4,1,""],SetEnergy:[41,4,1,""]},"promod3.scoring.ClashScorer":{DoExternalScores:[41,4,1,""],DoInternalScores:[41,4,1,""],DoNormalize:[41,4,1,""]},"promod3.scoring.DiscoContainer":{AddStructuralInfo:[40,1,1,""],AttachConstraints:[40,1,1,""]},"promod3.scoring.HBondScorer":{DoExternalScores:[41,4,1,""],DoInternalScores:[41,4,1,""],DoNormalize:[41,4,1,""],Load:[41,5,1,""],LoadPortable:[41,5,1,""],Save:[41,4,1,""],SavePortable:[41,4,1,""],SetEnergy:[41,4,1,""]},"promod3.scoring.PairwiseFunction":{Score:[40,4,1,""]},"promod3.scoring.PairwiseScorer":{DoExternalScores:[41,4,1,""],DoInternalScores:[41,4,1,""],DoNormalize:[41,4,1,""]},"promod3.scoring.ReducedScorer":{DoExternalScores:[41,4,1,""],DoInternalScores:[41,4,1,""],DoNormalize:[41,4,1,""],Load:[41,5,1,""],LoadPortable:[41,5,1,""],Save:[41,4,1,""],SavePortable:[41,4,1,""],SetEnergy:[41,4,1,""]},"promod3.scoring.SSAgreementScorer":{DoNormalize:[41,4,1,""],Load:[41,5,1,""],LoadPortable:[41,5,1,""],Save:[41,4,1,""],SavePortable:[41,4,1,""],SetScore:[41,4,1,""]},"promod3.scoring.TorsionScorer":{DoNormalize:[41,4,1,""],Load:[41,5,1,""],LoadPortable:[41,5,1,""],Save:[41,4,1,""],SavePortable:[41,4,1,""],SetEnergy:[41,4,1,""]},"promod3.sidechain":{AAToRotID:[51,4,1,""],BBDepRotamerLib:[52,3,1,""],DihedralConfiguration:[52,3,1,""],DisulfidScore:[44,4,1,""],FRMRotamer:[49,3,1,""],FRMRotamerGroup:[49,3,1,""],Frame:[45,3,1,""],FrameResidue:[45,3,1,""],GetDihedralConfiguration:[52,4,1,""],GetRotamericConfiguration:[52,4,1,""],LoadBBDepLib:[48,4,1,""],LoadLib:[48,4,1,""],Particle:[49,3,1,""],RRMRotamer:[49,3,1,""],RRMRotamerGroup:[49,3,1,""],ReadDunbrackFile:[48,4,1,""],ResolveCysteins:[44,4,1,""],RotamerGraph:[46,3,1,""],RotamerID:[51,3,1,""],RotamerLib:[52,3,1,""],RotamerLibEntry:[52,3,1,""],SCWRLRotamerConstructor:[50,3,1,""],SidechainParticle:[49,3,1,""],SubrotamerOptimizer:[53,4,1,""],TLCToRotID:[51,4,1,""]},"promod3.sidechain.BBDepRotamerLib":{AddRotamer:[52,4,1,""],Load:[52,5,1,""],LoadPortable:[52,5,1,""],MakeStatic:[52,4,1,""],QueryLib:[52,4,1,""],Save:[52,4,1,""],SavePortable:[52,4,1,""],SetInterpolate:[52,4,1,""]},"promod3.sidechain.FRMRotamer":{"__getitem__":[49,4,1,""],"__len__":[49,4,1,""],AddFrameEnergy:[49,4,1,""],AddSubrotamerDefinition:[49,4,1,""],ApplyOnResidue:[49,4,1,""],GetActiveSubrotamer:[49,4,1,""],GetFrameEnergy:[49,4,1,""],GetInternalEnergy:[49,4,1,""],GetInternalEnergyPrefactor:[49,4,1,""],GetNumSubrotamers:[49,4,1,""],GetProbability:[49,4,1,""],GetSelfEnergy:[49,4,1,""],GetSubrotamerDefinition:[49,4,1,""],GetTemperature:[49,4,1,""],SetActiveSubrotamer:[49,4,1,""],SetFrameEnergy:[49,4,1,""],SetInternalEnergy:[49,4,1,""],SetInternalEnergyPrefactor:[49,4,1,""],SetProbability:[49,4,1,""],SetTemperature:[49,4,1,""],ToFrameResidue:[49,4,1,""],ToRRMRotamer:[49,4,1,""]},"promod3.sidechain.FRMRotamerGroup":{"__getitem__":[49,4,1,""],"__len__":[49,4,1,""],AddFrameEnergy:[49,4,1,""],ApplyOnResidue:[49,4,1,""],ApplySelfEnergyThresh:[49,4,1,""],Merge:[49,4,1,""],SetFrameEnergy:[49,4,1,""]},"promod3.sidechain.FrameResidue":{"__getitem__":[45,4,1,""],"__len__":[45,4,1,""]},"promod3.sidechain.Particle":{AddLonePair:[49,4,1,""],GetCharge:[49,4,1,""],GetName:[49,4,1,""],GetParticleType:[49,4,1,""],GetPos:[49,4,1,""],IsHBondAcceptor:[49,4,1,""],IsHBondDonor:[49,4,1,""],PairwiseEnergy:[49,4,1,""],SetPolarDirection:[49,4,1,""]},"promod3.sidechain.RRMRotamer":{"__getitem__":[49,4,1,""],"__len__":[49,4,1,""],AddFrameEnergy:[49,4,1,""],ApplyOnResidue:[49,4,1,""],GetFrameEnergy:[49,4,1,""],GetInternalEnergy:[49,4,1,""],GetInternalEnergyPrefactor:[49,4,1,""],GetProbability:[49,4,1,""],GetSelfEnergy:[49,4,1,""],SetFrameEnergy:[49,4,1,""],SetInternalEnergy:[49,4,1,""],SetInternalEnergyPrefactor:[49,4,1,""],SetProbability:[49,4,1,""],ToFrameResidue:[49,4,1,""]},"promod3.sidechain.RRMRotamerGroup":{"__getitem__":[49,4,1,""],"__len__":[49,4,1,""],AddFrameEnergy:[49,4,1,""],ApplyOnResidue:[49,4,1,""],ApplySelfEnergyThresh:[49,4,1,""],Merge:[49,4,1,""],SetFrameEnergy:[49,4,1,""]},"promod3.sidechain.RotamerGraph":{CreateFromFRMList:[46,5,1,""],CreateFromRRMList:[46,5,1,""]},"promod3.sidechain.RotamerLib":{AddRotamer:[52,4,1,""],Load:[52,5,1,""],LoadPortable:[52,5,1,""],MakeStatic:[52,4,1,""],QueryLib:[52,4,1,""],Save:[52,4,1,""],SavePortable:[52,4,1,""]},"promod3.sidechain.RotamerLibEntry":{FromResidue:[52,5,1,""],IsSimilar:[52,4,1,""],SimilarDihedral:[52,4,1,""],chi1:[52,6,1,""],chi2:[52,6,1,""],chi3:[52,6,1,""],chi4:[52,6,1,""],probability:[52,6,1,""],sig1:[52,6,1,""],sig2:[52,6,1,""],sig3:[52,6,1,""],sig4:[52,6,1,""]},"promod3.sidechain.SCWRLRotamerConstructor":{AssignInternalEnergies:[50,4,1,""],ConstructBackboneFrameResidue:[50,4,1,""],ConstructFrameResidue:[50,4,1,""],ConstructFrameResidueHeuristic:[50,4,1,""],ConstructRRMRotamerGroup:[50,4,1,""],ConstructSidechainFrameResidue:[50,4,1,""]},"test_actions.ActionTestCase":{RunAction:[1,4,1,""],RunExitStatusTest:[1,4,1,""],pm_action:[1,6,1,""],pm_bin:[1,6,1,""],testPMExists:[1,4,1,""]},promod3:{SetCompoundsChemlib:[15,1,1,""],core:[12,2,0,"-"],loop:[23,2,0,"-"],modelling:[30,2,0,"-"],scoring:[42,2,0,"-"],sidechain:[47,2,0,"-"]},test_actions:{ActionTestCase:[1,3,1,""]}},objnames:{"0":["cmake","command","CMake command"],"1":["py","function","Python function"],"2":["py","module","Python module"],"3":["py","class","Python class"],"4":["py","method","Python method"],"5":["py","staticmethod","Python static method"],"6":["py","attribute","Python attribute"],"7":["std","option","option"]},objtypes:{"0":"cmake:command","1":"py:function","2":"py:module","3":"py:class","4":"py:method","5":"py:staticmethod","6":"py:attribute","7":"std:option"},terms:{"10a":36,"1aki":26,"1crn":[21,23,25,26,30,31,32,34,35,36,42,47],"1crn_cut":[30,31,35],"1crna":[26,31],"1ey":8,"1eye_rec":8,"20a":36,"2b1":2,"2jlp":0,"30a":36,"3x3":9,"655a":26,"__doc__":[11,13],"__getitem__":[26,39,41,45,49],"__init__":[1,8,13,16],"__len__":[22,26,45,49],"__main__":[1,8],"__name__":[1,8],"__setitem__":[26,39,41],"_data":37,"_name":4,"_run":[1,4],"_xml":4,"abstract":34,"boolean":11,"break":[4,8,16],"byte":[10,37],"case":[0,1,5,8,13,16,22,26,27,29,32,34,35,36,37,41,44,47,49,50,52],"catch":26,"char":[22,37],"class":[1,5,8,9,10,12,13,14,17,20],"const":37,"default":[0,1,2,4,5,8,10,13,14,15,18,21,22,25,26,27,28,30,31,32,34],"enum":[26,51],"export":[8,21],"final":[8,18,26,28,30,31,35,40,42,44,46,47,49],"float":[9,10,21,22,25,26,27,28,29,31,32,33,34,35,36,37,39,40,41,43,44,49,50,52,53],"function":[1,3],"import":[0,1,5,8,11,13,16,18,20,21,22,23,25,26,27,30,31,32,34,35,36,42,47,49,50],"int":[1,9,10,11,14,21,22,24,25,26,27,28,29,31,32,33,34,35,36,37,39,40,41,45,49,50,52,53],"long":35,"new":[1,3,7,8,13,16,17,21,22,25,26,29,31,32,34,35,36,37,47,49],"null":26,"public":[8,37],"return":[1,8,9,10,11,13,14,15,21,22,24,25,26,27,28,29,31,32,33,34,35,36,37,39,40,41,43,44,45,48,49,50,51,52],"s\u00f6ding":38,"short":[8,16,37],"static":[8,14,21,25,26,27,31,36,37,39,41,46,48,52],"super":47,"switch":[8,16,40],"throw":[1,37,47,48],"true":[1,11,13,14,21,22,23,25,26,29,31,32,33,34,35,36,37,39,41,44,47,50],"try":[1,8,18,29,35,37,52],"void":37,"while":[1,4,8,14,20,21,25,35,37],a3m:[0,13],a3mtoprofil:[0,13],aa1:41,aa2:41,aa_aft:26,aa_befor:26,aa_clash:[35,39],aa_interact:[35,39],aa_pack:[35,39],aa_packing_scor:37,aa_relax_test:32,aa_res_idx:50,aa_scor:37,aa_with_rotam:47,aaa1:39,aaa2:39,aaa:[21,39],aaaaaaaa:22,aaaaggggggggggggggggggggaaaaaa:35,aafrequ:26,aafrequenciesstruct:26,aah:21,aatorotid:51,abcdefghijklmnopqrstuvwxyz0123456789abcdefghijklmnopqrstuvwxyz:35,abil:16,abl:[2,8],abort:[8,10,32,35],about:[1,4,8,10,26,35],abov:[0,1,5,8,13,16,20,22,29,31,35,37,51,52],absolut:[4,5,34],academ:8,accept:[10,13,20,31,32,34,35,36,37],acceptor:[41,50],access:[4,5,8,21,22,26,27,31,35,39,40,41,49,51],accessor:26,accord:[5,10,16,21,22,25,26,27,28,29,31,34,35,36,39,44,47,49,50,52],accordingli:[26,40],accur:28,accuraci:28,achiev:[10,16],acknowledg:8,across:[1,52],act:[20,32],acta:38,action_nam:16,action_unit_test:1,actiontest:1,activ:[13,14,16,44,49,53],active_internal_energi:53,actual:[3,8,13,16,22,26,34,35,36,40,41,42,49,50,52],actual_posit:34,actual_step:34,adapt:[8,25,26,32,34,35,38],add:[1,2,4,6,8,10,13,18,20,21,26,27,31,32,35,36,39,40,41,44,47,49,50],add_argu:11,add_custom_target:8,add_doc_depend:4,add_doc_sourc:[4,8],add_subdirectori:8,addalign:13,addcarestraint:32,addcbrestraint:32,addcoordin:26,addcrestraint:32,addedg:10,addendum:20,addfrag:26,addfragmentinfo:31,addframeenergi:49,addharmonicangl:25,addharmonicbond:25,addharmonicimprop:25,addit:[4,11,13,14,16,20,22,23,25,26,33,35,37,50],addition:[1,4,16,21,25,26,50],addljpair:25,addlonepair:49,addnod:10,addnrestraint:32,addorestraint:32,addpairwisefunct:40,addperiodicdihedr:25,addperiodicimprop:25,addprofil:13,address:37,addrotam:52,addseqidparamet:26,addseqsimparamet:[23,26],addsequenceprofileparamet:26,addssagreeparamet:26,addstructur:13,addstructuralinfo:40,addstructureprofileparamet:26,addsubrotamerdefinit:49,addtorsionprobabilityparamet:26,addureybradleyangl:25,admir:8,advanc:28,advantag:25,advic:[8,16],advis:20,affect:[8,22,50,51],after:[1,2,4,5,8,10,13,16,21,22,25,26,27,29,31,32,34,35,37,40,52],after_c_stem:22,afterward:[8,26,35],again:[2,3,8,26,28],against:[20,39],agg:27,agglom:31,ago:1,agre:20,agreement:[20,26,28,41],agress:[2,10],aim:19,ala:[22,27,32,47,50,51,52],ala_cb:21,ala_h1:21,ala_h:21,alanin:[3,51],alg:[23,26,35],algorithm:[3,10,19,22,23,26],alia:29,align:[0,13,18,26,28,30,35,38,40],alignedcuboid:22,alignmenthandl:[28,35,40],alignmentlist:[0,13,35],all:[0,1,2,3,4,8,10,13,14,16,18,19,20],all_atom:[21,22,25,49,50],all_atom_env:21,all_atom_po:[21,50],all_atom_scor:35,all_atom_scorer_env:35,all_atom_sidechain_env:35,all_po:[21,25,32],all_scor:31,allatom:[32,35,36],allatomclashscor:35,allatominteractionscor:[35,37],allatomoverallscor:[31,35],allatompackingscor:[35,37],allatomrelax:[25,32],alleg:20,alloc:26,allow:[0,2,3,5,8,11,16,22,26,27,28,31,34,35,37,39,41,46,52],allow_multitempl:13,allow_prepro_ci:22,almost:[4,32],aln:[0,28,30,31,35,40],aln_sourc:13,alon:[11,20],along:[1,8,20],alongsid:20,alot:8,alpha:[9,22,41,47],alpha_bin:41,alreadi:[1,4,8,10,16,22,25,26,28,31,35,36,39,40,41,49,50,52,53],also:[1,2,4,8,11,16,20,26,27,28,31,32,33,34,35,36,44,45,46,50,52],alter:[31,34],altern:[4,5,8,31,34,35,48,50],alwai:[0,1,7,8,16,29,34,35,37],amber:[21,35],ambig:52,ambigu:[0,13,52],aminoacid:[21,22,25,27,41,51,52],aminoacidatom:[21,39],aminoacidhydrogen:21,aminoacidlookup:[21,25],among:31,amount:[18,28,52],analysi:[32,33,38],analyt:[31,52],anchor:[9,21],ancient:15,angl:[9,21,22,23,25,26],angle_bin:41,angle_bin_s:26,angle_force_const:25,angle_four:9,angle_on:9,angle_thre:9,angle_two:9,angstrom:[26,32],ani:[0,1,4,5,8,10,13,14,15,18,20,21,22,25,26,27,29,31,33,34,35,36,37,39,40,41,45,47,49,50],anneal:[10,31,34],annot:20,announc:[1,8],anoth:[4,14,22,29,32,35,36,44],anymor:[3,10],anyon:[8,16],anyth:[0,2,5,8,13,14,15,31,32,36,39,41],anywai:8,anywher:16,apach:[3,20],apart:[1,31,35,36,39,41],app:7,appear:20,append:[0,13,22,26,27,35,47],appendix:20,appli:[3,7,10,11,15,16,20,22,26,29,31,32,34,35,36,38,40,44,47,49,52],applic:[1,20,32,50],applyccd:31,applyde:10,applyedgedecomposit:10,applyk:31,applyonresidu:[47,49],applypairwisefunct:[40,41],applysd:25,applyselfenergythresh:[47,49],applytransform:22,approach:[0,2,10,26,28,35,37,44,47,50],appropri:[10,20,27,35,37,50],approx:35,approxim:[25,49],arbitrari:[3,21,26,44],arbitrarili:34,archiv:20,arendal:38,arg:[1,4,13,51],arg_ca:21,arg_hd3:21,arg_sorted_scor:31,arginin:51,argpars:13,argument:[0,1,2,4,11,12],argumentpars:13,argv:13,aris:20,around:[1,4,8,9,16,22,31,32,35,39,40,41,52],arrai:[0,8,37],artifici:26,ascend:29,ask:8,asn:[51,52],asn_c:21,asn_hb2:21,asp:[21,49,51,52],asp_ha:21,asp_o:21,asparagin:51,aspart:[51,52],ass:34,assembl:13,assemblepars:13,assert:20,assertequ:8,assess:[39,40],assign:[3,10,22,26,31,34,39,41,50,53],assigninternalenergi:50,assignsecstruct:35,associ:[20,26,29,45],assum:[1,4,5,7,8,20,25,26,32,35,37,40,41,44],assur:44,astar:3,astarsolv:10,atom:[3,8,9],atom_idx:[21,25],atom_nam:[21,25],atomhandl:49,attach:[0,4,8,13,20,21,25,28,29,31,35,36,39,40,41,42],attach_view:13,attachconstraint:40,attachenviron:[31,32,34,36,39,41,42],attachview:[30,31,35],attent:[1,16],attribut:[8,13,20,26,35,36,52],author:20,authorship:20,autom:[2,4],automat:[1,8,10,11,14,16,26,30,31,37,52],automatis:8,avaibl:50,avail:[1,2,3,5,7,8,15,16,18,20,25,26,31,34,40,47],availab:20,availabl:8,averag:[31,40,44],avg:26,avg_sampling_per_posit:28,avoid:[0,3,6,11,13,15,26,32,34],awai:[16,36,49],awar:[8,50],awesom:[1,8],axi:[9,22],back:[1,16,25,34],backbon:[0,3,9,18,21,22,26,27,28,29,30,31],backbone_scor:35,backbone_scorer_env:35,backbonelist:[18,21],backboneoverallscor:[28,31,34,35],backbonerelax:[32,35],backbonescor:8,backbonescoreenv:[8,28,31,34,35],backbonescoreenvlisten:8,background:[2,36],backrub:[22,38],backward:37,bad:25,base:[0,3,4,5,9,11,13,19,20,22,23],base_target:4,bashrc:8,basi:[4,8,16,20,32,34,48,49],basic:[1,2,8,11,16,27,34,35,47,49,52],bb_dep_lib:37,bb_list:[18,21,22,23,26,29,31,32,34,35,40],bb_list_on:28,bb_list_two:28,bb_score:31,bbdeprotamerlib:[35,36,37,48,50,52],becaus:[8,16,21,35,40],becom:[10,52],been:[2,3,10,16,20,24,26,31,32,35,39,41,44,52],befor:[0,1,4,7,8,13,16,22,25,26,27,29,31,32,34,35,36,37],begin:[1,8,21,22,34,40],behalf:20,behav:[1,52],behaviour:[0,13,39,40,52],behind:8,bell:8,belong:[3,4,16,21,22,26,29,31,34,35,36,39,40,41,45,49,50],belov:26,below:[0,8,20,21,25,26,28,31,32,36,37,39,41,44],below_thre:26,benefici:20,besid:[2,4,10,13,26],best:[4,7,31,35,44],best_candid:31,beta:[9,22,33,41],beta_bin:41,better:[25,31,34,35,39,41],between:[1,3,10,13,22,25,26,28,29,31,32,34,35,36,37,39,40,41,42,43,44,45,49,50,52],beyond:13,biasini2013:[19,38],biasini:38,bienert:38,big:[25,37],bilinearli:52,bin:[1,8,16,18,26,27,39,41,52],bin_siz:52,binari:[1,4,8,16,17,25,26,27],bind:[0,13,20],bins_per_dimens:27,bioinformat:38,biol:38,biologi:[19,38],biophi:38,biopolym:38,bit:[1,2,8,16,31,35],bitwis:26,blank:8,block:3,blosum62:[23,26,28,40],boilerpl:20,bond:[0,3,9,22,25,26,32,33,36,38,41],bond_force_const:25,bond_length:[9,25],bool:[1,8,10,11,13,14,21,22,25,26,29,31,32,33,34,35,36,37,39,41,44,49,50,52],boost:[0,1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43,44,45,46,47,48,49,50,51,52,53,54],boost_librari:4,boost_root:2,bootstrap:[6,7],bore:34,both:[3,21,26,29,35,44,47,52],bound:[21,25,28,31,49],bracket:20,bradlei:25,branch:[4,8],branchnam:16,brew:4,bridg:[24,25,32,35,36],briefli:16,bring:8,broken:1,broyden:35,bsd:20,bug:[3,8,16],build_disulfid:36,builder:2,buildfromrawmodel:[30,35],buildrawmodel:[0,30,31,35],buildsidechain:35,buildup:[47,49],built:[4,7,25,26,40,45,50],bunch:[1,13,16],bundl:20,bytecod:1,c_coord:9,c_num:29,c_po:[9,22,41],c_stem:[9,23,26,29,31,32,34],c_stem_psi:34,c_str:37,c_ter:[32,50],ca_coord:9,ca_pairwise_funct:40,ca_po:[9,22],ca_pos_on:[43,44],ca_pos_two:[43,44],ca_posit:44,ca_rmsd:[23,26],cach:[2,26,28],calcul:[8,22,26,27,28,31,32,34,39,40,41,42,44,45,46,47,49,50],calculateallatomscor:31,calculatebackbonescor:31,calculatelinearcombin:[31,34,39,41],calculatescor:[39,41,42],calculatescoreprofil:[39,41],calculatesequenceprofilescor:31,calculatestemrmsd:31,calculatestructureprofilescor:31,call:[1,2,4,8,11,13,14,15,16,21,25,26,27,29,31,34,35,36,37,39,40,41,49,50,52],callabl:[13,16],calpha:35,calul:27,came:8,can:[0,1,2,3,4,5,7,8,9,10,11,13,14,15,16,18,19,21,22,23,25,26,27,28,29,30,31,32,34,35,36,37,39,40,41,42,44,45,46,47,48,49,50],cand:35,candid:[3,30],cannot:[0,8,13,20,25,26,27,29,35,37,39,41,48,51,52],canutescu2003:[32,38],canutescu2003b:[38,39,41,43,44],canutescu:38,cap:10,capabl:[24,30,34],captur:1,carbon:[9,22,43,49,50],carbonyl:[49,50],care:[0,8,10,31,32,35,37,41],carlo:[3,10,28,31,34,35,46],carmsd:[22,23,26],carri:[8,11,20],cast:37,categori:4,caus:[16,20,33],caution:21,caviti:26,cb_in_sidechain:50,cb_pack:[28,35,41],cb_packing_scor:37,cb_pairwise_funct:40,cb_po:22,cb_pos_on:[43,44],cb_pos_two:[43,44],cb_posit:44,cbeta:[28,31,34,35,41,42],cbeta_scor:[37,42],cbetaenvlisten:8,cbetascor:[8,35,37],cbpackingscor:[8,35,37],ccd:[3,30,31],ccdcloser:34,center:33,central:[22,27,41],centroid:31,certain:[1,2,4,8,10,16,26,27,28,29,35,37,39,40,41],certainli:1,ch1particl:49,ch2particl:49,ch3particl:49,ch_name:26,chain:[0,8,13,21,22,23,24],chain_idx:[8,21,31,34,35,36,39,40,41],chain_idx_list:36,chain_idx_on:40,chain_idx_two:40,chain_index:[26,34,39],chain_indic:40,chain_nam:[26,35],chainhandl:[21,22,29],chainid:0,chakravarti:38,chakravarty1999:[26,38],chanact:35,chanc:[8,10,35],chang:[1,3,4,5,8,10,16,20,21,27,28,29,32,34,35,36,39],change_frequ:[10,34],chapter:[29,33],charact:[13,20],charg:[8,20,21,25,32,49,50],charmm:[21,25,35],check:[0,1,2,3,5,8,11,13,14,16,22,25,26,30,32],check_io:37,check_xml:8,checkbasetyp:37,checkfinalmodel:35,checkmagicnumb:37,checkout:[8,16],checktypes:37,chemdict_tool:[5,7],chemic:[5,15,21,39],chemistri:38,chemlib:[5,7],chi1:52,chi2:52,chi3:52,chi4:52,chi:52,child:13,childclass:1,chmod:8,choos:[20,31,34],chose:5,chosen:[0,13,34,35],cif:[0,5,7,13],ciiipgatcpgdyan:35,circumv:50,claim:20,clash:[3,28,31,32,34,35,39,41,42,44,47],clash_scor:42,clash_thresh:35,clashscor:[31,33,34,35],classic:48,claus:20,clean:[2,8,16],cleanli:37,clear:[14,21,22,31,35,40],clearenviron:[21,40],cleargap:29,clearpo:21,clearresidu:21,clip:13,clone:8,close:[16,18,22,26,31,32,34,35,36,44],closed_posit:34,closegap:35,closelargedelet:35,closer:[3,26,30,31],closerbas:34,closesmalldelet:[32,35],closur:[32,35,38],clustal:[0,13],cluster:[3,31,37,40],cluster_thresh:[28,40],clutter:[1,8,26],cmake:0,cmake_support:[4,8,16,20],cmakecach:2,cmakelist:[1,2,4,8,16],coars:8,code:[0,1,2,3,4,5,6,7,8,11,13,14,15,16,17,20,21,22,26,27,33,35],codetest:[4,8],coil:[24,28],collect:[11,14,21,28,40],column:[26,28],combin:[20,25,26,27,28,31,34,35,38,39,41,44,52],come:[1,4,8,11,13,35,36,42,46,52],command:[0,1,7,8,11,12],commandlin:13,comment:[16,20],commerci:[8,20],commit:[8,16],common:[8,13,20,28],commonli:[8,18,30,31,41],commun:20,comp_lib:50,compar:[3,8,22,23,26,31,32,52],comparison:[35,38,52],compat:[16,25,37],compensatori:22,compil:[1,2,4,8,14,16,18,20,37,54],complain:1,complaint:16,complet:[14,16,22,25,32,34,35,36,52],complex:[8,16,36,44,49,53],compli:20,complianc:20,complib_dir_contain:[5,7],complib_dir_localhost:[5,7],compon:[5,7,10,15,26,33,41],compoundlib:[5,50],compress:[11,26],comput:[3,8,19,20,31,33,38,39,41],concaten:21,concept:8,concern:8,condit:[8,20,27],conf:[2,8],confid:[26,41],config:[4,8],config_head:4,configur:[2,8,10,16,20,31,47],conflict:16,conform:[26,32,34,38,46,52],connect:[4,5,10,16,21,25,26,31],connectivi:5,conop:[5,21,22,25,27,41,50,51],conquer:8,consecut:[26,27,41],consequenti:20,conserv:[18,29],consid:[0,4,8,10,13,14,16,21,22,26,27,28,31,32,34,35,36,39,40,41,44,47,50,52],consider_all_nod:10,consider_hydrogen:49,consider_ligand:36,consist:[3,8,20,21,25,28,29,31,32,34,35,36,37,40,44,49,52],conspicu:20,constant:[3,25,32,39,41,53],constitut:20,constraint:[13,26,32,34,40],constraintfunct:40,constru:20,construct:[0,9,21,22,26,28,29,34,37],constructatompo:9,constructbackboneframeresidu:[47,50],constructcbetapo:9,constructcterminaloxygen:9,constructetd:10,constructframeresidu:50,constructframeresidueheurist:50,constructfrmrotamergroup:[47,50],constructor:[21,25,29,32,34,37,40,41,47,49],constructrrmrotamergroup:50,constructsidechainframeresidu:50,contact:40,contactfunct:40,contain:[0,1,2,3,4,5],content:[8,12,17,20,23,26,42,47,54],contigu:[25,36,37],continu:[1,21,29,32,47],contract:20,contrast:45,contribut:4,contributor:20,contributori:20,control:[0,3,8,10,20,31,34,36,40,49,50,52,53],conveni:[1,7,8,18,28,31,34,35],convent:[1,51],converg:[28,31,32,34],convers:[20,37],convert:[4,5,22,25,26,27,35,37,39,41,52,53],convert_module_data:4,convertbasetyp:37,cooler:[3,30,31],coolerbas:34,cooling_factor:[10,34],coord:[26,31],coord_idx:26,coord_info:26,coordin:[3,9,26,31,32,34,35,38,39,47],coordinfo:26,cope:16,copi:[2,3,4,8,16,18,20,21,22,29,31,34,35,40],copyright:20,copyright_cmak:20,core:[0,8,9,10,11],correct:[5,25],correctli:35,correspond:[0,10,16,21,22,25,26,27,31,37,52],corrupt:[21,40],cotain:26,could:[1,4,5,8,13,16,25,26,35],count:[14,29,34,35,39,41],countenclosedgap:29,countenclosedinsert:29,counter:34,counterclaim:20,counterpart:[31,41,50],coupl:[1,8,16,35],cours:8,coutsia:38,coutsias2005:[32,38],cover:[1,8,12,13,14,21,25,26,28,30,34],coverag:35,cparticl:49,cpp:4,cpr:[51,52],cpu:[18,25,35],cpu_platform_support:25,crambin:[26,31,34],crash:47,createalign:[31,35],createentityfromview:[36,47],createfromfrmlist:[46,47],createfromrrmlist:46,createfullview:[30,31,35],createsequ:[26,31,35],creation:[25,32],creator:[25,32],criteria:36,criterion:[10,34],criterium:31,croak:16,cross:20,crucial:8,cryst:38,cterminalclos:34,cumul:50,current:[2,4,5,8,10,14,16,21,22,25,26,31,34,35,37,40,41,42,49,50,53],custom:[8,26,34,35,36,37,48,51],customari:20,cutoff:[24,25,31,32,36,39,41],cycl:29,cyclic:[31,32,38],cyd:[51,52],cyh:[51,52],cys_hb3:21,cys_sg:21,cystein:[25,36,44,47,51],d_bin:41,dai:11,damag:20,dampen:25,danc:38,dare:4,dat:[26,37],data1:4,data2:4,data:[0,1,3,4,8,16,17,21,23,24,25],data_:37,data_gener:[3,37,48],data_to_stor:26,data_typ:26,databas:[0,9,23,24],databs:26,datatyp:26,date:[5,7,16,20],davi:38,davis2006:[22,38],dbg:8,dcmake_install_prefix:2,deactiv:10,dead:[10,38],deal:[35,36],debug:[8,10,21],decent:15,decid:[3,8,32],decis:27,declar:[4,8,16],decod:13,decompos:[3,10],decomposit:[10,28,46],decreas:34,dedic:[4,8,16],dee:10,deep:[22,35],def:[1,8,21,35],def_angl:21,defend:20,defin:[1,4,8,9,13,14,15,20,21,22,23,24,25],definem:8,degre:[22,26,27],delet:[0,2,8,22,35,49],deliber:20,deliv:[1,26,34,35],delta_scor:34,demand:35,demonstr:26,denovoclos:34,densiti:[22,32,38],dep1:4,dep2:4,dep:4,depend:0,dependency1:4,dependency2:4,depends_on:4,depth:[26,38],deriv:[1,20,26,38,43,44],descend:35,descent:[31,32,38],describ:[4,7,10,11,17,20,21,22,26,29,30,32,33,37,39,41,44,47,48,49,52,54],descript:[0,5,13,16,20,34,52],descriptor:26,descsrib:10,design:[1,3,19,20],desir:[9,18,25,31,32,34,35,39,40,41],despit:3,detail:[0,9,13,16,20,25,26,27,31,33,34,35,39,41,48,52],detect:[0,11,28,30],determin:[8,11,20,25,26,31,34,40,41],determinist:28,deuterium:35,develop:[1,3,8,16],deviat:[22,33,34,52],devot:12,dict:[4,28,31,33,34,39,41],dictionari:[4,5,13,15,33,38],did:[8,26,31,35],didn:7,didnt:5,differ:[1,2,4,7,8,10,15,16,20,21,26,28,29,31,35,39,41,47,51,52],dihedr:[9,18,22,23,25,26],dihedral_angl:22,dihedral_bin:41,dihedral_idx:52,dihedral_pair:27,dihedralconfigur:52,dill:38,dimens:27,dir:[4,8],direct:[8,20,22,24,26,41,49,50],directli:[8,10,26,31,35,36,40,44,49,51,52],directori:[1,2,4,5,7,8],dirti:1,dirtyccdclos:34,disabl:[1,16],disable_doctest:2,disable_document:2,disable_linkcheck:2,discard:26,disclaim:20,discocontain:40,disconnect:3,discret:[39,41],discuss:[20,26],disk:[8,25,28,39,41,52],displai:[11,13,14,20],dissimilar:28,dist:41,dist_bin:41,dist_bin_s:26,distanc:[9,22,26,28,31,35,36,39,40,41,43],distance_thresh:28,distant:40,distinct:[21,36,52],distinguish:3,distribut:[1,8,20,25,26,27,34,37,39,41,48,52],disulfid:[0,25,32,36,43],disulfid_bridg:[25,36],disulfid_score_thresh:36,disulfidscor:[36,44],dive:[16,35],diverg:8,divers:[26,28],dng:18,do_it:[39,41],doc:[2,4,8,16,20],docker:3,dockerfil:[5,7],dockerhub:7,docstr:13,doctest:[2,8,16],document:[1,2],doe:[1,3,4,8,9,10,11,13,15,16,20,22,26,30,31,34,35,37,40,48],doesn:[8,16,29,32,34,52],doesnt:52,doexternalscor:[39,41],dointernalscor:[39,41],domain:28,domin:10,don:[2,10,20,31,35,50],done:[1,8,11,13,16,23,25,27,31,34,35,37],donor:41,donorm:[39,41],dont:[0,34],dont_write_bytecod:1,dost_root:2,doubt:13,down:[13,22,26,34],download:5,dpm3_runtime_profiling_level:14,draw:[22,27,34],drawback:8,drawn:[27,34],drawphigivenpsi:27,drawpsigivenphi:27,drop:8,dssp:[3,26,41],dssp_state:41,due:[26,31,32,35,44],dump:52,dunbrack:[3,38,48],duplic:6,dure:[1,21,32,35,37,45,52],dynam:52,dynamicspatialorgan:3,e_cut:10,e_thresh:[10,35],e_tresh:10,each:[0,8,10,13,14,20,21,22,25,26,27,28,29,31,32,33,34,35,36,37,39,41],earli:3,earlier:2,easi:8,easier:[1,8,20],easili:[4,16,35],echo:8,edg:10,edge_idx:10,editor:1,editori:20,educ:8,effect:[4,8,10,25,36,44],effici:[21,28,34,38,42],egg:26,eigen3_include_dir:2,eigen:[2,3],either:[0,8,13,16,20,21,22,27,29,31,32,34,35,36,37,39,40,41,45,49,51,52],elabor:[8,20],electron:20,electrostat:[25,32],element:[1,10,21,22,26,28,31,33,37,40,44],elimin:[10,38],els:[8,16,36,37],emerg:1,empir:[43,44],emploi:16,empti:[8,11,13,22,26,28,31,35,49],enabl:[1,2,11,13,15,25,26],enable_mm:2,enable_ss:2,enclos:[20,29,35],encod:0,encount:[29,34],end:[0,1,2,4,8,10,11,13,16,20,21,22,26,28,29,31,35,38],end_resnum:35,end_transl:4,endian:37,energi:[3,8,10,18,25,32,34,35,39,41,44,45,46,47,49,50,53],enforc:[21,31,34,35,36,39,40,41],engin:19,enough:[8,16,25,26,35,37],ensur:[2,8,18,31,35,37],ent:[0,13,21,25,26,33,36,42],ent_seq:42,enter:45,entiti:[8,13,14,20,21,22,26,33,35,42,47],entityhandl:[13,21,22,33,35,36,40],entityview:[26,27,28,33,35],entri:[0,3,8,14,25,26,31,32,33,36,41,47,50],enumer:[8,10,21,25,26,31,40,47,49,50,51,52],env:[8,18,21,25,28,32,33,35,36,39,40,41,42],env_po:[32,36],env_structur:[21,40],environ:[1,3,8,21,28,29,31,32,34,35,36,37,39],epsilon:[10,25,36,53],equal:[34,39,41,44,50],equidist:52,equival:[35,39,41],error:[0,11,13,14,26,32,35,37],especi:28,estim:[10,33,34,38,41,44,52],etc:[1,3,8,16,22,26,31,40],evalu:[4,8,32,35,39,40,41],evaluategromacsposrul:9,even:[2,8,10,20,22,25,29,35],event:[20,28],eventu:13,ever:[16,34],everi:[0,1,8,10,13,21,22,26,27,28,31,32,34,35,36,39,40,41,44,46,49,50,52,53],everyth:[1,2,3,7,8],evolut:38,evolv:42,exact:[0,7,10,13,37],exactli:[2,10,26,28,31,35,40,44,50,51],exampl:[0,1,2,8,11,13,16,17,18,20,21,23,25,26,27,28,30],example_reconstruct:47,exce:[39,41],exceed:[26,29],except:[0,3,13,20,26,29,34,35,50],exclud:[8,20,26],exclus:[1,8,20,25],exec:7,execut:0,exercis:20,exisit:17,exist:[0,1,2,4,8,10,11,13,14,16,21,22,26,31,32,33,34,35,37,39,40,41,48,49,51,52],exit:[0,1,11,13],exit_cod:1,exit_statu:11,exot:8,exp:34,expect:[1,7,21,25,26,35,36,40,44,53],expens:26,experiment:35,explain:[1,8],explan:8,explicit:2,explicitli:20,explor:38,exponenti:34,exponentialcool:34,expos:26,express:[20,44],ext:11,extend:[1,4,8,16,17,24,26,28],extendatcterm:29,extendatnterm:29,extended_search:[31,35],extens:[0,3,11,13,29,35],extension_penalti:29,extent:26,extern:[3,4,5,7,8,34],extra:[2,3,8,16,22,37,48],extra_bin:26,extra_force_field:35,extract:[8,9,21,22,23,25,26,27,28,30,31,32,34,35,36,39,40,41,44,50],extractbackbon:21,extractloopposit:25,extractstatist:27,extrem:22,f_i:26,f_idx:40,facilit:28,factor:[10,25,34,49],fail:[0,1,8,11,14,22,31,32,35],failur:[0,8,11,13,20,52],fall:32,fallback:52,fals:[1,8,10,11,13,22,25,26,29,31,34,35,36,44,47,49,50],far:[31,35],fast:[9,18,19,21,25,26,27,37,39,40,41,52],fasta:[0,13,30,35],faster:[10,25,26,32,33,40],fastest:[32,35],favor:33,favourit:1,fed:[4,16],fedora:8,fee:20,feed:[4,21,31],feel:[8,16],fellow:8,fetch:16,few:[2,8,16,25,37,42],ff_aa:25,ff_aa_on:25,ff_aa_two:25,ff_ala:25,ff_arg:25,ff_asn:25,ff_asp:25,ff_cy:25,ff_cys2:25,ff_gln:25,ff_glu:25,ff_gly:25,ff_hisd:25,ff_hise:25,ff_ile:25,ff_leu:25,ff_lookup:[25,32,35],ff_lookup_charmm:37,ff_ly:25,ff_met:25,ff_phe:25,ff_pro:25,ff_ser:25,ff_thr:25,ff_trp:25,ff_tyr:25,ff_val:25,ff_xxx:25,field:[20,35,37,52],fifti:20,figur:16,file:[0,1,2,3,4,5,8],filecheck:16,fileexist:11,fileextens:11,filegzip:11,filenam:[0,8,11,13,25,26,27,28,37,39,41,48,52],filenotfound:33,fill:[4,7,8,13,16,23,26,29,30,31,33,35],fillfromdatabas:[31,35],fillfrommontecarlosampl:[31,35],fillloopsbydatabas:35,fillloopsbymontecarlo:35,filo:40,filtercandid:33,filtercandidateswithsc:33,final_model:[30,35],find:[4,7,8,10,16,21,23],findchain:42,findeigen3:20,findwithin:8,fine:8,finish:53,fire:[1,7],first:[0,1,8,10,13,16,18,21,22,25,26,27,28,29,31,32,34,35,36,39,40,41,43,44,47,49,52],fit:[16,20,22,26,30,31],fix:[3,8,11,16,25,32,36,37,39,41],fix_cterm:32,fix_nterm:32,fix_surrounding_hydrogen:25,flag1:4,flag2:4,flag:[0,2,4,8,10,11,22,26,35,36,49,50],flanking_rot_angle_on:22,flanking_rot_angle_two:22,fletch:[26,47],fletcher:35,flexibl:[0,19,36,44,47,49,50,53],flip:52,flood:26,flush:[1,16],fold:38,folder:[2,4,8,16,18,37],follow:[0,1,2,4,5,8,10,11,16,18,20,22,23,25,26,28,29,30,31,35,36,37,39,41,47,49,50,51,52],fontsiz:27,forbidden:8,forc:[25,32,35],force_const:[25,32],forcefield:23,forcefieldaminoacid:25,forcefieldbondinfo:25,forcefieldconnect:25,forcefieldharmonicangleinfo:25,forcefieldharmonicimproperinfo:25,forcefieldljpairinfo:25,forcefieldlookup:[25,32,35,37],forcefieldperiodicdihedralinfo:25,forcefieldureybradleyangleinfo:25,forg:16,forget:[1,8],form:[14,20,24,25,26,30,35,40,52],formal:[31,32,49,52],format:[0,5,13,20,26,48],formula:33,forward:16,found:[1,4,8,11,13,16,21,23,26,28,31,32,33,34,35,36,44,46,52],foundat:1,four:[9,34],fraction:[26,28,32,34],frag_db:[23,26,31,37],frag_info:26,frag_length:[23,26,28],frag_map:26,frag_po:[23,26,28],frag_residu:[23,26],frag_seq:[23,26],frag_siz:26,fragdb:[23,24,26,31,35,37],fragger:[23,26,28,34,35],fragger_handl:35,fragger_map:26,fraggerhandl:[26,28,35],fraggermap:[26,28],fragment:[3,9,22,23,24],fragment_db:35,fragment_handl:28,fragment_info:26,fragment_length:[26,28],fragmentinfo:[26,31],fragments_per_posit:28,fragmentsampl:34,frame:[3,16,35,36],frame_energi:49,frame_residu:[45,47],frameresidu:[45,49,50],framework:[8,19,38],free:[8,20,51,52],frequenc:[26,34],frm:36,frmrotam:[44,49,53],frmrotamergroup:[44,46,49,50],from:[0,1,2,3,4,5,6,7,8,9,10,11,13,16,18,20,21,22,23,25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42],fromhhm:26,fromhoriz:26,fromresidu:52,front:[1,11,16],fstream:37,fudg:25,fulfil:[26,52],full:[0,1,8,10,21,25,26,29,30,31,34,36,47,49],full_seq:[29,31],fullgapextend:[29,35],fulli:[8,16,21,22,26,29,30,36],function_typ:40,functions_specific_to_your_act:8,fundament:37,funni:[2,8],further:[10,28,29,35,36,37],furthermor:37,futur:[25,26],gamma:[40,41,44],gamma_bin:41,gap:[0,3,9,18,24,25],gapextend:[29,35],gapfre:26,gapless:[0,13],gather:[4,12,16,26,28,47,49,52],gauc:52,gauch:52,gauche_minu:52,gauche_plu:52,gciiipgatcpgdyan:[31,35],gener:[1,2,3,5,8,10,13,14,16,18,19,20,23,24],generatedenovotrajectori:28,generatestructureprofil:26,geom:[21,22,25,26,28,32,35,44,49],geometr:[9,23],geoom:43,get:[0,1,2,7,8,16],getaa:[21,22,25],getaaa:21,getaah:21,getactivesubrotam:49,getallatomposit:[21,32,36],getallatomscoringkei:31,getallatomweight:31,getanchoratomindex:21,getangl:47,getangularbins:26,getatomcount:8,getatomnam:21,getatomnameamb:21,getatomnamecharmm:21,getaveragescor:31,getbackbonelist:[23,26],getbackbonescoringkei:31,getbackboneweight:31,getbins:27,getbinsperdimens:27,getbound:22,getc:22,getca:22,getcb:22,getchain:29,getchainindex:29,getchainnam:29,getchains:8,getcharg:[25,49],getclust:31,getclusteredcandid:31,getconfid:26,getcoordidx:26,getcoordinfo:26,getcpuplatformsupport:25,getcreationd:5,getdefault:[25,32,35],getdefaultlib:5,getdihedralangl:26,getdihedralconfigur:52,getdistbins:26,getdisulfidbridg:25,getdisulfidconnect:25,getdsspstat:26,getel:21,getenviron:21,getenvsetdata:8,getepsilon:25,getfirstindex:21,getforcefieldaminoacid:25,getfragmentinfo:[26,31],getframeenergi:49,getfudgelj:25,getfudgeqq:25,geth1index:21,geth2index:21,geth3index:21,getheavyindex:25,gethistogramindex:[22,27],gethistogramindic:27,gethnindex:21,gethydrogenindex:[21,25],getindex:[21,25],getinternalconnect:25,getinternalenergi:49,getinternalenergyprefactor:49,getlargestclust:31,getlastindex:21,getlength:29,getlist:28,getlooplength:25,getloopstartindic:25,getmass:25,getmaxnumatom:21,getmaxnumhydrogen:21,getn:22,getnam:[47,49],getnonbondedcutoff:32,getnum:31,getnumatom:[21,25],getnumb:31,getnumcandid:31,getnumchain:8,getnumcoord:26,getnumfrag:26,getnumhydrogen:21,getnumloopresidu:25,getnumresidu:[8,21,25],getnumstempair:26,getnumsubrotam:49,geto:22,getolc:[21,22],getomegators:[21,22],getoxtindex:25,getparticletyp:49,getpeptideboundconnect:25,getphiprobabilitygivenpsi:27,getphitors:[21,22,47],getpo:[21,49],getpotentialenergi:25,getpredict:26,getprob:[27,49],getpsiprobabilitygivenphi:27,getpsitors:[21,22,47],getr:33,getresiduedepth:26,getringpunch:33,getrotamericconfigur:52,getscor:[26,34],getselfenergi:49,getseqr:[21,40],getsequ:[21,22,26,31],getsequenceprofil:26,getsequenceprofilescoreskei:31,getsigma:25,getsimul:25,getsolventaccessibilitit:26,getstemrmsdskei:31,getstructureprofil:26,getstructureprofilescoreskei:31,getsubdb:26,getsubrotamerdefinit:49,getsystemcr:32,gettemperatur:[34,49],gettransform:22,getversionnumb:37,getweight:[28,31],ggg:35,gggaggg:35,gggggggggggggggggggg:35,git:[0,1,2,3,4,5,6,7,8,9,10,11,12,13,14,15],gitignor:8,give:[4,8,16,20,23,31,34,35,49],given:[0,1,3,4,8,9,10,11,13,14,21,22,25,26,27,28,29,30,31,32,33,34,35,36,37,39,40,41,44,47,49,50,52],glass:38,gln:[51,52],gln_ne2:21,global:[15,26,31,37],glu:[21,49,51,52],glu_oe1:21,glutam:51,glutamin:51,gly:[35,36,47,50,51],gly_n:21,glycin:[3,22,26,32,36,51],goal:[1,10,30],goe:[2,8,14,16,35,52],goldfarb:35,goldstein1994:[10,38],goldstein:[10,38],good:[4,8,18,25,26,35],goodwil:20,got:2,govern:20,grain:8,grant:20,graph:3,graph_initial_epsilon:36,graph_intial_epsilon:36,graph_max_complex:36,graphminim:[10,46],greatest:5,grep:2,grid:26,gromac:9,grossli:20,group:[4,14,24,26,27,41,44,45,46,47],group_definit:[27,41],group_idx:41,guarante:[26,28,31,34,36,37],gui:[8,27],guid:32,guidelin:[8,37],gzip:[0,5,11,13],haa:38,hand:[0,2,4,13,49],handl:[3,8,9,19],handler:28,happen:[1,8,25,26,28,29,34,35,49],hard:43,hardwar:18,harmless:20,harmon:[25,32],harmonic_angl:25,harmonic_bond:25,harmonic_improp:25,hasdata:26,hasfraglength:26,hasfragmentinfo:31,hash:26,hasringpunch:33,have:0,hbond:[28,35,41,49,50,51],hbond_scor:37,hbondscor:[35,37],headach:8,header1:4,header2:4,header3:4,header4:4,header:[0,2,4,16,17],header_output_dir:4,headlin:8,heavi:[21,25,36,39,50],heavili:[26,47],helic:[22,24,25,28,35,41],helix:[18,22,34,47],hello:37,hello_world:8,hellyeah:18,help:[0,1,2,4,7,8,13,16,18,25,41],helpactiontest:1,helper:4,hen:26,henc:[8,14,21,26,37],here:[0,1,2,4,8,11,13,14,16,18,21,22,25,26,27,28,30,31,32,34,35,37,39,41,44,48,52],herebi:20,herein:20,het:35,heurist:[35,50],heuristicprocessor:21,hgfhvhefgdntngcmssgphfnpygkehgapvdenrhlg:0,hhblit:[0,13],hhm:[0,13,26,31],hhsearch:26,hidden:49,hide:[8,16],hierarch:[31,40],hierarchi:15,high:[3,8,16,30,35],high_resolut:22,higher:[2,31,40,41],highest:15,highli:[2,8],hint:13,histidin:[25,51],histogram:[27,34],histori:16,hit:[1,10,16,27,32],hmm:38,hold:20,home:[4,5],homo:[0,13],homolog:[0,12,18,19,35,38],homologu:26,honor:35,honour:35,hook:8,horiz:26,host:[4,7,16],hotfix:16,how:[1,7],howev:[5,20,26],hparticl:49,hpp:37,hsd:[51,52],hse:[51,52],html:[2,8,16],http:[7,20],hybrid:52,hydrogen:[3,21,22,25,35,38,41,49,50],hyphen:1,i_loop:[25,36],id_:37,idea:[1,8,21,23,25,26,35,40,49,53],ideal:[22,32,53],idenfifi:50,ident:[3,26,27,41,52],identif:20,identifi:[0,13,14,20,26,31,35,36,39,41,50,52],idx:[10,21,22,25,26,28,32,40,49],idx_ca_res_37:21,idxhandl:8,iff:[26,29,33],ifstream:37,ignor:[0,25,32,35],iii:20,illustr:26,image_nam:[5,7],imagehandl:22,imagin:8,imaginari:1,img:[7,22],immedi:[1,8,15,16],impact:[0,25,26],implement:[3,16,19,26,28,29,32,34,35,37,43,44,46,47,51],impli:20,implicit:2,improp:25,improv:[3,20,25,35,38,44],in_dir:4,in_fil:8,in_path:4,in_stream:37,in_stream_:37,inabl:20,inaccur:25,inaccurate_pot_energi:25,inact:53,inactive_internal_energi:53,incident:20,incl:[25,26,35],includ:[2,8,11,16,18,20,21,25,26,29,31,33,35,37,39,41,47],include_ligand:35,inclus:[20,35],incompat:[31,32],incomplet:[35,48],inconsist:[10,13,21,22,25,26,29,31,32,36,40],inconveni:16,incorpor:20,increas:[10,28,31,32,35,50],incur:20,indemn:20,indemnifi:20,independ:[0,3,25,36,48],index:[8,10,21,22,25,26,27,28,29,31,32,33,34,35,39,40,41,45,49,50,52],index_four:25,index_on:25,index_thre:25,index_two:25,indic:[8,10,11,13,20,21,22,25,26,27,28,29,31,32,35,36,40,44,47,49],indirect:20,individu:[20,39,41],inf:[10,32],infin:32,infinit:32,influenc:[13,28,40],info:[26,31,35,40],inform:[5,7,8,13,16,20,22,23,26,28,29,31,34,35,38,40,41,42],infring:20,inherit:[1,39,40,41,46],init:16,init_bb_list:34,init_frag:34,initi:[3,10,21,22,26,28,31,32,34,35,36,39,40,41,46,49,52],initial_bb:31,initial_epsilon:[10,53],initialis:1,inlin:37,inner:14,input:[0,1,3,13,16,18,25,26,27,28,32,34,35,36,39,40,41,44,48,50,53],insert:[21,22,29,31,34,35,53],insertinto:[21,22,31],insertloop:[29,35],insertloopcleargap:[29,31,35],insid:[1,4],insight:16,instanc:[3,8,13,24,25,37],instead:[0,1,2,3,4,8,11,26,28,29,31,34,35,50],institut:20,instruct:2,int16_t:37,int32_t:37,int_32_t:37,integ:[8,13,21,40],intend:[1,8,34],intent:26,intention:20,interact:[3,8,25,32,39,40,41,43,44,45,49],intercept:[39,41],interest:[1,10,25,26,34,37,49,52],interfac:[0,4,8,20],intermedi:8,intern:[0,1,3,4,5,8,16,21,24,25,26,27,28,31,32,34,35,36,37,38,39,40,41,46,49,50,53],internal_e_prefac:50,internal_e_prefactor:49,internal_energi:49,internet:8,interpl:52,interpol:[40,52],interpret:[8,11],intervent:8,intrins:2,introduc:[1,4,8,16,32,35],invalid:[8,21,25,26,29,32,35,36,39,40,41,45,49,51,52],invok:[2,4,8,15,16],involv:[16,30,44],iostream:37,irrevoc:20,is_c_ter:[25,36],is_cter:25,is_n_ter:[25,36],is_nter:25,isallatomscoringsetup:[31,35],isallset:21,isanyset:21,isbackbonescoringsetup:35,isctermin:29,isempti:31,isen:14,ishbondacceptor:49,ishbonddonor:49,isntermin:29,isoleucin:51,isset:21,issimilar:52,issourc:37,istermin:29,isvalid:47,item:[1,8,16,21,22,25,26,35,40],iter:[10,26,27,28,31,32,34,35,49],itself:[3,4,8,16,26,34,36,37,39,41,49],januari:20,job:[8,26,34,35],johner:38,join:[8,21,23,26,31,32,34,36],jone:[38,49],jones1999:[26,38],journal:38,json:[0,13],jupyt:7,just:[1,2,8,13,15,16,23,25,26,29,31,35,50],kabsch1983:[26,38],kabsch:38,keep:[0,1,2,4,5,8,13,16,30],keep_non_converg:31,keep_sidechain:[8,36],kei:[0,13,26,28,31,34,35,39,40,41],kept:[8,16,25,31,32,36,45],kernel:38,keyword:27,kic:[30,31],kicclos:34,kick:13,kill_electrostat:25,kind:[1,8,20],kinemat:32,know:[2,52],knowledg:52,known:[4,11,21,40,50],krivov2009:[10,38,47],krivov:38,kwarg:1,l_e:49,lab:48,label:[16,25],lack:35,languag:[4,20],larg:[5,27,32,35],larger:[10,14,22,26,35,50],largest:[28,31,44],last:[1,4,21,22,25,29,31,32,34,35,40,41,48],last_psi:22,later:[1,8,10,21,47],latest:[2,5,7,8],latter:[0,5,16,35],launcher:[4,8],law:20,lawsuit:20,layer:44,layout:[26,37],lazi:49,lbfg:35,leach1998:[10,38],leach:38,lead:[0,8,9,11,22,25,31,32,36,39,41,48],least:[0,2,4,8,10,16,20,22,25,26,35,39,41,44],leav:1,left:[11,32],legal:[8,20],lemon:38,len:[22,23,25,26,28,31,35,36,41,47],length:[9,10,21,24,25,26,27,28,29,31,32,34,35,36,37,39,40,44],length_dep_weight:35,length_depend:31,lennard:49,less:[0,10,16,22,25,26,27,31,35,39,41,52],let:[1,7,8,22,26,31,47],letter:[3,5,21,22,26,27,34,51],leu:51,leu_h:21,leucin:51,level:[2,3,8,14,15,16,30,35,49],lexicograph:35,liabil:20,liabl:20,lib64:8,lib:[5,7,37],libexec:[4,8],libpromod3_nam:4,librari:[0,3,4],library1:4,library2:4,licenc:48,licens:3,licensor:20,life:16,ligand:[3,35,36,50],like:[1,4,7,8,16,35,37,48,49],limit:[3,20,26,32,35],line:[0,1,7,8,9,12],linear:[26,28,31,34,39,40,41],linear_weight:[31,34,39,41],linearcombin:31,linearscor:34,link:[0,2,4,8,16,20,21,25,26,28,34,36,39,40,41,42],link_cmd:4,linkcheck:[2,8,16],linker:[4,35],linker_length:35,list:[0,1,2,3,4,8,9,10,11,13,20,21,22,25,26,27,28,29,30,31,32,33,34,35,36,37,39,40,41,44,45,46,47,49,50,52,53],listen:8,literalinclud:8,litig:20,littl:[4,8,16,37],live:[4,8],lj_pair:25,load:[1,8,13,15,21,23],loadalign:[30,35],loadallatominteractionscor:39,loadallatompackingscor:39,loadamberforcefield:35,loadbb:26,loadbbdeplib:[0,36,47,48],loadcach:28,loadcbetascor:[31,34,41,42],loadcbpackingscor:41,loadcharmm:25,loadcharmmforcefield:35,loaddefaultallatomoverallscor:39,loaddefaultbackboneoverallscor:41,loadent:[0,13],loadfragdb:[23,24,31,35],loadhbondscor:41,loadlib:[0,36,48],loadpdb:[8,21,23,25,26,30,31,32,34,35,36,42,47],loadport:[25,26,27,37,39,41,52],loadreducedscor:41,loadsequenceprofil:[13,26,31],loadssagreementscor:41,loadstructuredb:[23,24,26,31,35],loadtorsionsampl:[22,24,27,34],loadtorsionsamplercoil:[24,31,35],loadtorsionsamplerextend:24,loadtorsionsamplerhel:24,loadtorsionscor:41,local:[2,5,7,25,26,27,39,41,52],localhost:7,locat:[2,3,4,5,10,22,24,26,29,37,39,41,49],log:[11,16,33,49,50],logic:0,loginfo:33,lone:49,lone_pair:49,longest:26,look:[5,8,11,16,22,26,36,40],lookup:[9,21,23],looooooong:10,loop:[0,3,8,18,19,21],loop_candid:31,loop_length:[25,26,31,36],loop_main:8,loop_po:25,loop_seq:31,loop_start_indic:[25,36],loopcandid:[28,30],loss:[16,20],lossi:26,lost:[1,16],lot:[1,7,8,13,16],low:[1,8,10,50],lower:[31,34,35,39,41],lowest:[31,34,49],lowest_energy_conform:34,lysin:51,machin:[25,26,27,37,39,41,52],macro:[4,8],made:[4,20,52],magic:[8,37],mai:[0,1,2,4,8,11,13,16,20,21,25,29,32,35],mail:20,main:[35,37,52],mainli:[21,34,49],maintain:[8,16],maintin:34,major:16,makefil:[2,8],makestat:52,malfunct:20,malici:16,man:[2,8],manag:[4,8,20,42],mani:[7,11,13,26,32,33,35,50],manipul:22,manner:[8,10,34],manual:[1,2,5,8,9,16,26,31,34,35,37,49],map:[0,13,21,22,26,28,33,36],mariani:38,mark:[4,20,50],mass:25,massiv:28,master:[8,16],mat3:9,mat4:[9,22,28,35],match:[0,4,13,22,25,26,27,31,32,34,35,40,41],materi:[1,8],math:33,mathemat:[31,32],matplotlib:27,matric:38,matrix:[9,26],matter:[4,7],max:[9,10,21,29,33,35,36,41,52,53],max_alpha:41,max_beta:41,max_complex:[10,53],max_count:[39,41],max_d:41,max_dev:34,max_dist:[31,40],max_extens:35,max_gamma:41,max_iter:[28,31,35],max_iter_lbfg:35,max_iter_sd:35,max_length:29,max_loops_to_search:35,max_n:10,max_num_all_atom:35,max_p:50,max_prob:49,max_res_extens:35,max_step:32,max_to_show:14,max_visited_nod:10,maxfraglength:26,maxim:[10,26,28,31,32,34,35,38,40,41],maximum:[10,26,31,32,34,49,50],mc_closer:34,mc_cooler:34,mc_num_loop:35,mc_sampler:34,mc_scorer:34,mc_step:[10,35],mcsolv:10,mean:[4,8,13,16,20,21,25,32,35,36],meaning:[26,31],meant:[18,21,26,33,35,50],measur:28,mechan:[18,20,31,32,34,35,40],meddl:[7,35],media:20,medium:20,meet:20,member:[8,13,31,35],memori:[10,26,35,37],mention:[1,2],merchant:20,mere:20,merg:[16,25,28,29,31,35,36,40,49],merge_dist:35,mergegap:29,mergegapsbydist:35,mergemhandl:35,mess:[8,16,40],messi:16,met:51,methionin:[35,51],method:[0,1,10,13,21,25,26,27,32,35,36,37,50],metric:40,metropoli:[10,31,34],mhandl:[29,30,31,35],middl:16,might:[10,25,26,31,32,34,40,49,50,53],min:[31,41],min_alpha:41,min_beta:41,min_candid:31,min_d:41,min_dist:40,min_gamma:41,min_loops_requir:35,min_scor:31,mincadist:22,mind:[1,8],minim:3,minimizemodelenergi:35,minimum:[22,26,28,44],minor:[3,25],mirror:37,miser:14,mismatch:[21,40],miss:[0,11,13,25,35],mix:[0,4],mkdir:[2,8],mm_sy:[25,32],mm_sys_output:25,mm_system_cr:32,mmcif:[5,11],mmsystemcr:[25,32],mod:8,mode:[1,52],modellinghandl:[29,31,35],modeltermini:35,modif:[20,35],modifi:[8,16,20,22,31,35],modified_crambin:31,modul:[1,3],modular:19,module_data:4,mol:[8,9,18,21,22,23],molecular:[18,32,35],molprob:30,molprobity_bin:33,molprobity_execut:33,moment:8,monitor:1,monolith:8,mont:[3,10,28,31,34,35,46],montecarlo:3,mood:8,more:[1,2,4,7,8,10,13,14,16,20,28,35,44,49],most:[0,3,4,5,8,22,25,26,27,28,31,32,35,39,41,48,50],mostli:[4,16,49],motion:[22,38],mount:[5,7],movabl:25,move:[2,3,8,16,25,31,32,34,35,37],movement:28,mpscore:33,msg:11,msgerrorandexit:11,msm:3,msse4:2,much:[10,26,35],multi:18,multipl:[0,2,3,4,8,13,14,18,25,28,31,35,36,39,41],multipli:[10,34],multitempl:13,must:0,mutlipl:13,my_db_on:26,my_db_two:26,my_script:7,myclass:37,myclassptr:37,mytrg:0,n_coord:9,n_num:29,n_po:[9,22,41],n_stem:[9,23,26,29,31,32,34],n_stem_phi:34,n_ter:[32,50],naivesolv:10,name:[0,1,3,4,5,7,8,11,13,14,20,21,25,26,27,29,31,33,35,44,48,49,51,52],name_pymod:4,namespac:[7,13,37],nan:[32,52],nativ:37,necessari:[8,22,34,40],necessarili:[20,53],need:[1,2,3,4,5,8,11,13,15,16,22,25,26,27,28,31,32,35,36,37,39,40,41,47],need_config_head:4,neg:[1,10,25,32,40],neglect:[28,32,45,49],neglect_size_on:31,neglig:20,neighbor:[8,21,35],neighbour:[35,52],network:[22,44],never:[13,16,26,31,36,37,39,41],nevertheless:[8,49],new_default:25,new_env_po:21,new_po:21,new_res_nam:49,new_siz:22,newli:[5,21,34],next:[1,8,16,22,27,28,29,37],next_aa:34,nglview:7,nice:8,nitrogen:[9,22,32,43,49,50],nobodi:1,node:10,node_idx:10,node_idx_on:10,node_idx_two:10,non:[0,4,10,13,16,20,24,25,27,28,29,31,32,35,37,47,48,50],non_rotamer:52,nonbonded_cutoff:[25,32],none:[13,26,28,33,34,35,36],nonredund:26,nonzero:52,norm:41,normal:[20,39,41],normalis:40,notabl:26,note:[0,2,8,13,14,21,22,25,26,28,31,32,34,35,36,37,39,40,41,47,50,51],notebook:7,noth:[0,4,8,13,14,20,34,49],notic:[1,4,16,20],notwithstand:20,novel:[19,38],novo:3,now:[3,8,14,16,18,22,26],nparticl:49,nterminalclos:34,null_model:31,num:[23,28,31,32,36],num_frag:[26,35],num_gap_extens:29,num_loop:31,num_residu:[21,25,34,36,39,40,41],num_residues_list:36,num_trajectori:28,number:[0,1,8,9,10,13,14,18,21,22,24,25,26,27,28,29,31,32,34,35,36,37,39,40,41,42,44,45,49,52],numer:35,numpi:[27,34],o_po:22,object:[0,3,8,13,14,20,21,22,23],oblig:20,observ:[10,26,32,53],obtain:[10,18,20,23,35],obviou:16,occupi:[45,50],occur:[21,28,40,41],ocparticl:49,odd:26,off:[1,8,14,35],offend:33,offer:[6,20,24,30,49,52],offset:[0,3,13,26,31,35],ofstream:37,often:[8,11,13,32],olc:22,old:[33,35],oligom:[0,13,30],oligomer:3,omega:[21,22],onc:[1,3,8,16,25,28,31,32,34,46,52,53],one_letter_cod:[21,23,26,31,32,34,36],onli:[0,1,2,4,8,10,11,13,14,15,16,20,21,22,25,26,28,29,31,33,34,35,36,37,39,41,44,47,48,50],only_longest_stretch:26,onto:[1,22,26,28],oparticl:49,open:[13,25,26,27,37,39,41,52],openmm:[2,18,25,32],openstructur:[0,1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43,44,45,46,47,48,49,50,51,52,53,54],oper:[3,10,16,18,21,26,40],opt:[11,13,16],optim:[0,2,3,10,25,26,27,31,39,41,44,47,48,52],optimis:8,optimize_subrotam:[36,44],option:[0,2,3,5,7,13,26,31,32,35,52],order:[0,5,13,21,25,26,29,31,35,37,40],org:20,organ:[8,26,52],orient:[9,32,41],orig_indic:[31,33],origin:[5,7,9,13,16,20,22,26,31,34,35,40,53],ost:[0,1,2,3,4],ost_complib:[5,7],ost_double_precis:2,ost_ent:33,ost_librari:4,ost_root:[2,8],other:[0,1,2,4,8,10,14,16,20,21,22,31,32,35,36,39,41,42],other_index:22,other_res_index:21,otherwis:[1,4,8,10,14,16,20,21,22,25,26,28,29,31,32,34,39,40,41,49,52],our:[4,5,8,16,26,31],out:[0,1,2,4,8,14,16,20,21,25,26,27,28,29,31,34,47,52],out_path:4,out_po:25,out_stream:37,out_stream_:37,outdat:[5,7],outer:[14,26],outlier:33,output:0,output_dir:4,outsid:[8,40],outstand:20,over:[2,4,13,16,26,32,34,35,49],overal:[10,34,40,46],overhead:25,overlap:[25,34,35,36],overli:16,overload:37,overrid:[2,5,25],overridden:4,overriden:5,overview:[8,16],overwrit:31,overwritten:25,own:[1,3,4,5],owner:20,ownership:20,oxt:[9,21,25],oxygen:[22,35,43,49,50],pack:21,packag:[4,8,16],pad:[22,37],page:[2,8,20],pai:1,pair:[9,25,26,27,28,32,34,36,37,39,40,41,44,49,52],pairwis:[3,8,10,22,28,31,35,39],pairwise_energi:10,pairwiseenergi:49,pairwisefunct:[40,41],pairwisefunctiontyp:40,pairwisescor:[8,35],paper:[43,44,47,49],paragraph:[1,8],parallel:26,paramet:[1,4,8,9,10,11,13,14,15,21,22,24,25,26,27,28,29,31,32,33,34,35,36,38,39,40,41,43,44,45,46,48,49,50,51,52,53],parameter_index:26,parametr:[32,35,36,50],parent:35,pars:[0,11,12],parser:12,part:[1,8,16,18,20,21,26,34,35,40,44,46,47,49],partial:29,particip:[36,44],particl:[25,26,32,41,43,44,45,47],particular:[8,10,20,26,31,32,34,49,52],partner:[39,40,41,49],pass:[13,16,21,25,26,28,29,32,34,44,45,49,50],past:[8,16,22,29],patent:20,path:[1,2,4,5,8,11,16,18,25,26,27,33,39,41,52],path_to_chemlib:15,path_to_dockerfile_dir:5,path_to_promod3_checkout:6,pattern:38,paus:14,pdb:[0,5,8,11,13,18,21,22,23,24,25,26,30,31,32,33,34,35,36,42,47],penal:[29,35],penalti:[29,35],penultim:3,peopl:16,pep:[0,1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43,44,45,46,47,48,49,50,51,52,53,54],peptid:[3,21,23,25,26,35,36,47],per:[4,8,10,12,16,21,27,31,34,35,39,40,41,44],percent:20,percentag:33,perfect:8,perfectli:8,perform:[0,10,16,18,19,20,25,28,31,32,33,34,35,37,40,44],period:25,periodic_dihedr:25,periodic_improp:25,permiss:[8,20],permut:10,perpetu:20,pertain:20,phase:25,phe:[51,52],phenix:33,phenylalanin:51,phi:[21,22,26,27,32,34,41,47,50,52],phi_bin:[41,52],phi_handl:47,philippsen:38,phipsisampl:34,phosphoserin:35,phrase:8,pick:[31,34],pictur:8,piec:[8,28],pipelin:[0,3,14],pivot:[31,32,34],pivot_on:[31,32],pivot_thre:[31,32],pivot_two:[31,32],place:[1,2,4,8,11,13,16,20,26],plain:[0,13],plan:16,plane:33,platform:[18,25],playground:7,pleas:[2,8,16,28,31,32,35],plot:27,plt:27,plu:[8,13,15,26,44,49],pm3_csc:16,pm3_openmm_cpu_thread:[18,25,35],pm3_runtime_profiling_level:14,pm3argpars:[0,11,12],pm3argumentpars:[0,11,13],pm_action:[1,4,8],pm_action_init:8,pm_bin:1,png:27,point:[2,7,8,13,15,21,26,28,34,35,40,52],pointer:[2,8,37],polar:[49,50],polar_direct:49,polici:8,pop:[16,31,34,40],popul:[2,16],port_str_db:26,portabl:[4,17,25,26,27],portable_binary_seri:37,portable_fil:4,portablebinarydatasink:37,portablebinarydatasourc:37,pos_end:28,pos_on:28,pos_start:28,pos_two:28,posit:[3,8,9],possibl:[0,3,8,10,13,16,20,22,25,26,27,29,31,32,34,35,36,37,39,40,41,44,46,49,51,52],post:13,postprocess:36,pot:25,pot_:32,potenti:[10,23,25,26,31,32,35,36,37,38,41],power:20,pqhpg:0,practic:[4,8,25,26],pre:[8,16],pre_commit:[8,16],preceed:36,precis:[2,31,35],precomput:23,pred:40,predefin:[4,18,25,35,39,41],predict:[26,28,35,38,40,41],prefactor:49,prefer:[2,4,20,26,52,53],prefilt:35,prefix:[1,4,8,11],prepar:[8,20,35],present:[22,28,32,36,49,50,52],prev_aa:34,prevent:[1,8],previous:[25,26,31,36,40],primary_rot_angl:22,principl:[34,40],print:[1,2,5,20,22,23,25,26,31,32,33,35,42],printstatist:26,printsummari:14,prior:35,privat:[1,37],pro:[21,27,51,52],probabilist:[26,50],probability_cutoff:50,probabl:[4,8,10,16,26,27,28,31,32,34,49,50,52],problem:[3,7,10,13,16,26,31,32,34,35,40,42,44,46,48,53],problemat:[3,5,28],proce:42,procedur:[10,28,34,36],process:[1,13,16,21,25,28,32,34,35,37,40,45,49,52],processor:5,produc:[0,1,2,4,8,10,26,29,33,35,50],product:[1,3,16,20],prof:[0,26,31],prof_dir:26,prof_path:26,profil:[0,3,12,13],profiledb:26,profilehandl:[13,26,28,31,35],prog:13,program:[4,5,8,12],project:[3,4,8,16],prolin:[22,33,50,51],promin:[0,20],promod3_mod:4,promod3_nam:4,promod3_name_head:4,promod3_path:8,promod3_root:8,promod3_shared_data_path:[8,37],promod3_unittest:[1,4,8],promod:[5,7],promot:8,propag:[8,22],proper:[16,26,50],properli:[1,35,39,41,50],properti:[21,22,35,52],propos:[29,31,32,34,44],proposed_posit:34,proposestep:34,prot:[8,23,26,32,34,36,47],prot_rec:8,protein:[0,18,19,24,25],proton:[21,25,51,52],prototyp:19,provid:[0,1,2,3,4,5,7,8,13,16,20,21,22,23,25,26,28,29,31,32,33,34,35,36,37,40,48,49,50,52],prune:[10,53],pseudo:[34,35,39,41],psi:[21,22,26,27,32,34,41,47,50,52],psi_bin:[41,52],psi_handl:47,psipr:[26,28,40,41],psipred_confid:41,psipred_pr:28,psipred_predict:[26,28,35],psipred_st:41,psipredpredict:23,pssm:[0,13],publicli:20,pull:[7,8,16],punch:[1,3,30],pure:0,purpos:[8,10,20,35,52],push:[7,16],pushverbositylevel:13,put:[1,4,8,11,13,35],pwd:5,py_run:[1,4,8],pyc:1,pylint:16,pylintrc:16,pymod:[4,8,16],pyplot:27,pytest:8,python2:8,python:[0,1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43,44,45,46,47,48,49,50,51,52,53,54],python_root:2,pythonpath:8,qmean:2,qmeandisco:40,qualiti:35,quantum:38,queri:[26,52],querylib:52,question:[3,27],quickli:[5,8,32],quit:[8,13],rackovski:38,radian:[9,22,25,27],radii:[33,43],radiu:[8,33,39,41],raihvhqfgdlsqgcestgphynplavph:0,rais:[0,9,10,13,21,22,25,26,27,28,29,31,32,33,34,35,36,39,40,41,44,45,49,50,52],rama_iffi:33,ramachandran:33,random:[10,22,24,27,31,32,34],random_se:31,randomized_frag:22,randomli:[27,34],rang:[8,9,21,22,23,25,26,27,28,29,32,34,35,39,40,41,52],rank:31,rapid:38,rare:8,rather:[5,7,8,11,16,34,52],raw:[7,18,25,26,27,30,31],rawmodel:[3,8],reach:[0,29,32],read:[0,8,11,13,16,25,26,27,29,36,37,39,41,48,52],readabl:[0,8,13,20,52],readdunbrackfil:48,reader:[16,18],readi:[2,52],readm:[2,48],real:[8,13,37,50],realli:[1,2,8,11,16],reappear:16,reason:[8,16,20,32,34,53],rebas:16,rebuild:[2,8],recalcul:27,receiv:20,recent:16,recip:[3,6,7],recipi:20,recoginz:51,recogn:[0,13],recognis:[1,8,16],recognit:38,recommend:[2,5,8,20,25,35],reconstruct:[0,3,8,18,21,22,25,30,32,35],reconstructcbetaposit:22,reconstructcstemoxygen:22,reconstructor:[32,35,36],reconstructoxygenposit:22,reconstructsidechain:[8,35,36],reconstructtest:8,record:[1,35],recreat:16,redistribut:20,reduc:[3,25,28,35,41],reduced_scor:37,reducedscor:[35,37],redund:[24,31],ref_backbon:[23,26],ref_fil:8,refactor:3,refer:[1,4,8,18,19,21,22,23,25,26,34],referenc:8,refresh:31,regard:[20,32,44],region:[25,28,29,32,34,35,45,50],regist:[4,8],registri:7,regress:38,regularli:5,reinterpret_cast:37,reject:[31,32,34],rel:[4,5,9,10,26,28,32,41],relat:[4,8,13,26,28,37,38,49],relax:30,relev:[2,3,4,7,25,36],reli:5,remain:[20,30,34,35],rememb:[1,8,34],remodel:[31,36],remodel_cutoff:36,remov:[2,3,10,22,25,26,29,31,33,35,36,40,47,49],removecoordin:26,removeterminalgap:35,renumb:[26,35],reorder:35,reordergap:35,replac:[3,20,21,22,34,35],replacefrag:22,report:[1,8,35],reportmolprobityscor:33,repositori:[1,4,8,16],repres:[10,20,21],represent:[22,23,25,26,27,37,39,41,49,52],reproduc:[3,20,35],reproduct:20,request:[26,28,48,52],requir:[0,2,3,5,8,13,16,19,20,21,22,26,27,28,31,32,35,36,37,42,49,50,51,52],reread:26,res_depth:26,res_idx:49,res_index:21,res_indic:[21,25,36],res_list:[21,25,32,36],res_num:21,resembl:16,reserv:11,reset:[10,21,25,32,34,40,49],resid:5,residu:[0,3,8,9,21,22,23,24,25,26,27,28,29,31,32,33,34,35,36,38,39,40,41,42,44,45,47,49],residue_depth:26,residue_index:[45,49,50],residuedepth:26,residuehandl:[9,21,22,26,29,31,32,33,34,49,50,52],residuehandlelist:21,resiz:[22,37],resnum:[21,22,29,31,35,36,40],resnum_on:40,resnum_rang:35,resnum_two:40,resolut:[22,32],resolv:[16,21,32],resolvecystein:44,resort:35,respect:[9,25,35],respons:[8,16,20],rest:[0,1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43,44,45,46,47,48,49,50,51,52,53,54],restart:7,restor:[22,31,34,40],restraint:[26,32],restrict:[8,16,29],restructuredtext:[0,1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43,44,45,46,47,48,49,50,51,52,53,54],result:[0,2,8,10,20,25,27,28,31,32,33,34,35,36,38,44,52],resum:14,retain:20,reus:[35,36],review:16,revis:20,reviv:16,rewrit:1,richardson:38,ridig:36,right:[1,2,8,13,20],rigid:[0,3],rigid_frame_cutoff:36,rigidblock:28,rij:43,ring:[3,30],ring_punch_detect:35,risk:20,rmsd:[22,23,26,28,31,32],rmsd_cutoff:[26,31,32],rmsd_thresh:[26,28],rnum:40,robot:38,role:13,root:[2,4,8,16],rosetta:41,rot:36,rot_constructor:47,rot_group:[47,50],rot_lib:50,rot_lib_entri:50,rota_out:33,rotam:[0,3,33,36,38,44,45],rotamer:[48,52],rotamer_group:[44,46,47],rotamer_id:47,rotamer_librari:[3,35,36,48],rotamer_model:36,rotamer_on:44,rotamer_res_indic:36,rotamer_two:44,rotamergraph:[36,46,47,49,53],rotamergroup:49,rotamerid:[47,50],rotamerlib:[35,36,37,48,50,52],rotamerlibentri:[50,52],rotat:[9,22],rotatearoundomegators:22,rotatearoundphipsitors:22,rotatearoundphitors:22,rotatearoundpsitors:22,rotationaroundlin:9,roughli:24,round:52,routin:[1,18,31],royalti:20,rrm:36,rrmrotam:[44,49],rrmrotamergroup:[44,46,49,50],rst1:4,rst2:4,rst:[4,8,16],rsync:8,rule:[5,8,9,16],run:0,runact:1,runexitstatustest:1,runmolprob:33,runmolprobityent:33,runnabl:8,runner:1,runtest:[1,8],runtim:[3,10,12],runtimeerror:[9,10,21,22,25,26,27,29,31,32,34,35,36,39,40,41,44,45,48,49,50,52],runtimeexcept:27,s_id:26,safe:2,said:4,same:[0,1,2,4,7,8,10,13,14,20,21,25,26,28,31,32,34,35,36,37,39,40,41,42,45,48,49,50,52],samiti:35,sampl:[3,8,22,23],sampled_frag:34,samplemontecarlo:[3,34],sampler:[3,23,24,26],samplerbas:34,sampling_start_index:34,sander:38,saniti:2,sanity_check:2,satisfi:51,save:[8,16,22,25,26,27,28,31,34,37,39,40,41,52],savebb:26,savecach:28,savefig:27,savepdb:[18,21,22,25,26,30,31,32,34,35,36,47],saveport:[25,26,27,37,39,41,52],sc_data:32,sc_rec:[32,36],sc_rec_test:36,sc_result:32,scale:22,scatter:27,scheme:[1,8,13,21,26,29,34],schenk:38,schmidt:38,schwede:38,sci:38,scondari:35,scope:14,score:[0,3,8,19,23,26,28,29,30],score_contain:31,score_env:[31,34,42],score_threshold:44,score_vari:35,scorecontain:31,scorer:3,scorer_env:[28,31,34],scorerbas:34,scoring_weight:28,scoringgapextend:[29,35],scoringweight:[28,31,35],scratch:[26,34],scriptnam:11,scriptpath:8,scwrl3:42,scwrl3disulfidscor:[43,44],scwrl3pairwisescor:43,scwrl4:[38,44,47,49,50],scwrlrotamerconstructor:[47,49,50],seamlessli:16,search:[2,3,8,21,26,28,31,33,35,36,41,44,49,50],searchdb:[23,26],second:[8,10,22,25,26,28,31,32,35,39,40,41,43,44],secondari:[3,26,28,38,41],secondli:8,section:[1,4,7,17,20,54],see:[0,1,8,9,10,11,13,16,18,20,21,25,26,27,29,31,33,34,35,37,39,40,41,52],seed:[10,24,27,31,32,34],seem:16,segment:22,select:[3,10,26,28,34,35,36,47],selenium:35,self:[1,8,10,44,47,49],self_energi:[10,49],sell:20,send:11,sensibl:35,sent:20,seok:38,separ:[1,3,8,10,20,25,27,35,39,41,44],seq:[13,21,23,26,28,29,31,35,40,42],seq_idx_on:28,seq_idx_two:28,seq_one_idx:28,seq_sep:[39,41],seq_tpl:[31,35],seq_trg:[31,35],seq_two_idx:28,seqid:[24,26],seqprof:13,seqr:[0,21,23,26,28,29,31,34,35,36,39,40,41],seqres_str:[21,32,36],seqsim:26,sequenc:[0,3,8,13,18,21,22,23],sequencefromchain:42,sequencehandl:[21,26,28,29,35,40],sequencelist:[21,35,40],sequenceprofil:26,sequenti:[22,35],ser:51,serial:[26,37],serializ:37,serin:51,serv:[1,13,26,28,31,34],servic:[16,20],set:[1,2,4,8,10,11,13,15,16,18,21,22,25,26,28,31,32,33,34,35,36,37,39,40,41,44,47,49,50,52,53],setaa:22,setactivesubrotam:49,setallatomscoringkei:31,setaroundomegators:22,setaroundphipsitors:22,setaroundphitors:22,setaroundpsitors:22,setbackbonescoringkei:31,setbackrub:22,setc:22,setca:22,setcb:22,setcharg:25,setcpuplatformsupport:25,setdefault:25,setdisulfidconnect:25,setenergi:[39,41],setenviron:[21,32,36,40],setepsilon:25,setframeenergi:[47,49],setfudgelj:25,setfudgeqq:25,setinitialenviron:[21,31,32,34,36,40,42],setinternalconnect:25,setinternalenergi:49,setinternalenergyprefactor:49,setinterpol:52,setmass:25,setn:22,setnonbondedcutoff:32,seto:22,setolc:22,setpeptideboundconnect:25,setphitors:22,setpo:21,setpolardirect:49,setprob:49,setpsipredpredict:[35,40,41],setpsitors:22,setresidu:21,setscor:41,setsequ:22,setsequenceoffset:35,setsequenceprofil:35,setsequenceprofilescoreskei:31,setsigma:25,setstemrmsdskei:31,setstructureprofil:26,setstructureprofilescoreskei:31,settemperatur:49,setup:[2,5,7,8],setupdefaultallatomscor:[31,35],setupdefaultbackbonescor:[31,35],setupsystem:25,setweight:31,sever:[0,2,3,5,8,10,13,24,26,27,28,31,32,36,40,41,42,44,48,49,52,53],sg_pos_on:43,sg_pos_two:43,shake:34,shall:20,shanno:35,shapovalov2011:[38,48],shapovalov:38,shared_ptr:37,shebang:8,sheet:35,shelenkov:38,shell:[1,2,8,11],shift:[22,26,29],shiftctermin:29,shiftextens:29,ship:[5,48],shorten:35,shorter:35,shortest:31,shortli:8,should:[1,2,4,5,7,8,10,11,13,16,18,20,22,23,26,27,28,31,32,34,35,36,37,40,45,47,49],show:[1,8,13,14,31,34,47,50],showcas:[1,21,25,27],shown:[8,14,35],shrink:22,shrug:38,side:[8,35,38],sidechain_pymod:8,sidechain_reconstructor:35,sidechain_rst:8,sidechain_test_data:8,sidechain_test_orig:36,sidechain_test_rec:36,sidechain_unit_test:8,sidechainparticl:[49,50],sidechainreconstructiondata:[30,32],sidechainreconstructor:[25,30,32,35],sidenot:[26,36],sig1:52,sig2:52,sig3:52,sig4:52,sigma:25,silent:1,sim:25,similar:[1,2,16,23,26,28,40,41,52],similardihedr:52,similarli:[2,25,35],simpl:[0,9,22,26,34,39,40,41,52],simpler:[25,35],simplest:[5,8,30],simpli:[21,22,31,32,34,35,50,51,52],simplic:[23,26],simplif:13,simplifi:[3,22,25,26],simul:[10,25,31,32,34],sinc:[1,2,4,8,10,11,16,18,22,25,26,27,28,51],singl:[2,4,8,10,21,22,25,26,28,31,32,34,35,36,40,41,45,48,49,50,53],singleton:25,singular:[3,6],singularity_nohttp:7,sink:37,sit:8,site:[5,8],size:[8,21,22,26,27,32,34,37,39,40,41],sizeof:37,skip:[0,1,8,16,26,35,50],slide:28,slight:35,slightli:35,slow:37,slower:[18,25,26,27,35,39,41,52],small:[8,26,32,35,36],smaller:[22,26,28,32,41],smallest:47,smallish:[2,8],smart:16,smng:3,smooth:38,smtl:35,soding2005:[26,38],softsampl:34,softwar:[8,20,38],sol:47,sole:[1,16,20],soli:38,solis2006:[24,38],solut:[8,10,28,31,32,34,35,36,46,47],solv:[10,16,47,53],solvent:26,solventaccess:26,solver:3,some:[1,2,4,5,6,7,8,13,16,21,23,26,30,33,34,35,36,37,40,42,47,50,52],somedata:37,someth:[1,7,8,11,16,26],sometim:16,somewher:4,soon:[7,10,32,41,47,52],sort:[1,4,10,14,31,34,52],sound:16,sourc:[1,2,4,7,8,11,13,15,16,20,26,28,31,32,33,34,35,36,37,52],source1:[4,16],source2:[4,16],source3:4,source4:4,source_chain_idx:35,source_mhandl:35,sp3:52,space:[10,34,38],span:35,sparticl:49,spatial:[8,42],spawn:[1,8],spdbv:35,spdbv_style:35,special:[1,2,4,8,20,25,34,50,51,52],specif:[1,8,20,25,26,27,28,31,34,38,40,48,50,52],specifi:[0,2,4,5,9,10,22,26,27,31,32,35,36,40,49,52],specimen:11,speed:[3,25,35],spent:[14,18],sphere:43,sphinx:[0,1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43,44,45,46,47,48,49,50,51,52,53,54],spin:38,spit:[29,34],split:42,sport:8,squar:26,src:[8,16],ss_agreement:41,ss_agreement_scor:37,ssagre:26,ssagreementscor:37,sse:2,sstream:37,stabil:38,stabl:16,stack:16,stage:[1,2,4,8],stai:[1,8,10,16,34],standalon:7,standard:[2,8,12,13,16,21,27,37,41,52],start:[0,1,2,4,7],start_idx:31,start_resnum:[21,22,26,31,34,35,36,39,40,41],start_resnum_list:36,start_rnum:40,start_temperatur:[10,34],starter:1,startscop:14,stash:[16,31,34,40],state:[1,2,8,20,21,26,31,34,40,41,44,51,52],statement:20,staticruntimeprofil:14,statist:[14,26,38],statu:[1,8],std:37,stderr:1,stdout:1,steadili:[10,34],steepest:[32,35],stem:[9,22,25,26,29,31,32,34,35,36],stemcoord:9,stempairorient:9,step:[8,10,14,16,18,19,28,29,30,31,32,34],stereochem:[3,35],steric:52,still:[8,14,25,26,35,37],stop:[1,8,14,29,32],stop_criterion:32,stoppag:20,storabl:26,storag:[8,21,25,39,41],store:[0,1,3,8,9,16,18,21,22,25,26,27,28,29,31,32,34,35,36,37,47],stori:8,str:[1,11,13,14,15,21,22,25,26,27,28,29,31,32,33,34,35,36,37,39,40,41,49,51,52],str_len:37,straight:16,strategi:52,stream:37,stretch:[21,26,31,34,35,40,41],strict:16,strictli:3,string:[0,3,11,13,26,27,29,37],stringstream:37,strip:[0,35],struc:5,struct:[5,26,37],struct_db:23,structral:[21,40],structur:[0,3,8,13],structural_db:31,structuralgap:[29,33],structuralgaplist:[29,35],structure_db:[26,28,31,35,37],structure_db_on:26,structure_db_two:26,structure_dir:26,structure_id:26,structure_path:26,structure_sourc:13,structuredb:[3,24,26,28,31,35,37],structuredbdatatyp:26,structureprofil:26,studer:38,stuff:[26,39],style:[35,40,41],sub:[8,26],sub_frag:22,sub_res_list:26,subdir:8,subfold:8,subject:[8,20],sublicens:20,submiss:20,submit:20,submodul:8,submodule1:16,subpart:28,subrotam:[0,3,44,47,49],subrotameroptim:[36,53],subsequ:[10,20,22,35],subset:[0,13,25,26,28,31,32,35,36],subst:26,subst_matrix:26,substitut:26,substweightmatrix:26,subtre:[4,8],succeed:29,success:[10,11,34],successfulli:5,sudo:[5,7],suffici:26,suffix:11,sugar:6,suggest:[5,8,43],suit:[1,8,26],sulfur:[43,44,49,50],sum:[14,29,35,36,43,44],summari:[14,26],superpos:[22,26,28,31,32,34],superpose_stem:22,superposed_rmsd:[22,31],superposeonto:22,superposit:[3,28,31,34],superpost:28,supersed:20,supervis:1,support:[1,8,11,13,18,20,25,32,35],suppos:[16,34],sure:[2,7,8,13,16,26],surfac:26,surotam:49,surround:[25,26,32,36,39,41],symmetr:[26,40,52],symmetri:[39,41],sync:8,syntax:20,system:[1,2,4,8,16,20,23],t_sampler:27,tabl:26,tag:[5,7],tail:22,tailor:[21,35],take:[8,10,21,26,27,28,31,32,34,35,37,41,44,50,53],taken:[0,21,25,32,34,35,50],talk:1,target:[0,1,2,4,8,13,18,26,28,30,31,32,34,35,40],target_chain_idx:35,target_mhandl:35,target_pdb:33,target_sequ:26,task:[8,16,32,35,37,40],techniqu:10,tell:[1,8,11,13,16,26],temperatur:[10,31,34,49],templat:[0,1,13,18,30,35,37,40],temporari:[26,35],temporarili:16,term:[8,20,26,49,51,52,53],termin:[1,9,11,18,20,21,22,25,29,31,32,34,35,36],terminal_len:34,terminal_seqr:34,termini:[29,34,35],terminu:[26,34,35,50],test_:8,test_action_:1,test_action_do_awesom:1,test_action_help:1,test_awesome_featur:8,test_check_io:37,test_cod:8,test_doctest:8,test_foo:4,test_portable_binari:37,test_reconstruct_sidechain:8,test_sidechain_reconstruct:8,test_submodule1:16,test_suite_:4,test_suite_your_module_run:8,test_your_modul:16,testcas:[1,8],testcasenam:8,testexit0:1,testpmexist:1,testreconstruct:8,testutil:[1,8],text:[1,13,20],than:[4,8,13,14,16,21,22,26,28,31,32,33,35,36,41,44],thei:[2,5,8,16,21,22,25,26,27,31,32,33,34,35,44,49,50,51,52],them:[4,8,16,22,25,26,27,28,29,31,35,36,40,45],themselv:25,theoret:34,theori:[20,38],therefor:[5,8,22,24,26,28,32,34,35,52],thereof:[20,25],thi:[0,1,2,3,4,5,7,8,10,11,12,13,14,15,16,17,18,20,21,22,23,25,26,27,28,29,30,31,32,33,34,35,36,37,39,40,41,42,44,47,49,50,51,52,53,54],thing:[1,2,8,16,26,28,35,52],think:10,thoroughli:16,those:[0,1,2,4,8,10,13,16,20,25,31,35,36,37,39,41,47,52],though:[25,35,37],thr:51,thread:[18,25,35,38],three:[1,4,16,21,22,27,31,33,34,41,51,52],threonin:51,thresh:[22,49,52],threshold:[10,26,28,32,35,36,40,52],through:[1,8,9,20,22,26,29,35,39,41],throughout:[13,16,24,25],thrown:26,thu:[5,11],tidi:16,tightli:16,time:[1,5,8,13,14,16,18,28,35],timer:14,tini:[16,35],titl:[20,27],tlc:[21,51],tlc_an:21,tlctorotid:[47,51],tmp_buf:37,todens:22,toentiti:[18,21,22,25,26,32,34,36],toframeresidu:49,togeth:[8,16,26,44],too:[13,16,31,32,35,37,49],tool:[3,4,23,37,42,47],toolbox:16,top:[2,6,7,8,14,15,16,32],topic:[1,8,16],topolog:[25,32],torrmrotam:49,torsion:[21,22,23,24,26],torsion_angl:47,torsion_bin:41,torsion_plot:27,torsion_sampl:[22,26,31,32,34,35,37],torsion_sampler_coil:[28,37],torsion_sampler_extend:[28,37],torsion_sampler_hel:37,torsion_sampler_helix:28,torsion_sampler_list:26,torsion_scor:37,torsionprob:26,torsionsampl:[22,24,26,27,28,31,32,34,35,37,41],torsionscor:[35,37],tort:20,total:[10,14,26,28],touch:[1,8,25,32],toward:[0,3,8,13,26,29,32,35,39,41,47,49,50,53],tpl:[0,30,31,35],tpr:[51,52],trace:35,track:[11,20,30],trade:20,trademark:20,tradition:11,trail:0,train:[24,31,35],trajectori:[28,34],tran:[22,51,52],transfer:20,transform:[9,20,22,28,34,35,52],translat:[4,8,20,26,51,52],transomegators:22,treat:[3,8,25,35,36,37,52],treatment:50,tree:[1,4,8,10,16,46,47],treepack:3,treesolv:[10,36,47],trg:[0,13,31,35],tri:[10,28,29,35,44,52],trick:[1,7,16],trigger:[1,4,8,48],tripeptid:27,tripl:11,triplet:23,trp:[51,52],trustworthi:16,tryptophan:51,ttccpsivarsnfnvcrlpgtpea:[31,35],ttccpsivarsnfnvcrlpgtpeaicatgytciiipgatcpgdyan:35,ttccpsivarsnfnvcrlpgtpeaicatytgciiipgatcpgdyan:[31,35],tupl:[9,10,11,22,25,26,28,29,33,35,36,44],turn:[0,1,11,14,16,35],tutori:8,tweak:35,twice:[14,40],two:[1,7,8,10,16,21,22,25,26,28,29,31,32,35,36,37,39,40,41,43,44,47,49,51,52],txt:[1,2,4,8,16,20],type:[0,1,8,9,10,11,13,14,20,21,22,24,25,26,27,29,31,32,33,34,35,36,37,39,40,41,43,47,48,49,50],typedef:37,typenam:37,typic:[22,28,34,47,52],tyr:[51,52],tyrosin:51,uint32_t:37,uint:37,ultra:26,uncertain:8,uncharg:50,undefin:25,under:[4,8,20],undergo:[28,32,34,36],underli:[29,31],underscor:1,understand:16,understood:0,undo:10,unexpect:2,unfavor:[22,32],unfavour:[32,34,44],unfortun:16,unhandl:[0,13],uniform:32,union:20,uniqu:[0,13,28,31,34,52],unittest:[1,8,16],unix:16,unknown:25,unless:[13,20,21,22,25,31,39,41],unlik:47,unrecognis:11,unset:[21,25,36],unsupport:[13,37],until:[8,10,32,35,40,50],untouch:22,untrack:1,unus:16,upat:5,updat:[3,5,7,8,16,21,25,29,31,32,35,36,40,42],updatedistribut:27,updateposit:[25,32],upon:[26,32,34],urei:25,urey_bradley_angl:25,usabl:16,usag:[0,3,10,13,24,26,31,32,36],use_amber_ff:35,use_bbdep_lib:36,use_frm:36,use_full_extend:35,use_scoring_extend:35,user:[1,5,8,19],userlevel:1,usr:[2,5,7,8],usual:[1,2,4,8,13,14,16,22,31,35,39],utilis:[8,16],v_size:37,val:[27,51],valid:[0,10,16,22,26,29,34,35,36,48,52],valin:51,valu:[2,10,11,13,21,22,25,26,28,31,34,35,37,39,40,41,44,47,49,51,52,53],valueerror:[28,35],vanish:40,varadarajan:38,vari:[4,37],variabl:[1,2,8,14,18,25,33,35,37],variant:[25,31],variou:[1,2,4,16,30],vec3:[9,21,22,26,32,33,43,44,49],vec3list:28,vector:[25,27,31,37],verbal:20,verbos:1,veri:[1,8,11,16,25,28,35,37],verif:13,verifi:[1,11,16],version:[2,3,5,8,16,20,26,35,37,48,51],via:[1,5,8,13,15,25],view:[13,16,27,35,40],virtual:8,visibl:36,visual:18,volum:5,wai:[1,2,4,5,8,16,22,23,25,31,41,47,51],wait:8,walk:[1,8],want:[1,2,3,7,8,15,16,22,26,28,31,32,35,40,49,50,52,53],warn:[8,16,35],warranti:20,watch:8,web:[2,8],weight:[3,26,28,31,34,35,39,41],weird:[28,32,47],well:[0,2,4,16,21,27,28,29,31,35,37,41,47,52],went:[0,8],were:[16,26,31,35],wester:38,wether:10,what:[1,8,11,13,16,23,26,40],when:[1,3,4,5,8,10,13,14,21,22,25,26,27,28,29,31,34,35,36,37,38,40,41,44,47,48,49,50,52],whenev:[8,21,31,40],where:[0,1,3,4,5,8,10,11,13,14,16,20,21,22,25,26,27,31,35,37,39,40,41,48,49,50,52],wherea:26,wherev:20,whether:[3,5,8,10,11,20,22,25,26,31,32,34,36,39,40,41,49,50,52],which:[0,1,4,8,9,11,12,13,16,18,20,21,22,25,26,27,28,29,31,32,33,34,35,36,37,39,40,41,49,50,52],whistl:8,whitespac:0,who:[10,47],whole:[1,2,8,16,20,22,26,35,49],whom:20,why:[1,16,50],width:[10,37,47],wild:4,window:28,window_length:28,wise:4,wish:[2,17,27,35],with_aa:31,with_db:31,within:[2,3,4,8,14,16,20,21,25,28,29,33,35,36,39,41,52],without:[1,4,8,11,13,20,25,29,32,35,40,52],won:[35,36,50],word:[4,7],work:[1,2,4,5,7,8,14,16,18,20,25,29,35,37],worldwid:20,worst:16,would:[1,2,8,11,22,26,27,44,49],wrap:26,wrapper:[1,4,8,15,35],write:0,writebasetyp:37,writemagicnumb:37,writetypes:37,writeversionnumb:37,written:[8,20,37],wrong:[2,13],wwpdb:5,www:20,xlabel:27,xlim:27,xml:8,xxx:[22,51],xxx_num_atom:21,xxx_num_hydrogen:21,year:1,yet:[26,31],ylabel:27,ylim:27,you:[0,1,2,3,4,5,7,8,10,11,13,14,15,16,18,20,21,22,23,25,26,27,28,30,31,32,34,35,36,37,39,40,41,47,48,49,50,52,53],your:[1,2,4,5,7],your_modul:[8,16],yourself:[2,8,10,16,35,50],yyyi:20,zero:[0,26,35,52],zhou2005:[26,38],zhou:38,zip:[26,47]},titles:["ProMod3 Actions","<code class=\"docutils literal\"><span class=\"pre\">test_actions</span></code> - Testing Actions","Building ProMod3","Changelog","ProMod3‘s Share Of CMake","Docker","ProMod3 and Containers","Singularity","Contributing","Geometry functions","Graph Minimizer","<code class=\"docutils literal\"><span class=\"pre\">helper</span></code> - Shared Functionality For the Everything","<code class=\"docutils literal\"><span class=\"pre\">core</span></code> - ProMod3 Core Functionality","<code class=\"docutils literal\"><span class=\"pre\">pm3argparse</span></code> - Parsing Command Lines","Runtime profiling","<code class=\"docutils literal\"><span class=\"pre\">SetCompoundsChemlib()</span></code>","ProMod3 Setup","Documentation For Developers","Getting Started","ProMod3","License","Handling All Atom Positions","Representing Loops","<code class=\"docutils literal\"><span class=\"pre\">loop</span></code> - Loop Handling","Loading Precomputed Objects","Generate <code class=\"docutils literal\"><span class=\"pre\">ost.mol.mm</span></code> systems","Structural Data","Sampling Dihedral Angles","Modelling Algorithms","Handling Gaps","<code class=\"docutils literal\"><span class=\"pre\">modelling</span></code> - Protein Modelling","Handling Loop Candidates","Fitting Loops Into Gaps","Model Checking","Generating Loops De Novo","Modelling Pipeline","Sidechain Reconstruction","Using Binary Files In ProMod3","References","All Atom Scorers","Backbone Score Environment","Backbone Scorers","<code class=\"docutils literal\"><span class=\"pre\">scoring</span></code> - Loop Scoring","Other Scoring Functions","Disulfid Bond Evaluation","Frame","Rotamer Graph","<code class=\"docutils literal\"><span class=\"pre\">sidechain</span></code> - Sidechain Modelling","Loading Rotamer Libraries","Rotamers","Rotamer Constructor","RotamerID","Rotamer Library","Subrotamer Optimization","Documentation For Users"],titleterms:{"class":[21,22,26,27,29,31,36,39,40,41],"default":35,"function":[4,9,11,12,29,36,40,43],acid:[21,25,27],action:[0,1,4,5,7,8],actiontestcas:1,algorithm:28,all:[21,32,39],allatomclashscor:39,allatomenv:21,allatomenvposit:21,allatominteractionscor:39,allatomoverallscor:39,allatompackingscor:39,allatomposit:21,allatomscor:39,amino:[21,25,27],angl:27,api:1,argument:13,atom:[21,32,39],backbon:[32,40,41,52],backbonelist:22,backboneoverallscor:41,backbonescor:41,backbonescoreenv:40,base:[26,39,41],binari:37,block:[28,49],bond:44,branch:16,build:[0,2,5,7,35,49],can:51,candid:31,cbetascor:41,cbpackingscor:41,ccd:32,chain:26,changelog:3,check:33,clashscor:41,closer:34,cmake:[1,2,4,16],code:37,command:13,compound:[5,7],configur:52,construct:[40,50],constructor:50,contain:6,contribut:8,conveni:40,cooler:34,core:12,creat:[1,25],data:[26,37],databas:26,defin:[26,27],definit:4,depend:[2,52],detect:33,develop:17,dihedr:27,directori:16,distinguish:21,disulfid:44,docker:5,document:[4,8,17,19,54],entri:52,environ:40,evalu:44,everyth:11,exampl:[31,37],execut:1,exisit:37,extend:29,featur:[8,26],file:[11,37],find:26,fit:32,forcefield:25,fragment:26,frame:[45,50],from:43,gap:[29,32],gener:[25,34],geometr:26,geometri:9,get:[18,51],git:16,graph:[10,46],group:49,handl:[21,23,29,31,35],have:1,hbondscor:41,header:37,helper:11,hook:16,how:[8,51],imag:[5,7],instal:2,integr:1,introduct:[4,11,13],issu:8,keep:31,kic:32,librari:[5,7,48,52],licens:[8,20],line:13,load:[24,48],lookup:25,loop:[22,23,25,31,32,34,42],loopcandid:31,mainten:4,make:[1,2],messag:11,minim:10,model:[0,18,28,30,31,33,35,47],modul:[4,8],mol:25,molprob:33,must:1,non:52,novo:[28,34],object:[24,34,45],optim:53,ost:[5,7,25],other:43,output:1,own:8,pairwis:40,pairwisescor:41,pars:13,parser:13,parti:8,particl:49,pipelin:[18,35],pm3argpars:13,portabl:37,posit:21,precomput:24,profil:14,promod3:[0,2,4,6,8,12,16,18,19,37],protein:30,psipredpredict:26,punch:33,quick:8,raw:35,reconstruct:36,reducedscor:41,refer:38,relax:32,releas:3,repres:22,residu:50,rigid:28,ring:33,rotam:[46,48,49,50,52],rotamerid:51,run:[1,2,5,7,18],runtim:14,sampl:27,sampler:[27,34],score:[31,40,42,43],scorer:[8,34,39,41],script:[1,5,7],scwrl3:43,sequenc:26,setcompoundschemlib:15,setup:16,share:[4,11],sidechain:[0,36,47],sidechainreconstructiondata:36,sidechainreconstructor:36,singular:7,smallest:49,ssagreementscor:41,stage:16,start:[8,18],step:35,structur:[16,26],subclass:1,subrotam:53,system:25,test:[1,4,8,11],test_act:1,third:8,torsion:27,torsionscor:41,track:31,triplet:27,type:52,unit:[1,4,8],user:54,write:8,your:8}}) \ No newline at end of file +Search.setIndex({envversion:47,filenames:["actions/index","actions/index_dev","buildsystem","changelog","cmake/index","container/docker","container/index","container/singularity","contributing","core/geometry","core/graph_minimizer","core/helper","core/index","core/pm3argparse","core/runtime_profiling","core/setcompoundschemlib","dev_setup","developers","gettingstarted","index","license","loop/all_atom","loop/backbone","loop/index","loop/load_loop_objects","loop/mm_system_creation","loop/structure_db","loop/torsion_sampler","modelling/algorithms","modelling/gap_handling","modelling/index","modelling/loop_candidates","modelling/loop_closing","modelling/model_checking","modelling/monte_carlo","modelling/pipeline","modelling/sidechain_reconstruction","portableIO","references","scoring/all_atom_scorers","scoring/backbone_score_env","scoring/backbone_scorers","scoring/index","scoring/other_scoring_functions","sidechain/disulfid","sidechain/frame","sidechain/graph","sidechain/index","sidechain/loading","sidechain/rotamer","sidechain/rotamer_constructor","sidechain/rotamer_id","sidechain/rotamer_lib","sidechain/subrotamer_optimizer","users"],objects:{"":{"--backbone-independent":[0,7,1,"cmdoption--backbone-independent"],"--keep-sidechains":[0,7,1,"cmdoption--keep-sidechains"],"--no-disulfids":[0,7,1,"cmdoption--no-disulfids"],"--no-subrotamer-optimization":[0,7,1,"cmdoption--no-subrotamer-optimization"],"--rigid-rotamers":[0,7,1,"cmdoption--rigid-rotamers"],"-i":[0,7,1,"cmdoption-i"],"-k":[0,7,1,"cmdoption-k"],"-n":[0,7,1,"cmdoption-n"],"-r":[0,7,1,"cmdoption-r"],"-s":[0,7,1,"cmdoption-s"],"command:add_doc_dependency":[4,0,1,""],"command:add_doc_source":[4,0,1,""],"command:convert_module_data":[4,0,1,""],"command:module":[4,0,1,""],"command:pm_action":[4,0,1,""],"command:promod3_unittest":[4,0,1,""],"command:pymod":[4,0,1,""],test_actions:[1,2,0,"-"]},"promod3.core":{ConstructAtomPos:[9,1,1,""],ConstructCBetaPos:[9,1,1,""],ConstructCTerminalOxygens:[9,1,1,""],EvaluateGromacsPosRule:[9,1,1,""],GraphMinimizer:[10,3,1,""],RotationAroundLine:[9,1,1,""],StaticRuntimeProfiler:[14,3,1,""],StemCoords:[9,3,1,""],StemPairOrientation:[9,3,1,""],helper:[11,2,0,"-"],pm3argparse:[13,2,0,"-"]},"promod3.core.GraphMinimizer":{AStarSolve:[10,4,1,""],AddEdge:[10,4,1,""],AddNode:[10,4,1,""],ApplyDEE:[10,4,1,""],ApplyEdgeDecomposition:[10,4,1,""],MCSolve:[10,4,1,""],NaiveSolve:[10,4,1,""],Prune:[10,4,1,""],Reset:[10,4,1,""],TreeSolve:[10,4,1,""]},"promod3.core.StaticRuntimeProfiler":{Clear:[14,5,1,""],IsEnabled:[14,5,1,""],PrintSummary:[14,5,1,""],Start:[14,5,1,""],StartScoped:[14,5,1,""],Stop:[14,5,1,""]},"promod3.core.StemCoords":{c_coord:[9,6,1,""],ca_coord:[9,6,1,""],n_coord:[9,6,1,""]},"promod3.core.StemPairOrientation":{angle_four:[9,6,1,""],angle_one:[9,6,1,""],angle_three:[9,6,1,""],angle_two:[9,6,1,""],distance:[9,6,1,""]},"promod3.core.helper":{FileExists:[11,1,1,""],FileExtension:[11,1,1,""],FileGzip:[11,1,1,""],MsgErrorAndExit:[11,1,1,""]},"promod3.core.pm3argparse":{PM3ArgumentParser:[13,3,1,""]},"promod3.core.pm3argparse.PM3ArgumentParser":{"__init__":[13,4,1,""],AddAlignment:[13,4,1,""],AddProfile:[13,4,1,""],AddStructure:[13,4,1,""],AssembleParser:[13,4,1,""],Parse:[13,4,1,""],action:[13,6,1,""]},"promod3.loop":{AllAtomEnv:[21,3,1,""],AllAtomEnvPositions:[21,3,1,""],AllAtomPositions:[21,3,1,""],AminoAcidAtom:[21,3,1,""],AminoAcidHydrogen:[21,3,1,""],AminoAcidLookup:[21,3,1,""],BackboneList:[22,3,1,""],CoordInfo:[26,3,1,""],ForcefieldAminoAcid:[25,3,1,""],ForcefieldBondInfo:[25,3,1,""],ForcefieldConnectivity:[25,3,1,""],ForcefieldHarmonicAngleInfo:[25,3,1,""],ForcefieldHarmonicImproperInfo:[25,3,1,""],ForcefieldLJPairInfo:[25,3,1,""],ForcefieldLookup:[25,3,1,""],ForcefieldPeriodicDihedralInfo:[25,3,1,""],ForcefieldUreyBradleyAngleInfo:[25,3,1,""],FragDB:[26,3,1,""],Fragger:[26,3,1,""],FraggerMap:[26,3,1,""],FragmentInfo:[26,3,1,""],LoadFragDB:[24,4,1,""],LoadStructureDB:[24,4,1,""],LoadTorsionSampler:[24,4,1,""],LoadTorsionSamplerCoil:[24,4,1,""],LoadTorsionSamplerExtended:[24,4,1,""],LoadTorsionSamplerHelical:[24,4,1,""],MmSystemCreator:[25,3,1,""],PsipredPrediction:[26,3,1,""],StructureDB:[26,3,1,""],StructureDBDataType:[26,3,1,""],TorsionSampler:[27,3,1,""]},"promod3.loop.AllAtomEnv":{ClearEnvironment:[21,4,1,""],GetAllAtomPositions:[21,4,1,""],GetEnvironment:[21,4,1,""],GetSeqres:[21,4,1,""],SetEnvironment:[21,4,1,""],SetInitialEnvironment:[21,4,1,""]},"promod3.loop.AllAtomEnvPositions":{all_pos:[21,6,1,""],res_indices:[21,6,1,""]},"promod3.loop.AllAtomPositions":{AllAtomPositions:[21,4,1,""],ClearPos:[21,4,1,""],ClearResidue:[21,4,1,""],Copy:[21,4,1,""],Extract:[21,4,1,""],ExtractBackbone:[21,4,1,""],GetAA:[21,4,1,""],GetFirstIndex:[21,4,1,""],GetIndex:[21,4,1,""],GetLastIndex:[21,4,1,""],GetNumAtoms:[21,4,1,""],GetNumResidues:[21,4,1,""],GetOmegaTorsion:[21,4,1,""],GetPhiTorsion:[21,4,1,""],GetPos:[21,4,1,""],GetPsiTorsion:[21,4,1,""],GetSequence:[21,4,1,""],InsertInto:[21,4,1,""],IsAllSet:[21,4,1,""],IsAnySet:[21,4,1,""],IsSet:[21,4,1,""],SetPos:[21,4,1,""],SetResidue:[21,4,1,""],ToEntity:[21,4,1,""]},"promod3.loop.AminoAcidLookup":{GetAA:[21,5,1,""],GetAAA:[21,5,1,""],GetAAH:[21,5,1,""],GetAnchorAtomIndex:[21,5,1,""],GetAtomName:[21,5,1,""],GetAtomNameAmber:[21,5,1,""],GetAtomNameCharmm:[21,5,1,""],GetElement:[21,5,1,""],GetH1Index:[21,5,1,""],GetH2Index:[21,5,1,""],GetH3Index:[21,5,1,""],GetHNIndex:[21,5,1,""],GetHydrogenIndex:[21,5,1,""],GetIndex:[21,5,1,""],GetMaxNumAtoms:[21,5,1,""],GetMaxNumHydrogens:[21,5,1,""],GetNumAtoms:[21,5,1,""],GetNumHydrogens:[21,5,1,""],GetOLC:[21,5,1,""]},"promod3.loop.BackboneList":{"__len__":[22,4,1,""],ApplyTransform:[22,4,1,""],BackboneList:[22,4,1,""],CARMSD:[22,4,1,""],Copy:[22,4,1,""],Extract:[22,4,1,""],GetAA:[22,4,1,""],GetBounds:[22,4,1,""],GetC:[22,4,1,""],GetCA:[22,4,1,""],GetCB:[22,4,1,""],GetN:[22,4,1,""],GetO:[22,4,1,""],GetOLC:[22,4,1,""],GetOmegaTorsion:[22,4,1,""],GetPhiTorsion:[22,4,1,""],GetPsiTorsion:[22,4,1,""],GetSequence:[22,4,1,""],GetTransform:[22,4,1,""],InsertInto:[22,4,1,""],MinCADistance:[22,4,1,""],RMSD:[22,4,1,""],ReconstructCBetaPositions:[22,4,1,""],ReconstructCStemOxygen:[22,4,1,""],ReconstructOxygenPositions:[22,4,1,""],ReplaceFragment:[22,4,1,""],RotateAroundOmegaTorsion:[22,4,1,""],RotateAroundPhiPsiTorsion:[22,4,1,""],RotateAroundPhiTorsion:[22,4,1,""],RotateAroundPsiTorsion:[22,4,1,""],Set:[22,4,1,""],SetAA:[22,4,1,""],SetAroundOmegaTorsion:[22,4,1,""],SetAroundPhiPsiTorsion:[22,4,1,""],SetAroundPhiTorsion:[22,4,1,""],SetAroundPsiTorsion:[22,4,1,""],SetBackrub:[22,4,1,""],SetC:[22,4,1,""],SetCA:[22,4,1,""],SetCB:[22,4,1,""],SetN:[22,4,1,""],SetO:[22,4,1,""],SetOLC:[22,4,1,""],SetSequence:[22,4,1,""],SuperposeOnto:[22,4,1,""],ToDensity:[22,4,1,""],ToEntity:[22,4,1,""],TransOmegaTorsions:[22,4,1,""],append:[22,4,1,""],clear:[22,4,1,""],empty:[22,4,1,""],resize:[22,4,1,""]},"promod3.loop.CoordInfo":{chain_name:[26,6,1,""],id:[26,6,1,""],offset:[26,6,1,""],shift:[26,6,1,""],size:[26,6,1,""],start_resnum:[26,6,1,""]},"promod3.loop.ForcefieldBondInfo":{bond_length:[25,6,1,""],force_constant:[25,6,1,""],index_one:[25,6,1,""],index_two:[25,6,1,""]},"promod3.loop.ForcefieldConnectivity":{harmonic_angles:[25,6,1,""],harmonic_bonds:[25,6,1,""],harmonic_impropers:[25,6,1,""],lj_pairs:[25,6,1,""],periodic_dihedrals:[25,6,1,""],periodic_impropers:[25,6,1,""],urey_bradley_angles:[25,6,1,""]},"promod3.loop.ForcefieldHarmonicAngleInfo":{angle:[25,6,1,""],force_constant:[25,6,1,""],index_one:[25,6,1,""],index_three:[25,6,1,""],index_two:[25,6,1,""]},"promod3.loop.ForcefieldHarmonicImproperInfo":{angle:[25,6,1,""],force_constant:[25,6,1,""],index_four:[25,6,1,""],index_one:[25,6,1,""],index_three:[25,6,1,""],index_two:[25,6,1,""]},"promod3.loop.ForcefieldLJPairInfo":{epsilon:[25,6,1,""],index_one:[25,6,1,""],index_two:[25,6,1,""],sigma:[25,6,1,""]},"promod3.loop.ForcefieldLookup":{GetAA:[25,4,1,""],GetCharges:[25,4,1,""],GetDefault:[25,5,1,""],GetDisulfidConnectivity:[25,4,1,""],GetEpsilons:[25,4,1,""],GetFudgeLJ:[25,4,1,""],GetFudgeQQ:[25,4,1,""],GetHeavyIndex:[25,4,1,""],GetHydrogenIndex:[25,4,1,""],GetInternalConnectivity:[25,4,1,""],GetMasses:[25,4,1,""],GetNumAtoms:[25,4,1,""],GetOXTIndex:[25,4,1,""],GetPeptideBoundConnectivity:[25,4,1,""],GetSigmas:[25,4,1,""],Load:[25,5,1,""],LoadCHARMM:[25,5,1,""],LoadPortable:[25,5,1,""],Save:[25,4,1,""],SavePortable:[25,4,1,""],SetCharges:[25,4,1,""],SetDefault:[25,5,1,""],SetDisulfidConnectivity:[25,4,1,""],SetEpsilons:[25,4,1,""],SetFudgeLJ:[25,4,1,""],SetFudgeQQ:[25,4,1,""],SetInternalConnectivity:[25,4,1,""],SetMasses:[25,4,1,""],SetPeptideBoundConnectivity:[25,4,1,""],SetSigmas:[25,4,1,""]},"promod3.loop.ForcefieldPeriodicDihedralInfo":{force_constant:[25,6,1,""],index_four:[25,6,1,""],index_one:[25,6,1,""],index_three:[25,6,1,""],index_two:[25,6,1,""],multiplicity:[25,6,1,""],phase:[25,6,1,""]},"promod3.loop.ForcefieldUreyBradleyAngleInfo":{angle:[25,6,1,""],angle_force_constant:[25,6,1,""],bond_force_constant:[25,6,1,""],bond_length:[25,6,1,""],index_one:[25,6,1,""],index_three:[25,6,1,""],index_two:[25,6,1,""]},"promod3.loop.FragDB":{AddFragments:[26,4,1,""],GetAngularBinSize:[26,4,1,""],GetDistBinSize:[26,4,1,""],GetNumFragments:[26,4,1,""],GetNumStemPairs:[26,4,1,""],HasFragLength:[26,4,1,""],Load:[26,5,1,""],LoadPortable:[26,5,1,""],MaxFragLength:[26,4,1,""],PrintStatistics:[26,4,1,""],Save:[26,4,1,""],SavePortable:[26,4,1,""],SearchDB:[26,4,1,""]},"promod3.loop.Fragger":{"__getitem__":[26,4,1,""],"__len__":[26,4,1,""],AddSSAgreeParameters:[26,4,1,""],AddSeqIDParameters:[26,4,1,""],AddSeqSimParameters:[26,4,1,""],AddSequenceProfileParameters:[26,4,1,""],AddStructureProfileParameters:[26,4,1,""],AddTorsionProbabilityParameters:[26,4,1,""],Fill:[26,4,1,""],GetFragmentInfo:[26,4,1,""],GetScore:[26,4,1,""]},"promod3.loop.FraggerMap":{"__getitem__":[26,4,1,""],"__setitem__":[26,4,1,""],Contains:[26,4,1,""],Load:[26,4,1,""],LoadBB:[26,4,1,""],Save:[26,4,1,""],SaveBB:[26,4,1,""]},"promod3.loop.FragmentInfo":{chain_index:[26,6,1,""],length:[26,6,1,""],offset:[26,6,1,""]},"promod3.loop.MmSystemCreator":{ExtractLoopPositions:[25,4,1,""],GetCpuPlatformSupport:[25,4,1,""],GetDisulfidBridges:[25,4,1,""],GetForcefieldAminoAcids:[25,4,1,""],GetIndexing:[25,4,1,""],GetLoopLengths:[25,4,1,""],GetLoopStartIndices:[25,4,1,""],GetNumLoopResidues:[25,4,1,""],GetNumResidues:[25,4,1,""],GetSimulation:[25,4,1,""],SetCpuPlatformSupport:[25,4,1,""],SetupSystem:[25,4,1,""],UpdatePositions:[25,4,1,""]},"promod3.loop.PsipredPrediction":{"__len__":[26,4,1,""],Add:[26,4,1,""],Extract:[26,4,1,""],FromHHM:[26,4,1,""],FromHoriz:[26,4,1,""],GetConfidence:[26,4,1,""],GetConfidences:[26,4,1,""],GetPrediction:[26,4,1,""],GetPredictions:[26,4,1,""],PsipredPrediction:[26,4,1,""]},"promod3.loop.StructureDB":{AddCoordinates:[26,4,1,""],GenerateStructureProfile:[26,4,1,""],GetBackboneList:[26,4,1,""],GetCoordIdx:[26,4,1,""],GetCoordInfo:[26,4,1,""],GetDSSPStates:[26,4,1,""],GetDihedralAngles:[26,4,1,""],GetNumCoords:[26,4,1,""],GetResidueDepths:[26,4,1,""],GetSequence:[26,4,1,""],GetSequenceProfile:[26,4,1,""],GetSolventAccessibilitites:[26,4,1,""],GetStructureProfile:[26,4,1,""],GetSubDB:[26,4,1,""],HasData:[26,4,1,""],Load:[26,5,1,""],LoadPortable:[26,5,1,""],PrintStatistics:[26,4,1,""],RemoveCoordinates:[26,4,1,""],Save:[26,4,1,""],SavePortable:[26,4,1,""],SetStructureProfile:[26,4,1,""]},"promod3.loop.TorsionSampler":{Draw:[27,4,1,""],DrawPhiGivenPsi:[27,4,1,""],DrawPsiGivenPhi:[27,4,1,""],ExtractStatistics:[27,4,1,""],GetBinSize:[27,4,1,""],GetBinsPerDimension:[27,4,1,""],GetHistogramIndex:[27,4,1,""],GetHistogramIndices:[27,4,1,""],GetPhiProbabilityGivenPsi:[27,4,1,""],GetProbability:[27,4,1,""],GetPsiProbabilityGivenPhi:[27,4,1,""],Load:[27,5,1,""],LoadPortable:[27,5,1,""],Save:[27,4,1,""],SavePortable:[27,4,1,""],UpdateDistributions:[27,4,1,""]},"promod3.modelling":{AllAtomRelaxer:[32,3,1,""],BackboneRelaxer:[32,3,1,""],BuildFromRawModel:[35,1,1,""],BuildRawModel:[35,1,1,""],BuildSidechains:[35,1,1,""],CCD:[32,3,1,""],CCDCloser:[34,3,1,""],CTerminalCloser:[34,3,1,""],CheckFinalModel:[35,1,1,""],ClearGaps:[29,1,1,""],CloseGaps:[35,1,1,""],CloseLargeDeletions:[35,1,1,""],CloseSmallDeletions:[35,1,1,""],CloserBase:[34,3,1,""],CoolerBase:[34,3,1,""],CountEnclosedGaps:[29,1,1,""],CountEnclosedInsertions:[29,1,1,""],DeNovoCloser:[34,3,1,""],DirtyCCDCloser:[34,3,1,""],ExponentialCooler:[34,3,1,""],FillLoopsByDatabase:[35,1,1,""],FillLoopsByMonteCarlo:[35,1,1,""],FilterCandidates:[33,1,1,""],FilterCandidatesWithSC:[33,1,1,""],FraggerHandle:[28,3,1,""],FragmentSampler:[34,3,1,""],FullGapExtender:[29,3,1,""],GapExtender:[29,3,1,""],GenerateDeNovoTrajectories:[28,1,1,""],GetRingPunches:[33,1,1,""],GetRings:[33,1,1,""],HasRingPunches:[33,1,1,""],InsertLoop:[35,1,1,""],InsertLoopClearGaps:[29,1,1,""],IsAllAtomScoringSetUp:[35,1,1,""],IsBackboneScoringSetUp:[35,1,1,""],KIC:[32,3,1,""],KICCloser:[34,3,1,""],LinearScorer:[34,3,1,""],LoopCandidates:[31,3,1,""],MergeGaps:[29,1,1,""],MergeGapsByDistance:[35,1,1,""],MergeMHandle:[35,1,1,""],MinimizeModelEnergy:[35,1,1,""],ModelTermini:[35,1,1,""],ModellingHandle:[35,3,1,""],NTerminalCloser:[34,3,1,""],PhiPsiSampler:[34,3,1,""],ReconstructSidechains:[36,1,1,""],RemoveTerminalGaps:[35,1,1,""],ReorderGaps:[35,1,1,""],ReportMolProbityScores:[33,1,1,""],RigidBlocks:[28,4,1,""],RunMolProbity:[33,1,1,""],RunMolProbityEntity:[33,1,1,""],SampleMonteCarlo:[34,1,1,""],SamplerBase:[34,3,1,""],ScoreContainer:[31,3,1,""],ScorerBase:[34,3,1,""],ScoringGapExtender:[29,3,1,""],ScoringWeights:[31,3,1,""],SetPsipredPredictions:[35,1,1,""],SetSequenceProfiles:[35,1,1,""],SetupDefaultAllAtomScoring:[35,1,1,""],SetupDefaultBackboneScoring:[35,1,1,""],ShiftExtension:[29,3,1,""],SidechainReconstructionData:[36,3,1,""],SidechainReconstructor:[36,3,1,""],SoftSampler:[34,3,1,""],StructuralGap:[29,3,1,""],StructuralGapList:[29,3,1,""]},"promod3.modelling.AllAtomRelaxer":{GetSystemCreator:[32,4,1,""],Run:[32,4,1,""],UpdatePositions:[32,4,1,""]},"promod3.modelling.BackboneRelaxer":{AddCARestraint:[32,4,1,""],AddCBRestraint:[32,4,1,""],AddCRestraint:[32,4,1,""],AddNRestraint:[32,4,1,""],AddORestraint:[32,4,1,""],GetNonBondedCutoff:[32,4,1,""],Run:[32,4,1,""],SetNonBondedCutoff:[32,4,1,""]},"promod3.modelling.CCD":{CCD:[32,4,1,""],Close:[32,4,1,""]},"promod3.modelling.CCDCloser":{Close:[34,4,1,""]},"promod3.modelling.CTerminalCloser":{Close:[34,4,1,""]},"promod3.modelling.CloserBase":{Close:[34,4,1,""]},"promod3.modelling.CoolerBase":{GetTemperature:[34,4,1,""],Reset:[34,4,1,""]},"promod3.modelling.DeNovoCloser":{Close:[34,4,1,""]},"promod3.modelling.DirtyCCDCloser":{Close:[34,4,1,""]},"promod3.modelling.ExponentialCooler":{GetTemperature:[34,4,1,""],Reset:[34,4,1,""]},"promod3.modelling.FraggerHandle":{Get:[28,4,1,""],GetList:[28,4,1,""],LoadCached:[28,4,1,""],SaveCached:[28,4,1,""]},"promod3.modelling.FragmentSampler":{Initialize:[34,4,1,""],ProposeStep:[34,4,1,""]},"promod3.modelling.FullGapExtender":{Extend:[29,4,1,""]},"promod3.modelling.GapExtender":{Extend:[29,4,1,""]},"promod3.modelling.KIC":{Close:[32,4,1,""],KIC:[32,4,1,""]},"promod3.modelling.KICCloser":{Close:[34,4,1,""]},"promod3.modelling.LinearScorer":{GetScore:[34,4,1,""]},"promod3.modelling.LoopCandidates":{Add:[31,4,1,""],AddFragmentInfo:[31,4,1,""],ApplyCCD:[31,4,1,""],ApplyKIC:[31,4,1,""],CalculateAllAtomScores:[31,4,1,""],CalculateBackboneScores:[31,4,1,""],CalculateSequenceProfileScores:[31,4,1,""],CalculateStemRMSDs:[31,4,1,""],CalculateStructureProfileScores:[31,4,1,""],Extract:[31,4,1,""],FillFromDatabase:[31,5,1,""],FillFromMonteCarloSampler:[31,5,1,""],GetClusteredCandidates:[31,4,1,""],GetClusters:[31,4,1,""],GetFragmentInfo:[31,4,1,""],GetLargestCluster:[31,4,1,""],GetSequence:[31,4,1,""],HasFragmentInfos:[31,4,1,""],Remove:[31,4,1,""]},"promod3.modelling.ModellingHandle":{Copy:[35,4,1,""],all_atom_scorer:[35,6,1,""],all_atom_scorer_env:[35,6,1,""],all_atom_sidechain_env:[35,6,1,""],backbone_scorer:[35,6,1,""],backbone_scorer_env:[35,6,1,""],gaps:[35,6,1,""],model:[35,6,1,""],profiles:[35,6,1,""],psipred_predictions:[35,6,1,""],seqres:[35,6,1,""],sidechain_reconstructor:[35,6,1,""]},"promod3.modelling.NTerminalCloser":{Close:[34,4,1,""]},"promod3.modelling.PhiPsiSampler":{Initialize:[34,4,1,""],ProposeStep:[34,4,1,""]},"promod3.modelling.SamplerBase":{Initialize:[34,4,1,""],ProposeStep:[34,4,1,""]},"promod3.modelling.ScoreContainer":{Contains:[31,4,1,""],Copy:[31,4,1,""],Extend:[31,4,1,""],Extract:[31,4,1,""],Get:[31,4,1,""],GetNumCandidates:[31,4,1,""],IsEmpty:[31,4,1,""],LinearCombine:[31,4,1,""],Set:[31,4,1,""]},"promod3.modelling.ScorerBase":{GetScore:[34,4,1,""]},"promod3.modelling.ScoringGapExtender":{Extend:[29,4,1,""]},"promod3.modelling.ScoringWeights":{GetAllAtomScoringKeys:[31,5,1,""],GetAllAtomWeights:[31,5,1,""],GetBackboneScoringKeys:[31,5,1,""],GetBackboneWeights:[31,5,1,""],GetSequenceProfileScoresKey:[31,5,1,""],GetStemRMSDsKey:[31,5,1,""],GetStructureProfileScoresKey:[31,5,1,""],GetWeights:[31,5,1,""],SetAllAtomScoringKeys:[31,5,1,""],SetBackboneScoringKeys:[31,5,1,""],SetSequenceProfileScoresKey:[31,5,1,""],SetStemRMSDsKey:[31,5,1,""],SetStructureProfileScoresKey:[31,5,1,""],SetWeights:[31,5,1,""]},"promod3.modelling.ShiftExtension":{Extend:[29,4,1,""]},"promod3.modelling.SidechainReconstructionData":{disulfid_bridges:[36,6,1,""],env_pos:[36,6,1,""],is_c_ter:[36,6,1,""],is_n_ter:[36,6,1,""],loop_lengths:[36,6,1,""],loop_start_indices:[36,6,1,""],rotamer_res_indices:[36,6,1,""]},"promod3.modelling.SidechainReconstructor":{AttachEnvironment:[36,4,1,""],Reconstruct:[36,4,1,""]},"promod3.modelling.SoftSampler":{Initialize:[34,4,1,""],ProposeStep:[34,4,1,""]},"promod3.modelling.StructuralGap":{Copy:[29,4,1,""],ExtendAtCTerm:[29,4,1,""],ExtendAtNTerm:[29,4,1,""],GetChain:[29,4,1,""],GetChainIndex:[29,4,1,""],GetChainName:[29,4,1,""],GetLength:[29,4,1,""],IsCTerminal:[29,4,1,""],IsNTerminal:[29,4,1,""],IsTerminal:[29,4,1,""],ShiftCTerminal:[29,4,1,""],after:[29,6,1,""],before:[29,6,1,""],full_seq:[29,6,1,""],length:[29,6,1,""],seq:[29,6,1,""]},"promod3.scoring":{AllAtomClashScorer:[39,3,1,""],AllAtomInteractionScorer:[39,3,1,""],AllAtomOverallScorer:[39,3,1,""],AllAtomPackingScorer:[39,3,1,""],AllAtomScorer:[39,3,1,""],BackboneOverallScorer:[41,3,1,""],BackboneScoreEnv:[40,3,1,""],BackboneScorer:[41,3,1,""],CBPackingScorer:[41,3,1,""],CBetaScorer:[41,3,1,""],ClashScorer:[41,3,1,""],ConstraintFunction:[40,3,1,""],ContactFunction:[40,3,1,""],DiscoContainer:[40,3,1,""],HBondScorer:[41,3,1,""],LoadAllAtomInteractionScorer:[39,1,1,""],LoadAllAtomPackingScorer:[39,1,1,""],LoadCBPackingScorer:[41,1,1,""],LoadCBetaScorer:[41,1,1,""],LoadDefaultAllAtomOverallScorer:[39,1,1,""],LoadDefaultBackboneOverallScorer:[41,1,1,""],LoadHBondScorer:[41,1,1,""],LoadReducedScorer:[41,1,1,""],LoadSSAgreementScorer:[41,1,1,""],LoadTorsionScorer:[41,1,1,""],PairwiseFunction:[40,3,1,""],PairwiseFunctionType:[40,3,1,""],PairwiseScorer:[41,3,1,""],ReducedScorer:[41,3,1,""],SCWRL3DisulfidScore:[43,4,1,""],SCWRL3PairwiseScore:[43,4,1,""],SSAgreementScorer:[41,3,1,""],TorsionScorer:[41,3,1,""]},"promod3.scoring.AllAtomClashScorer":{DoExternalScores:[39,4,1,""],DoInternalScores:[39,4,1,""],DoNormalize:[39,4,1,""]},"promod3.scoring.AllAtomInteractionScorer":{DoExternalScores:[39,4,1,""],DoInternalScores:[39,4,1,""],DoNormalize:[39,4,1,""],Load:[39,5,1,""],LoadPortable:[39,5,1,""],Save:[39,4,1,""],SavePortable:[39,4,1,""],SetEnergy:[39,4,1,""]},"promod3.scoring.AllAtomOverallScorer":{"__getitem__":[39,4,1,""],"__setitem__":[39,4,1,""],AttachEnvironment:[39,4,1,""],CalculateLinearCombination:[39,4,1,""],Contains:[39,4,1,""],Get:[39,4,1,""]},"promod3.scoring.AllAtomPackingScorer":{DoNormalize:[39,4,1,""],Load:[39,5,1,""],LoadPortable:[39,5,1,""],Save:[39,4,1,""],SavePortable:[39,4,1,""],SetEnergy:[39,4,1,""]},"promod3.scoring.AllAtomScorer":{AttachEnvironment:[39,4,1,""],CalculateScore:[39,4,1,""],CalculateScoreProfile:[39,4,1,""]},"promod3.scoring.BackboneOverallScorer":{"__getitem__":[41,4,1,""],"__setitem__":[41,4,1,""],AttachEnvironment:[41,4,1,""],Calculate:[41,4,1,""],CalculateLinearCombination:[41,4,1,""],Contains:[41,4,1,""],Get:[41,4,1,""]},"promod3.scoring.BackboneScoreEnv":{AddPairwiseFunction:[40,4,1,""],ApplyPairwiseFunction:[40,4,1,""],ClearEnvironment:[40,4,1,""],Copy:[40,4,1,""],GetSeqres:[40,4,1,""],Pop:[40,4,1,""],SetEnvironment:[40,4,1,""],SetInitialEnvironment:[40,4,1,""],SetPsipredPrediction:[40,4,1,""],Stash:[40,4,1,""]},"promod3.scoring.BackboneScorer":{AttachEnvironment:[41,4,1,""],CalculateScore:[41,4,1,""],CalculateScoreProfile:[41,4,1,""]},"promod3.scoring.CBPackingScorer":{DoNormalize:[41,4,1,""],Load:[41,5,1,""],LoadPortable:[41,5,1,""],Save:[41,4,1,""],SavePortable:[41,4,1,""],SetEnergy:[41,4,1,""]},"promod3.scoring.CBetaScorer":{DoExternalScores:[41,4,1,""],DoInternalScores:[41,4,1,""],DoNormalize:[41,4,1,""],Load:[41,5,1,""],LoadPortable:[41,5,1,""],Save:[41,4,1,""],SavePortable:[41,4,1,""],SetEnergy:[41,4,1,""]},"promod3.scoring.ClashScorer":{DoExternalScores:[41,4,1,""],DoInternalScores:[41,4,1,""],DoNormalize:[41,4,1,""]},"promod3.scoring.DiscoContainer":{AddStructuralInfo:[40,1,1,""],AttachConstraints:[40,1,1,""]},"promod3.scoring.HBondScorer":{DoExternalScores:[41,4,1,""],DoInternalScores:[41,4,1,""],DoNormalize:[41,4,1,""],Load:[41,5,1,""],LoadPortable:[41,5,1,""],Save:[41,4,1,""],SavePortable:[41,4,1,""],SetEnergy:[41,4,1,""]},"promod3.scoring.PairwiseFunction":{Score:[40,4,1,""]},"promod3.scoring.PairwiseScorer":{DoExternalScores:[41,4,1,""],DoInternalScores:[41,4,1,""],DoNormalize:[41,4,1,""]},"promod3.scoring.ReducedScorer":{DoExternalScores:[41,4,1,""],DoInternalScores:[41,4,1,""],DoNormalize:[41,4,1,""],Load:[41,5,1,""],LoadPortable:[41,5,1,""],Save:[41,4,1,""],SavePortable:[41,4,1,""],SetEnergy:[41,4,1,""]},"promod3.scoring.SSAgreementScorer":{DoNormalize:[41,4,1,""],Load:[41,5,1,""],LoadPortable:[41,5,1,""],Save:[41,4,1,""],SavePortable:[41,4,1,""],SetScore:[41,4,1,""]},"promod3.scoring.TorsionScorer":{DoNormalize:[41,4,1,""],Load:[41,5,1,""],LoadPortable:[41,5,1,""],Save:[41,4,1,""],SavePortable:[41,4,1,""],SetEnergy:[41,4,1,""]},"promod3.sidechain":{AAToRotID:[51,4,1,""],BBDepRotamerLib:[52,3,1,""],DihedralConfiguration:[52,3,1,""],DisulfidScore:[44,4,1,""],FRMRotamer:[49,3,1,""],FRMRotamerGroup:[49,3,1,""],Frame:[45,3,1,""],FrameResidue:[45,3,1,""],GetDihedralConfiguration:[52,4,1,""],GetRotamericConfiguration:[52,4,1,""],LoadBBDepLib:[48,4,1,""],LoadLib:[48,4,1,""],Particle:[49,3,1,""],RRMRotamer:[49,3,1,""],RRMRotamerGroup:[49,3,1,""],ReadDunbrackFile:[48,4,1,""],ResolveCysteins:[44,4,1,""],RotamerGraph:[46,3,1,""],RotamerID:[51,3,1,""],RotamerLib:[52,3,1,""],RotamerLibEntry:[52,3,1,""],SCWRLRotamerConstructor:[50,3,1,""],SidechainParticle:[49,3,1,""],SubrotamerOptimizer:[53,4,1,""],TLCToRotID:[51,4,1,""]},"promod3.sidechain.BBDepRotamerLib":{AddRotamer:[52,4,1,""],Load:[52,5,1,""],LoadPortable:[52,5,1,""],MakeStatic:[52,4,1,""],QueryLib:[52,4,1,""],Save:[52,4,1,""],SavePortable:[52,4,1,""],SetInterpolate:[52,4,1,""]},"promod3.sidechain.FRMRotamer":{"__getitem__":[49,4,1,""],"__len__":[49,4,1,""],AddFrameEnergy:[49,4,1,""],AddSubrotamerDefinition:[49,4,1,""],ApplyOnResidue:[49,4,1,""],GetActiveSubrotamer:[49,4,1,""],GetFrameEnergy:[49,4,1,""],GetInternalEnergy:[49,4,1,""],GetInternalEnergyPrefactor:[49,4,1,""],GetNumSubrotamers:[49,4,1,""],GetProbability:[49,4,1,""],GetSelfEnergy:[49,4,1,""],GetSubrotamerDefinition:[49,4,1,""],GetTemperature:[49,4,1,""],SetActiveSubrotamer:[49,4,1,""],SetFrameEnergy:[49,4,1,""],SetInternalEnergy:[49,4,1,""],SetInternalEnergyPrefactor:[49,4,1,""],SetProbability:[49,4,1,""],SetTemperature:[49,4,1,""],ToFrameResidue:[49,4,1,""],ToRRMRotamer:[49,4,1,""]},"promod3.sidechain.FRMRotamerGroup":{"__getitem__":[49,4,1,""],"__len__":[49,4,1,""],AddFrameEnergy:[49,4,1,""],ApplyOnResidue:[49,4,1,""],ApplySelfEnergyThresh:[49,4,1,""],Merge:[49,4,1,""],SetFrameEnergy:[49,4,1,""]},"promod3.sidechain.FrameResidue":{"__getitem__":[45,4,1,""],"__len__":[45,4,1,""]},"promod3.sidechain.Particle":{AddLonePair:[49,4,1,""],GetCharge:[49,4,1,""],GetName:[49,4,1,""],GetParticleType:[49,4,1,""],GetPos:[49,4,1,""],IsHBondAcceptor:[49,4,1,""],IsHBondDonor:[49,4,1,""],PairwiseEnergy:[49,4,1,""],SetPolarDirection:[49,4,1,""]},"promod3.sidechain.RRMRotamer":{"__getitem__":[49,4,1,""],"__len__":[49,4,1,""],AddFrameEnergy:[49,4,1,""],ApplyOnResidue:[49,4,1,""],GetFrameEnergy:[49,4,1,""],GetInternalEnergy:[49,4,1,""],GetInternalEnergyPrefactor:[49,4,1,""],GetProbability:[49,4,1,""],GetSelfEnergy:[49,4,1,""],SetFrameEnergy:[49,4,1,""],SetInternalEnergy:[49,4,1,""],SetInternalEnergyPrefactor:[49,4,1,""],SetProbability:[49,4,1,""],ToFrameResidue:[49,4,1,""]},"promod3.sidechain.RRMRotamerGroup":{"__getitem__":[49,4,1,""],"__len__":[49,4,1,""],AddFrameEnergy:[49,4,1,""],ApplyOnResidue:[49,4,1,""],ApplySelfEnergyThresh:[49,4,1,""],Merge:[49,4,1,""],SetFrameEnergy:[49,4,1,""]},"promod3.sidechain.RotamerGraph":{CreateFromFRMList:[46,5,1,""],CreateFromRRMList:[46,5,1,""]},"promod3.sidechain.RotamerLib":{AddRotamer:[52,4,1,""],Load:[52,5,1,""],LoadPortable:[52,5,1,""],MakeStatic:[52,4,1,""],QueryLib:[52,4,1,""],Save:[52,4,1,""],SavePortable:[52,4,1,""]},"promod3.sidechain.RotamerLibEntry":{FromResidue:[52,5,1,""],IsSimilar:[52,4,1,""],SimilarDihedral:[52,4,1,""],chi1:[52,6,1,""],chi2:[52,6,1,""],chi3:[52,6,1,""],chi4:[52,6,1,""],probability:[52,6,1,""],sig1:[52,6,1,""],sig2:[52,6,1,""],sig3:[52,6,1,""],sig4:[52,6,1,""]},"promod3.sidechain.SCWRLRotamerConstructor":{AssignInternalEnergies:[50,4,1,""],ConstructBackboneFrameResidue:[50,4,1,""],ConstructFrameResidue:[50,4,1,""],ConstructFrameResidueHeuristic:[50,4,1,""],ConstructRRMRotamerGroup:[50,4,1,""],ConstructSidechainFrameResidue:[50,4,1,""]},"test_actions.ActionTestCase":{RunAction:[1,4,1,""],RunExitStatusTest:[1,4,1,""],pm_action:[1,6,1,""],pm_bin:[1,6,1,""],testPMExists:[1,4,1,""]},promod3:{SetCompoundsChemlib:[15,1,1,""],core:[12,2,0,"-"],loop:[23,2,0,"-"],modelling:[30,2,0,"-"],scoring:[42,2,0,"-"],sidechain:[47,2,0,"-"]},test_actions:{ActionTestCase:[1,3,1,""]}},objnames:{"0":["cmake","command","CMake command"],"1":["py","function","Python function"],"2":["py","module","Python module"],"3":["py","class","Python class"],"4":["py","method","Python method"],"5":["py","staticmethod","Python static method"],"6":["py","attribute","Python attribute"],"7":["std","option","option"]},objtypes:{"0":"cmake:command","1":"py:function","2":"py:module","3":"py:class","4":"py:method","5":"py:staticmethod","6":"py:attribute","7":"std:option"},terms:{"10a":36,"1aki":26,"1crn":[21,23,25,26,30,31,32,34,35,36,42,47],"1crn_cut":[30,31,35],"1crna":[26,31],"1ey":8,"1eye_rec":8,"20a":36,"2b1":[],"2jlp":0,"30a":36,"3x3":9,"655a":26,"__doc__":[11,13],"__getitem__":[26,39,41,45,49],"__init__":[1,8,13,16],"__len__":[22,26,45,49],"__main__":[1,8],"__name__":[1,8],"__setitem__":[26,39,41],"_data":37,"_name":4,"_run":[1,4],"_xml":4,"abstract":34,"boolean":11,"break":[4,8,16],"byte":[10,37],"case":[0,1,5,8,13,16,22,26,27,29,32,34,35,36,37,41,44,47,49,50,52],"catch":26,"char":[22,37],"class":[1,5,8,9,10,12,13,14,17,20],"const":37,"default":[0,1,4,5,8,10,13,14,15,18,21,22,25,26,27,28,30,31,32,34],"enum":[26,51],"export":[8,21],"final":[8,18,26,28,30,31,35,40,42,44,46,47,49],"float":[9,10,21,22,25,26,27,28,29,31,32,33,34,35,36,37,39,40,41,43,44,49,50,52,53],"function":[1,3],"import":[0,1,5,8,11,13,16,18,20,21,22,23,25,26,27,30,31,32,34,35,36,42,47,49,50],"int":[1,9,10,11,14,21,22,24,25,26,27,28,29,31,32,33,34,35,36,37,39,40,41,45,49,50,52,53],"long":35,"new":[1,3,7,8,13,16,17,21,22,25,26,29,31,32,34,35,36,37,47,49],"null":26,"public":[8,37],"return":[1,8,9,10,11,13,14,15,21,22,24,25,26,27,28,29,31,32,33,34,35,36,37,39,40,41,43,44,45,48,49,50,51,52],"s\u00f6ding":38,"short":[8,16,37],"static":[8,14,21,25,26,27,31,36,37,39,41,46,48,52],"super":47,"switch":[8,16,40],"throw":[1,37,47,48],"true":[1,11,13,14,21,22,23,25,26,29,31,32,33,34,35,36,37,39,41,44,47,50],"try":[1,8,18,29,35,37,52],"void":37,"while":[1,4,8,14,20,21,25,35,37],a3m:[0,13],a3mtoprofil:[0,13],aa1:41,aa2:41,aa_aft:26,aa_befor:26,aa_clash:[35,39],aa_interact:[35,39],aa_pack:[35,39],aa_packing_scor:37,aa_relax_test:32,aa_res_idx:50,aa_scor:37,aa_with_rotam:47,aaa1:39,aaa2:39,aaa:[21,39],aaaaaaaa:22,aaaaggggggggggggggggggggaaaaaa:35,aafrequ:26,aafrequenciesstruct:26,aah:21,aatorotid:51,abcdefghijklmnopqrstuvwxyz0123456789abcdefghijklmnopqrstuvwxyz:35,abil:16,abl:[2,8],abort:[8,10,32,35],about:[1,4,8,10,26,35],abov:[0,1,5,8,13,16,20,22,29,31,35,37,51,52],absolut:[4,5,34],academ:8,accept:[10,13,20,31,32,34,35,36,37],acceptor:[41,50],access:[4,5,8,21,22,26,27,31,35,39,40,41,49,51],accessor:26,accord:[5,10,16,21,22,25,26,27,28,29,31,34,35,36,39,44,47,49,50,52],accordingli:[26,40],accur:28,accuraci:28,achiev:[10,16],acknowledg:8,across:[1,52],act:[20,32],acta:38,action_nam:16,action_unit_test:1,actiontest:1,activ:[13,14,16,44,49,53],active_internal_energi:53,actual:[3,8,13,16,22,26,34,35,36,40,41,42,49,50,52],actual_posit:34,actual_step:34,adapt:[8,25,26,32,34,35,38],add:[1,2,4,6,8,10,13,18,20,21,26,27,31,32,35,36,39,40,41,44,47,49,50],add_argu:11,add_custom_target:8,add_doc_depend:4,add_doc_sourc:[4,8],add_subdirectori:8,addalign:13,addcarestraint:32,addcbrestraint:32,addcoordin:26,addcrestraint:32,addedg:10,addendum:20,addfrag:26,addfragmentinfo:31,addframeenergi:49,addharmonicangl:25,addharmonicbond:25,addharmonicimprop:25,addit:[4,11,13,14,16,20,22,23,25,26,33,35,37,50],addition:[1,4,16,21,25,26,50],addljpair:25,addlonepair:49,addnod:10,addnrestraint:32,addorestraint:32,addpairwisefunct:40,addperiodicdihedr:25,addperiodicimprop:25,addprofil:13,address:37,addrotam:52,addseqidparamet:26,addseqsimparamet:[23,26],addsequenceprofileparamet:26,addssagreeparamet:26,addstructur:13,addstructuralinfo:40,addstructureprofileparamet:26,addsubrotamerdefinit:49,addtorsionprobabilityparamet:26,addureybradleyangl:25,admir:8,advanc:28,advantag:25,advic:[8,16],advis:20,affect:[8,22,50,51],after:[1,2,4,5,8,10,13,16,21,22,25,26,27,29,31,32,34,35,37,40,52],after_c_stem:22,afterward:[8,26,35],again:[2,3,8,26,28],against:[20,39],agg:27,agglom:31,ago:1,agre:20,agreement:[20,26,28,41],agress:[2,10],aim:19,ala:[22,27,32,47,50,51,52],ala_cb:21,ala_h1:21,ala_h:21,alanin:[3,51],alg:[23,26,35],algorithm:[3,10,22,23,26],alia:29,align:[0,13,18,26,28,30,35,38,40],alignedcuboid:22,alignmenthandl:[28,35,40],alignmentlist:[0,13,35],all:[0,1,3,4,8,10,13,14,16,18,20],all_atom:[21,22,25,49,50],all_atom_env:21,all_atom_po:[21,50],all_atom_scor:35,all_atom_scorer_env:35,all_atom_sidechain_env:35,all_po:[21,25,32],all_scor:31,allatom:[32,35,36],allatomclashscor:35,allatominteractionscor:[35,37],allatomoverallscor:[31,35],allatompackingscor:[35,37],allatomrelax:[25,32],alleg:20,alloc:26,allow:[0,2,3,5,8,11,16,22,26,27,28,31,34,35,37,39,41,46,52],allow_multitempl:13,allow_prepro_ci:22,almost:[4,32],aln:[0,28,30,31,35,40],aln_sourc:13,alon:[11,20],along:[1,8,20],alongsid:20,alot:8,alpha:[9,22,41,47],alpha_bin:41,alreadi:[1,4,8,10,16,22,25,26,28,31,35,36,39,40,41,49,50,52,53],also:[1,2,4,8,11,16,20,26,27,28,31,32,33,34,35,36,44,45,46,50,52],alter:[31,34],altern:[4,5,8,31,34,35,48,50],alwai:[0,1,7,8,16,29,34,35,37],amber:[21,35],ambig:52,ambigu:[0,13,52],aminoacid:[21,22,25,27,41,51,52],aminoacidatom:[21,39],aminoacidhydrogen:21,aminoacidlookup:[21,25],among:31,amount:[18,28,52],analysi:[32,33,38],analyt:[31,52],anchor:[9,21],ancient:15,angl:[9,21,22,23,25,26],angle_bin:41,angle_bin_s:26,angle_force_const:25,angle_four:9,angle_on:9,angle_thre:9,angle_two:9,angstrom:[26,32],ani:[0,1,4,5,8,10,13,14,15,18,20,21,22,25,26,27,29,31,33,34,35,36,37,39,40,41,45,47,49,50],anneal:[10,31,34],annot:20,announc:[1,8],anoth:[4,14,22,29,32,35,36,44],anymor:[3,10],anyon:[8,16],anyth:[0,2,5,8,13,14,15,31,32,36,39,41],anywai:8,anywher:16,apach:[3,20],apart:[1,31,35,36,39,41],app:7,appear:20,append:[0,13,22,26,27,35,47],appendix:20,appli:[3,7,10,11,15,16,20,22,26,29,31,32,34,35,36,38,40,44,47,49,52],applic:[1,20,32,50],applyccd:31,applyde:10,applyedgedecomposit:10,applyk:31,applyonresidu:[47,49],applypairwisefunct:[40,41],applysd:25,applyselfenergythresh:[47,49],applytransform:22,approach:[0,2,10,26,28,35,37,44,47,50],appropri:[10,20,27,35,37,50],approx:35,approxim:[25,49],arbitrari:[3,21,26,44],arbitrarili:34,archiv:20,arendal:38,arg:[1,4,13,51],arg_ca:21,arg_hd3:21,arg_sorted_scor:31,arginin:51,argpars:13,argument:[0,1,4,11,12],argumentpars:13,argv:13,aris:20,around:[1,4,8,9,16,22,31,32,35,39,40,41,52],arrai:[0,8,37],artifici:26,ascend:29,ask:8,asn:[51,52],asn_c:21,asn_hb2:21,asp:[21,49,51,52],asp_ha:21,asp_o:21,asparagin:51,aspart:[51,52],ass:34,assembl:13,assemblepars:13,assert:20,assertequ:8,assess:[39,40],assign:[3,10,22,26,31,34,39,41,50,53],assigninternalenergi:50,assignsecstruct:35,associ:[20,26,29,45],assum:[1,4,5,7,8,20,25,26,32,35,37,40,41,44],assur:44,astar:3,astarsolv:10,atom:[3,8,9],atom_idx:[21,25],atom_nam:[21,25],atomhandl:49,attach:[0,4,8,13,20,21,25,28,29,31,35,36,39,40,41,42],attach_view:13,attachconstraint:40,attachenviron:[31,32,34,36,39,41,42],attachview:[30,31,35],attent:[1,16],attribut:[8,13,20,26,35,36,52],author:20,authorship:20,autom:[2,4],automat:[1,8,10,11,14,16,26,30,31,37,52],automatis:8,avaibl:50,avail:[1,2,3,5,7,8,15,16,18,20,25,26,31,34,40,47],availab:20,availabl:8,averag:[31,40,44],avg:26,avg_sampling_per_posit:28,avoid:[0,3,6,11,13,15,26,32,34],awai:[16,36,49],awar:[8,50],awesom:[1,8],axi:[9,22],back:[1,16,25,34],backbon:[0,3,9,18,21,22,26,27,28,29,30,31],backbone_scor:35,backbone_scorer_env:35,backbonelist:[18,21],backboneoverallscor:[28,31,34,35],backbonerelax:[32,35],backbonescor:8,backbonescoreenv:[8,28,31,34,35],backbonescoreenvlisten:8,background:[2,36],backrub:[22,38],backward:37,bad:25,base:[0,3,4,5,9,11,13,20,22,23],base_target:4,bashrc:8,basi:[4,8,16,20,32,34,48,49],basic:[1,2,8,11,16,27,34,35,47,49,52],bb_dep_lib:37,bb_list:[18,21,22,23,26,29,31,32,34,35,40],bb_list_on:28,bb_list_two:28,bb_score:31,bbdeprotamerlib:[35,36,37,48,50,52],becaus:[8,16,21,35,40],becom:[10,52],been:[2,3,10,16,20,24,26,31,32,35,39,41,44,52],befor:[0,1,4,7,8,13,16,22,25,26,27,29,31,32,34,35,36,37],begin:[1,8,21,22,34,40],behalf:20,behav:[1,52],behaviour:[0,13,39,40,52],behind:8,bell:8,belong:[3,4,16,21,22,26,29,31,34,35,36,39,40,41,45,49,50],belov:26,below:[0,8,20,21,25,26,28,31,32,36,37,39,41,44],below_thre:26,benefici:20,besid:[2,4,10,13,26],best:[4,7,31,35,44],best_candid:31,beta:[9,22,33,41],beta_bin:41,better:[25,31,34,35,39,41],between:[1,3,10,13,22,25,26,28,29,31,32,34,35,36,37,39,40,41,42,43,44,45,49,50,52],beyond:13,biasini2013:[19,38],biasini:38,bienert:38,big:[25,37],bilinearli:52,bin:[1,8,16,18,26,27,39,41,52],bin_siz:52,binari:[1,4,8,16,17,25,26,27],bind:[0,13,20],bins_per_dimens:27,bioinformat:38,biol:38,biologi:[19,38],biophi:38,biopolym:38,bit:[1,8,16,31,35],bitwis:26,blank:8,block:3,blosum62:[23,26,28,40],boilerpl:20,bond:[0,3,9,22,25,26,32,33,36,38,41],bond_force_const:25,bond_length:[9,25],bool:[1,8,10,11,13,14,21,22,25,26,29,31,32,33,34,35,36,37,39,41,44,49,50,52],boost:[0,1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43,44,45,46,47,48,49,50,51,52,53,54],boost_librari:4,boost_root:2,bootstrap:[6,7],bore:34,both:[3,21,26,29,35,44,47,52],bound:[21,25,28,31,49],bracket:20,bradlei:25,branch:[4,8],branchnam:16,brew:4,bridg:[24,25,32,35,36],briefli:16,bring:8,broken:1,broyden:35,bsd:20,bug:[3,8,16],build_disulfid:36,builder:2,buildfromrawmodel:[30,35],buildrawmodel:[0,30,31,35],buildsidechain:35,buildup:[47,49],built:[4,7,25,26,40,45,50],bunch:[1,13,16],bundl:20,bytecod:1,c_coord:9,c_num:29,c_po:[9,22,41],c_stem:[9,23,26,29,31,32,34],c_stem_psi:34,c_str:37,c_ter:[32,50],ca_coord:9,ca_pairwise_funct:40,ca_po:[9,22],ca_pos_on:[43,44],ca_pos_two:[43,44],ca_posit:44,ca_rmsd:[23,26],cach:[2,26,28],calcul:[8,22,26,27,28,31,32,34,39,40,41,42,44,45,46,47,49,50],calculateallatomscor:31,calculatebackbonescor:31,calculatelinearcombin:[31,34,39,41],calculatescor:[39,41,42],calculatescoreprofil:[39,41],calculatesequenceprofilescor:31,calculatestemrmsd:31,calculatestructureprofilescor:31,call:[1,2,4,8,11,13,14,15,16,21,25,26,27,29,31,34,35,36,37,39,40,41,49,50,52],callabl:[13,16],calpha:35,calul:27,came:8,can:[0,1,3,4,5,7,8,9,10,11,13,14,15,16,18,21,22,23,25,26,27,28,29,30,31,32,34,35,36,37,39,40,41,42,44,45,46,47,48,49,50],cand:35,candid:[3,30],cannot:[0,8,13,20,25,26,27,29,35,37,39,41,48,51,52],canutescu2003:[32,38],canutescu2003b:[38,39,41,43,44],canutescu:38,cap:10,capabl:[24,30,34],captur:1,carbon:[9,22,43,49,50],carbonyl:[49,50],care:[0,8,10,31,32,35,37,41],carlo:[3,10,28,31,34,35,46],carmsd:[22,23,26],carri:[8,11,20],cast:37,categori:4,caus:[16,20,33],caution:21,caviti:26,cb_in_sidechain:50,cb_pack:[28,35,41],cb_packing_scor:37,cb_pairwise_funct:40,cb_po:22,cb_pos_on:[43,44],cb_pos_two:[43,44],cb_posit:44,cbeta:[28,31,34,35,41,42],cbeta_scor:[37,42],cbetaenvlisten:8,cbetascor:[8,35,37],cbpackingscor:[8,35,37],ccd:[3,30,31],ccdcloser:34,center:33,central:[22,27,41],centroid:31,certain:[1,2,4,8,10,16,26,27,28,29,35,37,39,40,41],certainli:1,ch1particl:49,ch2particl:49,ch3particl:49,ch_name:26,chain:[0,8,13,21,22,23,24],chain_idx:[8,21,31,34,35,36,39,40,41],chain_idx_list:36,chain_idx_on:40,chain_idx_two:40,chain_index:[26,34,39],chain_indic:40,chain_nam:[26,35],chainhandl:[21,22,29],chainid:0,chakravarti:38,chakravarty1999:[26,38],chanact:35,chanc:[8,10,35],chang:[1,3,4,5,8,10,16,20,21,27,28,29,32,34,35,36,39],change_frequ:[10,34],chapter:[29,33],charact:[13,20],charg:[8,20,21,25,32,49,50],charmm:[21,25,35],check:[0,1,3,5,8,11,13,14,16,22,25,26,30,32],check_io:37,check_xml:8,checkbasetyp:37,checkfinalmodel:35,checkmagicnumb:37,checkout:[8,16],checktypes:37,chemdict_tool:[5,7],chemic:[5,15,21,39],chemistri:38,chemlib:[5,7],chi1:52,chi2:52,chi3:52,chi4:52,chi:52,child:13,childclass:1,chmod:8,choos:[20,31,34],chose:5,chosen:[0,13,34,35],cif:[0,5,7,13],ciiipgatcpgdyan:35,circumv:50,claim:20,clash:[3,28,31,32,34,35,39,41,42,44,47],clash_scor:42,clash_thresh:35,clashscor:[31,33,34,35],classic:48,claus:20,clean:[2,8,16],cleanli:37,clear:[14,21,22,31,35,40],clearenviron:[21,40],cleargap:29,clearpo:21,clearresidu:21,clip:13,clone:8,close:[16,18,22,26,31,32,34,35,36,44],closed_posit:34,closegap:35,closelargedelet:35,closer:[3,26,30,31],closerbas:34,closesmalldelet:[32,35],closur:[32,35,38],clustal:[0,13],cluster:[3,31,37,40],cluster_thresh:[28,40],clutter:[1,8,26],cmake:0,cmake_support:[4,8,16,20],cmakecach:2,cmakelist:[1,2,4,8,16],coars:8,code:[0,1,3,4,5,6,7,8,11,13,14,15,16,17,20,21,22,26,27,33,35],codetest:[4,8],coil:[24,28],collect:[11,14,21,28,40],column:[26,28],combin:[20,25,26,27,28,31,34,35,38,39,41,44,52],come:[1,4,8,11,13,35,36,42,46,52],command:[0,1,7,8,11,12],commandlin:13,comment:[16,20],commerci:[8,20],commit:[8,16],common:[8,13,20,28],commonli:[8,18,30,31,41],commun:20,comp_lib:50,compar:[3,8,22,23,26,31,32,52],comparison:[35,38,52],compat:[16,25,37],compensatori:22,compil:[1,2,4,8,14,16,18,20,37,54],complain:1,complaint:16,complet:[14,16,22,25,32,34,35,36,52],complex:[8,16,36,44,49,53],compli:20,complianc:20,complib_dir_contain:[5,7],complib_dir_localhost:[5,7],compon:[5,7,10,15,26,33,41],compoundlib:[5,50],compress:[11,26],comput:[3,8,19,20,31,33,38,39,41],concaten:21,concept:8,concern:8,condit:[8,20,27],conf:[2,8],confid:[26,41],config:[4,8],config_head:4,configur:[8,10,16,20,31,47],conflict:16,conform:[26,32,34,38,46,52],connect:[4,5,10,16,21,25,26,31],connectivi:5,conop:[5,21,22,25,27,41,50,51],conquer:8,consecut:[26,27,41],consequenti:20,conserv:[18,29],consid:[0,4,8,10,13,14,16,21,22,26,27,28,31,32,34,35,36,39,40,41,44,47,50,52],consider_all_nod:10,consider_hydrogen:49,consider_ligand:36,consist:[3,8,20,21,25,28,29,31,32,34,35,36,37,40,44,49,52],conspicu:20,constant:[3,25,32,39,41,53],constitut:20,constraint:[13,26,32,34,40],constraintfunct:40,constru:20,construct:[0,9,21,22,26,28,29,34,37],constructatompo:9,constructbackboneframeresidu:[47,50],constructcbetapo:9,constructcterminaloxygen:9,constructetd:10,constructframeresidu:50,constructframeresidueheurist:50,constructfrmrotamergroup:[47,50],constructor:[21,25,29,32,34,37,40,41,47,49],constructrrmrotamergroup:50,constructsidechainframeresidu:50,contact:40,contactfunct:40,contain:[0,1,3,4,5],content:[8,12,17,20,23,26,42,47,54],contigu:[25,36,37],continu:[1,21,29,32,47],contract:20,contrast:45,contribut:4,contributor:20,contributori:20,control:[0,3,8,10,20,31,34,36,40,49,50,52,53],conveni:[1,7,8,18,28,31,34,35],convent:[1,51],converg:[28,31,32,34],convers:[20,37],convert:[4,5,22,25,26,27,35,37,39,41,52,53],convert_module_data:4,convertbasetyp:37,cooler:[3,30,31],coolerbas:34,cooling_factor:[10,34],coord:[26,31],coord_idx:26,coord_info:26,coordin:[3,9,26,31,32,34,35,38,39,47],coordinfo:26,cope:16,copi:[2,3,4,8,16,18,20,21,22,29,31,34,35,40],copyright:20,copyright_cmak:20,core:[0,8,9,10,11],correct:[5,25],correctli:35,correspond:[0,10,16,21,22,25,26,27,31,37,52],corrupt:[21,40],cotain:26,could:[1,4,5,8,13,16,25,26,35],count:[14,29,34,35,39,41],countenclosedgap:29,countenclosedinsert:29,counter:34,counterclaim:20,counterpart:[31,41,50],coupl:[1,8,16,35],cours:8,coutsia:38,coutsias2005:[32,38],cover:[1,8,12,13,14,21,25,26,28,30,34],coverag:35,cparticl:49,cpp:4,cpr:[51,52],cpu:[18,25,35],cpu_platform_support:25,crambin:[26,31,34],crash:47,createalign:[31,35],createentityfromview:[36,47],createfromfrmlist:[46,47],createfromrrmlist:46,createfullview:[30,31,35],createsequ:[26,31,35],creation:[25,32],creator:[25,32],criteria:36,criterion:[10,34],criterium:31,croak:16,cross:20,crucial:8,cryst:38,cterminalclos:34,cumul:50,current:[2,4,5,8,10,14,16,21,22,25,26,31,34,35,37,40,41,42,49,50,53],custom:[8,26,34,35,36,37,48,51],customari:20,cutoff:[24,25,31,32,36,39,41],cycl:29,cyclic:[31,32,38],cyd:[51,52],cyh:[51,52],cys_hb3:21,cys_sg:21,cystein:[25,36,44,47,51],d_bin:41,dai:11,damag:20,dampen:25,danc:38,dare:4,dat:[26,37],data1:4,data2:4,data:[0,1,3,4,8,16,17,21,23,24,25],data_:37,data_gener:[3,37,48],data_to_stor:26,data_typ:26,databas:[0,9,23,24],databs:26,datatyp:26,date:[5,7,16,20],davi:38,davis2006:[22,38],dbg:8,dcmake_install_prefix:2,deactiv:10,dead:[10,38],deal:[35,36],debug:[8,10,21],decent:15,decid:[3,8,32],decis:27,declar:[4,8,16],decod:13,decompos:[3,10],decomposit:[10,28,46],decreas:34,dedic:[4,8,16],dee:10,deep:[22,35],def:[1,8,21,35],def_angl:21,defend:20,defin:[1,4,8,9,13,14,15,20,21,22,23,24,25],definem:8,degre:[22,26,27],delet:[0,2,8,22,35,49],deliber:20,deliv:[1,26,34,35],delta_scor:34,demand:35,demonstr:26,denovoclos:34,densiti:[22,32,38],dep1:4,dep2:4,dep:4,depend:0,dependency1:4,dependency2:4,depends_on:4,depth:[26,38],deriv:[1,20,26,38,43,44],descend:35,descent:[31,32,38],describ:[4,7,10,11,17,20,21,22,26,29,30,32,33,37,39,41,44,47,48,49,52,54],descript:[0,5,13,16,20,34,52],descriptor:26,descsrib:10,design:[1,3,19,20],desir:[9,18,25,31,32,34,35,39,40,41],despit:3,detail:[0,9,13,16,20,25,26,27,31,33,34,35,39,41,48,52],detect:[0,11,28,30],determin:[8,11,20,25,26,31,34,40,41],determinist:28,deuterium:35,develop:[1,3,8,16],deviat:[22,33,34,52],devot:12,dict:[4,28,31,33,34,39,41],dictionari:[4,5,13,15,33,38],did:[8,26,31,35],didn:7,didnt:5,differ:[1,2,4,7,8,10,15,16,20,21,26,28,29,31,35,39,41,47,51,52],dihedr:[9,18,22,23,25,26],dihedral_angl:22,dihedral_bin:41,dihedral_idx:52,dihedral_pair:27,dihedralconfigur:52,dill:38,dimens:27,dir:[4,8],direct:[8,20,22,24,26,41,49,50],directli:[8,10,26,31,35,36,40,44,49,51,52],directori:[1,4,5,7,8],dirti:1,dirtyccdclos:34,disabl:[1,16],disable_doctest:2,disable_document:2,disable_linkcheck:2,discard:26,disclaim:20,discocontain:40,disconnect:3,discret:[39,41],discuss:[20,26],disk:[8,25,28,39,41,52],displai:[11,13,14,20],dissimilar:28,dist:41,dist_bin:41,dist_bin_s:26,distanc:[9,22,26,28,31,35,36,39,40,41,43],distance_thresh:28,distant:40,distinct:[21,36,52],distinguish:3,distribut:[1,8,20,25,26,27,34,37,39,41,48,52],disulfid:[0,25,32,36,43],disulfid_bridg:[25,36],disulfid_score_thresh:36,disulfidscor:[36,44],dive:[16,35],diverg:8,divers:[26,28],dng:18,do_it:[39,41],doc:[2,4,8,16,20],docker:3,dockerfil:[5,7],dockerhub:7,docstr:13,doctest:[2,8,16],document:1,doe:[1,3,4,8,9,10,11,13,15,16,20,22,26,30,31,34,35,37,40,48],doesn:[8,16,29,32,34,52],doesnt:52,doexternalscor:[39,41],dointernalscor:[39,41],domain:28,domin:10,don:[2,10,20,31,35,50],done:[1,8,11,13,16,23,25,27,31,34,35,37],donor:41,donorm:[39,41],dont:[0,34],dont_write_bytecod:1,dost_root:2,doubt:13,down:[13,22,26,34],download:5,dpm3_runtime_profiling_level:14,draw:[22,27,34],drawback:8,drawn:[27,34],drawphigivenpsi:27,drawpsigivenphi:27,drop:8,dssp:[3,26,41],dssp_state:41,due:[26,31,32,35,44],dump:52,dunbrack:[3,38,48],duplic:6,dure:[1,21,32,35,37,45,52],dynam:52,dynamicspatialorgan:3,e_cut:10,e_thresh:[10,35],e_tresh:10,each:[0,8,10,13,14,20,21,22,25,26,27,28,29,31,32,33,34,35,36,37,39,41],earli:3,earlier:2,easi:8,easier:[1,8,20],easili:[4,16,35],echo:8,edg:10,edge_idx:10,editor:1,editori:20,educ:8,effect:[4,8,10,25,36,44],effici:[21,28,34,38,42],egg:26,eigen3_include_dir:2,eigen:[2,3],either:[0,8,13,16,20,21,22,27,29,31,32,34,35,36,37,39,40,41,45,49,51,52],elabor:[8,20],electron:20,electrostat:[25,32],element:[1,10,21,22,26,28,31,33,37,40,44],elimin:[10,38],els:[8,16,36,37],emerg:1,empir:[43,44],emploi:16,empti:[8,11,13,22,26,28,31,35,49],enabl:[1,2,11,13,15,25,26],enable_mm:2,enable_ss:2,enclos:[20,29,35],encod:0,encount:[29,34],end:[0,1,2,4,8,10,11,13,16,20,21,22,26,28,29,31,35,38],end_resnum:35,end_transl:4,endian:37,energi:[3,8,10,18,25,32,34,35,39,41,44,45,46,47,49,50,53],enforc:[21,31,34,35,36,39,40,41],engin:19,enough:[8,16,25,26,35,37],ensur:[2,8,18,31,35,37],ent:[0,13,21,25,26,33,36,42],ent_seq:42,enter:45,entiti:[8,13,14,20,21,22,26,33,35,42,47],entityhandl:[13,21,22,33,35,36,40],entityview:[26,27,28,33,35],entri:[0,3,8,14,25,26,31,32,33,36,41,47,50],enumer:[8,10,21,25,26,31,40,47,49,50,51,52],env:[8,18,21,25,28,32,33,35,36,39,40,41,42],env_po:[32,36],env_structur:[21,40],environ:[1,3,8,21,28,29,31,32,34,35,36,37,39],epsilon:[10,25,36,53],equal:[34,39,41,44,50],equidist:52,equival:[35,39,41],error:[0,11,13,14,26,32,35,37],especi:28,estim:[10,33,34,38,41,44,52],etc:[1,3,8,16,22,26,31,40],evalu:[4,8,32,35,39,40,41],evaluategromacsposrul:9,even:[2,8,10,20,22,25,29,35],event:[20,28],eventu:13,ever:[16,34],everi:[0,1,8,10,13,21,22,26,27,28,31,32,34,35,36,39,40,41,44,46,49,50,52,53],everyth:[1,3,7,8],evolut:38,evolv:42,exact:[0,7,10,13,37],exactli:[2,10,26,28,31,35,40,44,50,51],exampl:[0,1,8,11,13,16,17,18,20,21,23,25,26,27,28,30],example_reconstruct:47,exce:[39,41],exceed:[26,29],except:[0,3,13,20,26,29,34,35,50],exclud:[8,20,26],exclus:[1,8,20,25],exec:7,execut:0,exercis:20,exisit:17,exist:[0,1,2,4,8,10,11,13,14,16,21,22,26,31,32,33,34,35,37,39,40,41,48,49,51,52],exit:[0,1,11,13],exit_cod:1,exit_statu:11,exot:8,exp:34,expect:[1,7,21,25,26,35,36,40,44,53],expens:26,experiment:35,explain:[1,8],explan:8,explicit:2,explicitli:20,explor:38,exponenti:34,exponentialcool:34,expos:26,express:[20,44],ext:11,extend:[1,4,8,16,17,24,26,28],extendatcterm:29,extendatnterm:29,extended_search:[31,35],extens:[0,3,11,13,29,35],extension_penalti:29,extent:26,extern:[3,4,5,7,8,34],extra:[2,3,8,16,22,37,48],extra_bin:26,extra_force_field:35,extract:[8,9,21,22,23,25,26,27,28,30,31,32,34,35,36,39,40,41,44,50],extractbackbon:21,extractloopposit:25,extractstatist:27,extrem:22,f_i:26,f_idx:40,facilit:28,factor:[10,25,34,49],fail:[0,1,8,11,14,22,31,32,35],failur:[0,8,11,13,20,52],fall:32,fallback:52,fals:[1,8,10,11,13,22,25,26,29,31,34,35,36,44,47,49,50],far:[31,35],fast:[9,18,19,21,25,26,27,37,39,40,41,52],fasta:[0,13,30,35],faster:[10,25,26,32,33,40],fastest:[32,35],favor:33,favourit:1,fed:[4,16],fedora:8,fee:20,feed:[4,21,31],feel:[8,16],fellow:8,fetch:16,few:[2,8,16,25,37,42],ff_aa:25,ff_aa_on:25,ff_aa_two:25,ff_ala:25,ff_arg:25,ff_asn:25,ff_asp:25,ff_cy:25,ff_cys2:25,ff_gln:25,ff_glu:25,ff_gly:25,ff_hisd:25,ff_hise:25,ff_ile:25,ff_leu:25,ff_lookup:[25,32,35],ff_lookup_charmm:37,ff_ly:25,ff_met:25,ff_phe:25,ff_pro:25,ff_ser:25,ff_thr:25,ff_trp:25,ff_tyr:25,ff_val:25,ff_xxx:25,field:[20,35,37,52],fifti:20,figur:16,file:[0,1,3,4,5,8],filecheck:16,fileexist:11,fileextens:11,filegzip:11,filenam:[0,8,11,13,25,26,27,28,37,39,41,48,52],filenotfound:33,fill:[4,7,8,13,16,23,26,29,30,31,33,35],fillfromdatabas:[31,35],fillfrommontecarlosampl:[31,35],fillloopsbydatabas:35,fillloopsbymontecarlo:35,filo:40,filtercandid:33,filtercandidateswithsc:33,final_model:[30,35],find:[4,7,8,10,16,21,23],findchain:42,findeigen3:20,findwithin:8,fine:8,finish:53,fire:[1,7],first:[0,1,8,10,13,16,18,21,22,25,26,27,28,29,31,32,34,35,36,39,40,41,43,44,47,49,52],fit:[16,20,22,26,30,31],fix:[3,8,11,16,25,32,36,37,39,41],fix_cterm:32,fix_nterm:32,fix_surrounding_hydrogen:25,flag1:4,flag2:4,flag:[0,2,4,8,10,11,22,26,35,36,49,50],flanking_rot_angle_on:22,flanking_rot_angle_two:22,fletch:[26,47],fletcher:35,flexibl:[0,19,36,44,47,49,50,53],flip:52,flood:26,flush:[1,16],fold:38,folder:[2,4,8,16,18,37],follow:[0,1,2,4,5,8,10,11,16,18,20,22,23,25,26,28,29,30,31,35,36,37,39,41,47,49,50,51,52],fontsiz:27,forbidden:8,forc:[25,32,35],force_const:[25,32],forcefield:23,forcefieldaminoacid:25,forcefieldbondinfo:25,forcefieldconnect:25,forcefieldharmonicangleinfo:25,forcefieldharmonicimproperinfo:25,forcefieldljpairinfo:25,forcefieldlookup:[25,32,35,37],forcefieldperiodicdihedralinfo:25,forcefieldureybradleyangleinfo:25,forg:16,forget:[1,8],form:[14,20,24,25,26,30,35,40,52],formal:[31,32,49,52],format:[0,5,13,20,26,48],formula:33,forward:16,found:[1,4,8,11,13,16,21,23,26,28,31,32,33,34,35,36,44,46,52],foundat:1,four:[9,34],fraction:[26,28,32,34],frag_db:[23,26,31,37],frag_info:26,frag_length:[23,26,28],frag_map:26,frag_po:[23,26,28],frag_residu:[23,26],frag_seq:[23,26],frag_siz:26,fragdb:[23,24,26,31,35,37],fragger:[23,26,28,34,35],fragger_handl:35,fragger_map:26,fraggerhandl:[26,28,35],fraggermap:[26,28],fragment:[3,9,22,23,24],fragment_db:35,fragment_handl:28,fragment_info:26,fragment_length:[26,28],fragmentinfo:[26,31],fragments_per_posit:28,fragmentsampl:34,frame:[3,16,35,36],frame_energi:49,frame_residu:[45,47],frameresidu:[45,49,50],framework:[8,19,38],free:[8,20,51,52],frequenc:[26,34],frm:36,frmrotam:[44,49,53],frmrotamergroup:[44,46,49,50],from:[0,1,3,4,5,6,7,8,9,10,11,13,16,18,20,21,22,23,25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42],fromhhm:26,fromhoriz:26,fromresidu:52,front:[1,11,16],fstream:37,fudg:25,fulfil:[26,52],full:[0,1,8,10,21,25,26,29,30,31,34,36,47,49],full_seq:[29,31],fullgapextend:[29,35],fulli:[8,16,21,22,26,29,30,36],function_typ:40,functions_specific_to_your_act:8,fundament:37,funni:[2,8],further:[10,28,29,35,36,37],furthermor:37,futur:[25,26],gamma:[40,41,44],gamma_bin:41,gap:[0,3,9,18,24,25],gapextend:[29,35],gapfre:26,gapless:[0,13],gather:[4,12,16,26,28,47,49,52],gauc:52,gauch:52,gauche_minu:52,gauche_plu:52,gciiipgatcpgdyan:[31,35],gener:[1,3,5,8,10,13,14,16,18,20,23,24],generatedenovotrajectori:28,generatestructureprofil:26,geom:[21,22,25,26,28,32,35,44,49],geometr:[9,23],geoom:43,get:[0,1,7,8,16],getaa:[21,22,25],getaaa:21,getaah:21,getactivesubrotam:49,getallatomposit:[21,32,36],getallatomscoringkei:31,getallatomweight:31,getanchoratomindex:21,getangl:47,getangularbins:26,getatomcount:8,getatomnam:21,getatomnameamb:21,getatomnamecharmm:21,getaveragescor:31,getbackbonelist:[23,26],getbackbonescoringkei:31,getbackboneweight:31,getbins:27,getbinsperdimens:27,getbound:22,getc:22,getca:22,getcb:22,getchain:29,getchainindex:29,getchainnam:29,getchains:8,getcharg:[25,49],getclust:31,getclusteredcandid:31,getconfid:26,getcoordidx:26,getcoordinfo:26,getcpuplatformsupport:25,getcreationd:5,getdefault:[25,32,35],getdefaultlib:5,getdihedralangl:26,getdihedralconfigur:52,getdistbins:26,getdisulfidbridg:25,getdisulfidconnect:25,getdsspstat:26,getel:21,getenviron:21,getenvsetdata:8,getepsilon:25,getfirstindex:21,getforcefieldaminoacid:25,getfragmentinfo:[26,31],getframeenergi:49,getfudgelj:25,getfudgeqq:25,geth1index:21,geth2index:21,geth3index:21,getheavyindex:25,gethistogramindex:[22,27],gethistogramindic:27,gethnindex:21,gethydrogenindex:[21,25],getindex:[21,25],getinternalconnect:25,getinternalenergi:49,getinternalenergyprefactor:49,getlargestclust:31,getlastindex:21,getlength:29,getlist:28,getlooplength:25,getloopstartindic:25,getmass:25,getmaxnumatom:21,getmaxnumhydrogen:21,getn:22,getnam:[47,49],getnonbondedcutoff:32,getnum:31,getnumatom:[21,25],getnumb:31,getnumcandid:31,getnumchain:8,getnumcoord:26,getnumfrag:26,getnumhydrogen:21,getnumloopresidu:25,getnumresidu:[8,21,25],getnumstempair:26,getnumsubrotam:49,geto:22,getolc:[21,22],getomegators:[21,22],getoxtindex:25,getparticletyp:49,getpeptideboundconnect:25,getphiprobabilitygivenpsi:27,getphitors:[21,22,47],getpo:[21,49],getpotentialenergi:25,getpredict:26,getprob:[27,49],getpsiprobabilitygivenphi:27,getpsitors:[21,22,47],getr:33,getresiduedepth:26,getringpunch:33,getrotamericconfigur:52,getscor:[26,34],getselfenergi:49,getseqr:[21,40],getsequ:[21,22,26,31],getsequenceprofil:26,getsequenceprofilescoreskei:31,getsigma:25,getsimul:25,getsolventaccessibilitit:26,getstemrmsdskei:31,getstructureprofil:26,getstructureprofilescoreskei:31,getsubdb:26,getsubrotamerdefinit:49,getsystemcr:32,gettemperatur:[34,49],gettransform:22,getversionnumb:37,getweight:[28,31],ggg:35,gggaggg:35,gggggggggggggggggggg:35,git:[0,1,3,4,5,6,7,8,9,10,11,12,13,14,15],gitignor:8,give:[4,8,16,20,23,31,34,35,49],given:[0,1,3,4,8,9,10,11,13,14,21,22,25,26,27,28,29,30,31,32,33,34,35,36,37,39,40,41,44,47,49,50,52],glass:38,gln:[51,52],gln_ne2:21,global:[15,26,31,37],glu:[21,49,51,52],glu_oe1:21,glutam:51,glutamin:51,gly:[35,36,47,50,51],gly_n:21,glycin:[3,22,26,32,36,51],goal:[1,10,30],goe:[2,8,14,16,35,52],goldfarb:35,goldstein1994:[10,38],goldstein:[10,38],good:[4,8,18,25,26,35],goodwil:20,got:2,govern:20,grain:8,grant:20,graph:3,graph_initial_epsilon:36,graph_intial_epsilon:36,graph_max_complex:36,graphminim:[10,46],greatest:5,grep:2,grid:26,gromac:9,grossli:20,group:[4,14,24,26,27,41,44,45,46,47],group_definit:[27,41],group_idx:41,guarante:[26,28,31,34,36,37],gui:[8,27],guid:32,guidelin:[8,37],gzip:[0,5,11,13],haa:38,hand:[0,2,4,13,49],handl:[3,8,9],handler:28,happen:[1,8,25,26,28,29,34,35,49],hard:43,hardwar:18,harmless:20,harmon:[25,32],harmonic_angl:25,harmonic_bond:25,harmonic_improp:25,hasdata:26,hasfraglength:26,hasfragmentinfo:31,hash:26,hasringpunch:33,have:0,hbond:[28,35,41,49,50,51],hbond_scor:37,hbondscor:[35,37],headach:8,header1:4,header2:4,header3:4,header4:4,header:[0,4,16,17],header_output_dir:4,headlin:8,heavi:[21,25,36,39,50],heavili:[26,47],helic:[22,24,25,28,35,41],helix:[18,22,34,47],hello:37,hello_world:8,hellyeah:18,help:[0,1,2,4,7,8,13,16,18,25,41],helpactiontest:1,helper:4,hen:26,henc:[8,14,21,26,37],here:[0,1,2,4,8,11,13,14,16,18,21,22,25,26,27,28,30,31,32,34,35,37,39,41,44,48,52],herebi:20,herein:20,het:35,heurist:[35,50],heuristicprocessor:21,hgfhvhefgdntngcmssgphfnpygkehgapvdenrhlg:0,hhblit:[0,13],hhm:[0,13,26,31],hhsearch:26,hidden:49,hide:[8,16],hierarch:[31,40],hierarchi:15,high:[3,8,16,30,35],high_resolut:22,higher:[31,40,41],highest:15,highli:[2,8],hint:13,histidin:[25,51],histogram:[27,34],histori:16,hit:[1,10,16,27,32],hmm:38,hold:20,home:[4,5],homo:[0,13],homolog:[0,12,18,19,35,38],homologu:26,honor:35,honour:35,hook:8,horiz:26,host:[4,7,16],hotfix:16,how:[1,7],howev:[5,20,26],hparticl:49,hpp:37,hsd:[51,52],hse:[51,52],html:[2,8,16],http:[7,20],hybrid:52,hydrogen:[3,21,22,25,35,38,41,49,50],hyphen:1,i_loop:[25,36],id_:37,idea:[1,8,21,23,25,26,35,40,49,53],ideal:[22,32,53],idenfifi:50,ident:[3,26,27,41,52],identif:20,identifi:[0,13,14,20,26,31,35,36,39,41,50,52],idx:[10,21,22,25,26,28,32,40,49],idx_ca_res_37:21,idxhandl:8,iff:[26,29,33],ifstream:37,ignor:[0,25,32,35],iii:20,illustr:26,image_nam:[5,7],imagehandl:22,imagin:8,imaginari:1,img:[7,22],immedi:[1,8,15,16],impact:[0,25,26],implement:[3,16,19,26,28,29,32,34,35,37,43,44,46,47,51],impli:20,implicit:2,improp:25,improv:[3,20,25,35,38,44],in_dir:4,in_fil:8,in_path:4,in_stream:37,in_stream_:37,inabl:20,inaccur:25,inaccurate_pot_energi:25,inact:53,inactive_internal_energi:53,incident:20,incl:[25,26,35],includ:[2,8,11,16,18,20,21,25,26,29,31,33,35,37,39,41,47],include_ligand:35,inclus:[20,35],incompat:[31,32],incomplet:[35,48],inconsist:[10,13,21,22,25,26,29,31,32,36,40],inconveni:16,incorpor:20,increas:[10,28,31,32,35,50],incur:20,indemn:20,indemnifi:20,independ:[0,3,25,36,48],index:[8,10,21,22,25,26,27,28,29,31,32,33,34,35,39,40,41,45,49,50,52],index_four:25,index_on:25,index_thre:25,index_two:25,indic:[8,10,11,13,20,21,22,25,26,27,28,29,31,32,35,36,40,44,47,49],indirect:20,individu:[20,39,41],inf:[10,32],infin:32,infinit:32,influenc:[13,28,40],info:[26,31,35,40],inform:[5,7,8,13,16,20,22,23,26,28,29,31,34,35,38,40,41,42],infring:20,inherit:[1,39,40,41,46],init:16,init_bb_list:34,init_frag:34,initi:[3,10,21,22,26,28,31,32,34,35,36,39,40,41,46,49,52],initial_bb:31,initial_epsilon:[10,53],initialis:1,inlin:37,inner:14,input:[0,1,3,13,16,18,25,26,27,28,32,34,35,36,39,40,41,44,48,50,53],insert:[21,22,29,31,34,35,53],insertinto:[21,22,31],insertloop:[29,35],insertloopcleargap:[29,31,35],insid:[1,4],insight:16,instanc:[3,8,13,24,25,37],instead:[0,1,2,3,4,8,11,26,28,29,31,34,35,50],institut:20,instruct:2,int16_t:37,int32_t:37,int_32_t:37,integ:[8,13,21,40],intend:[1,8,34],intent:26,intention:20,interact:[3,8,25,32,39,40,41,43,44,45,49],intercept:[39,41],interest:[1,10,25,26,34,37,49,52],interfac:[0,4,8,20],intermedi:8,intern:[0,1,3,4,5,8,16,21,24,25,26,27,28,31,32,34,35,36,37,38,39,40,41,46,49,50,53],internal_e_prefac:50,internal_e_prefactor:49,internal_energi:49,internet:8,interpl:52,interpol:[40,52],interpret:[8,11],intervent:8,intrins:2,introduc:[1,4,8,16,32,35],invalid:[8,21,25,26,29,32,35,36,39,40,41,45,49,51,52],invok:[2,4,8,15,16],involv:[16,30,44],iostream:37,irrevoc:20,is_c_ter:[25,36],is_cter:25,is_n_ter:[25,36],is_nter:25,isallatomscoringsetup:[31,35],isallset:21,isanyset:21,isbackbonescoringsetup:35,isctermin:29,isempti:31,isen:14,ishbondacceptor:49,ishbonddonor:49,isntermin:29,isoleucin:51,isset:21,issimilar:52,issourc:37,istermin:29,isvalid:47,item:[1,8,16,21,22,25,26,35,40],iter:[10,26,27,28,31,32,34,35,49],itself:[3,4,8,16,26,34,36,37,39,41,49],januari:20,job:[8,26,34,35],johner:38,join:[8,21,23,26,31,32,34,36],jone:[38,49],jones1999:[26,38],journal:38,json:[0,13],jupyt:7,just:[1,2,8,13,15,16,23,25,26,29,31,35,50],kabsch1983:[26,38],kabsch:38,keep:[0,1,4,5,8,13,16,30],keep_non_converg:31,keep_sidechain:[8,36],kei:[0,13,26,28,31,34,35,39,40,41],kept:[8,16,25,31,32,36,45],kernel:38,keyword:27,kic:[30,31],kicclos:34,kick:13,kill_electrostat:25,kind:[1,8,20],kinemat:32,know:[2,52],knowledg:52,known:[4,11,21,40,50],krivov2009:[10,38,47],krivov:38,kwarg:1,l_e:49,lab:48,label:[16,25],lack:35,languag:[4,20],larg:[5,27,32,35],larger:[10,14,22,26,35,50],largest:[28,31,44],last:[1,4,21,22,25,29,31,32,34,35,40,41,48],last_psi:22,later:[1,8,10,21,47],latest:[2,5,7,8],latter:[0,5,16,35],launcher:[4,8],law:20,lawsuit:20,layer:44,layout:[26,37],lazi:49,lbfg:35,leach1998:[10,38],leach:38,lead:[0,8,9,11,22,25,31,32,36,39,41,48],least:[0,2,4,8,10,16,20,22,25,26,35,39,41,44],leav:1,left:[11,32],legal:[8,20],lemon:38,len:[22,23,25,26,28,31,35,36,41,47],length:[9,10,21,24,25,26,27,28,29,31,32,34,35,36,37,39,40,44],length_dep_weight:35,length_depend:31,lennard:49,less:[0,10,16,22,25,26,27,31,35,39,41,52],let:[1,7,8,22,26,31,47],letter:[3,5,21,22,26,27,34,51],leu:51,leu_h:21,leucin:51,level:[2,3,8,14,15,16,30,35,49],lexicograph:35,liabil:20,liabl:20,lib64:8,lib:[5,7,37],libexec:[4,8],libpromod3_nam:4,librari:[0,3,4],library1:4,library2:4,licenc:48,licens:3,licensor:20,life:16,ligand:[3,35,36,50],like:[1,4,7,8,16,35,37,48,49],limit:[3,20,26,32,35],line:[0,1,7,8,9,12],linear:[26,28,31,34,39,40,41],linear_weight:[31,34,39,41],linearcombin:31,linearscor:34,link:[0,2,4,8,16,20,21,25,26,28,34,36,39,40,41,42],link_cmd:4,linkcheck:[2,8,16],linker:[4,35],linker_length:35,list:[0,1,2,3,4,8,9,10,11,13,20,21,22,25,26,27,28,29,30,31,32,33,34,35,36,37,39,40,41,44,45,46,47,49,50,52,53],listen:8,literalinclud:8,litig:20,littl:[4,8,16,37],live:[4,8],lj_pair:25,load:[1,8,13,15,21,23],loadalign:[30,35],loadallatominteractionscor:39,loadallatompackingscor:39,loadamberforcefield:35,loadbb:26,loadbbdeplib:[0,36,47,48],loadcach:28,loadcbetascor:[31,34,41,42],loadcbpackingscor:41,loadcharmm:25,loadcharmmforcefield:35,loaddefaultallatomoverallscor:39,loaddefaultbackboneoverallscor:41,loadent:[0,13],loadfragdb:[23,24,31,35],loadhbondscor:41,loadlib:[0,36,48],loadpdb:[8,21,23,25,26,30,31,32,34,35,36,42,47],loadport:[25,26,27,37,39,41,52],loadreducedscor:41,loadsequenceprofil:[13,26,31],loadssagreementscor:41,loadstructuredb:[23,24,26,31,35],loadtorsionsampl:[22,24,27,34],loadtorsionsamplercoil:[24,31,35],loadtorsionsamplerextend:24,loadtorsionsamplerhel:24,loadtorsionscor:41,local:[2,5,7,25,26,27,39,41,52],localhost:7,locat:[2,3,4,5,10,22,24,26,29,37,39,41,49],log:[11,16,33,49,50],logic:0,loginfo:33,lone:49,lone_pair:49,longest:26,look:[5,8,11,16,22,26,36,40],lookup:[9,21,23],looooooong:10,loop:[0,3,8,18,21],loop_candid:31,loop_length:[25,26,31,36],loop_main:8,loop_po:25,loop_seq:31,loop_start_indic:[25,36],loopcandid:[28,30],loss:[16,20],lossi:26,lost:[1,16],lot:[1,7,8,13,16],low:[1,8,10,50],lower:[31,34,35,39,41],lowest:[31,34,49],lowest_energy_conform:34,lysin:51,machin:[25,26,27,37,39,41,52],macro:[4,8],made:[4,20,52],magic:[8,37],mai:[0,1,2,4,8,11,13,16,20,21,25,29,32,35],mail:20,main:[35,37,52],mainli:[21,34,49],maintain:[8,16],maintin:34,major:16,makefil:[2,8],makestat:52,malfunct:20,malici:16,man:[2,8],manag:[4,8,20,42],mani:[7,11,13,26,32,33,35,50],manipul:22,manner:[8,10,34],manual:[1,2,5,8,9,16,26,31,34,35,37,49],map:[0,13,21,22,26,28,33,36],mariani:38,mark:[4,20,50],mass:25,massiv:28,master:[8,16],mat3:9,mat4:[9,22,28,35],match:[0,4,13,22,25,26,27,31,32,34,35,40,41],materi:[1,8],math:33,mathemat:[31,32],matplotlib:27,matric:38,matrix:[9,26],matter:[4,7],max:[9,10,21,29,33,35,36,41,52,53],max_alpha:41,max_beta:41,max_complex:[10,53],max_count:[39,41],max_d:41,max_dev:34,max_dist:[31,40],max_extens:35,max_gamma:41,max_iter:[28,31,35],max_iter_lbfg:35,max_iter_sd:35,max_length:29,max_loops_to_search:35,max_n:10,max_num_all_atom:35,max_p:50,max_prob:49,max_res_extens:35,max_step:32,max_to_show:14,max_visited_nod:10,maxfraglength:26,maxim:[10,26,28,31,32,34,35,38,40,41],maximum:[10,26,31,32,34,49,50],mc_closer:34,mc_cooler:34,mc_num_loop:35,mc_sampler:34,mc_scorer:34,mc_step:[10,35],mcsolv:10,mean:[4,8,13,16,20,21,25,32,35,36],meaning:[26,31],meant:[18,21,26,33,35,50],measur:28,mechan:[18,20,31,32,34,35,40],meddl:[7,35],media:20,medium:20,meet:20,member:[8,13,31,35],memori:[10,26,35,37],mention:[1,2],merchant:20,mere:20,merg:[16,25,28,29,31,35,36,40,49],merge_dist:35,mergegap:29,mergegapsbydist:35,mergemhandl:35,mess:[8,16,40],messi:16,met:51,methionin:[35,51],method:[0,1,10,13,21,25,26,27,32,35,36,37,50],metric:40,metropoli:[10,31,34],mhandl:[29,30,31,35],middl:16,might:[10,25,26,31,32,34,40,49,50,53],min:[31,41],min_alpha:41,min_beta:41,min_candid:31,min_d:41,min_dist:40,min_gamma:41,min_loops_requir:35,min_scor:31,mincadist:22,mind:[1,8],minim:3,minimizemodelenergi:35,minimum:[22,26,28,44],minor:[3,25],mirror:37,miser:14,mismatch:[21,40],miss:[0,11,13,25,35],mix:[0,4],mkdir:[2,8],mm_sy:[25,32],mm_sys_output:25,mm_system_cr:32,mmcif:[5,11],mmsystemcr:[25,32],mod:8,mode:[1,52],modellinghandl:[29,31,35],modeltermini:35,modif:[20,35],modifi:[8,16,20,22,31,35],modified_crambin:31,modul:[1,3],modular:19,module_data:4,mol:[8,9,18,21,22,23],molecular:[18,32,35],molprob:30,molprobity_bin:33,molprobity_execut:33,moment:8,monitor:1,monolith:8,mont:[3,10,28,31,34,35,46],montecarlo:3,mood:8,more:[1,2,4,7,8,10,13,14,16,20,28,35,44,49],most:[0,3,4,5,8,22,25,26,27,28,31,32,35,39,41,48,50],mostli:[4,16,49],motion:[22,38],mount:[5,7],movabl:25,move:[2,3,8,16,25,31,32,34,35,37],movement:28,mpscore:33,msg:11,msgerrorandexit:11,msm:3,msse4:2,much:[10,26,35],multi:18,multipl:[0,2,3,4,8,13,14,18,25,28,31,35,36,39,41],multipli:[10,34],multitempl:13,must:0,mutlipl:13,my_db_on:26,my_db_two:26,my_script:7,myclass:37,myclassptr:37,mytrg:0,n_coord:9,n_num:29,n_po:[9,22,41],n_stem:[9,23,26,29,31,32,34],n_stem_phi:34,n_ter:[32,50],naivesolv:10,name:[0,1,3,4,5,7,8,11,13,14,20,21,25,26,27,29,31,33,35,44,48,49,51,52],name_pymod:4,namespac:[7,13,37],nan:[32,52],nativ:37,necessari:[8,22,34,40],necessarili:[20,53],need:[1,2,3,4,5,8,11,13,15,16,22,25,26,27,28,31,32,35,36,37,39,40,41,47],need_config_head:4,neg:[1,10,25,32,40],neglect:[28,32,45,49],neglect_size_on:31,neglig:20,neighbor:[8,21,35],neighbour:[35,52],network:[22,44],never:[13,16,26,31,36,37,39,41],nevertheless:[8,49],new_default:25,new_env_po:21,new_po:21,new_res_nam:49,new_siz:22,newli:[5,21,34],next:[1,8,16,22,27,28,29,37],next_aa:34,nglview:7,nice:8,nitrogen:[9,22,32,43,49,50],nobodi:1,node:10,node_idx:10,node_idx_on:10,node_idx_two:10,non:[0,4,10,13,16,20,24,25,27,28,29,31,32,35,37,47,48,50],non_rotamer:52,nonbonded_cutoff:[25,32],none:[13,26,28,33,34,35,36],nonredund:26,nonzero:52,norm:41,normal:[20,39,41],normalis:40,notabl:26,note:[0,2,8,13,14,21,22,25,26,28,31,32,34,35,36,37,39,40,41,47,50,51],notebook:7,noth:[0,4,8,13,14,20,34,49],notic:[1,4,16,20],notwithstand:20,novel:[19,38],novo:3,now:[3,8,14,16,18,22,26],nparticl:49,nterminalclos:34,null_model:31,num:[23,28,31,32,36],num_frag:[26,35],num_gap_extens:29,num_loop:31,num_residu:[21,25,34,36,39,40,41],num_residues_list:36,num_trajectori:28,number:[0,1,8,9,10,13,14,18,21,22,24,25,26,27,28,29,31,32,34,35,36,37,39,40,41,42,44,45,49,52],numer:35,numpi:[27,34],o_po:22,object:[0,3,8,13,14,20,21,22,23],oblig:20,observ:[10,26,32,53],obtain:[10,18,20,23,35],obviou:16,occupi:[45,50],occur:[21,28,40,41],ocparticl:49,odd:26,off:[1,8,14,35],offend:33,offer:[6,20,24,30,49,52],offset:[0,3,13,26,31,35],ofstream:37,often:[8,11,13,32],olc:22,old:[33,35],oligom:[0,13,30],oligomer:3,omega:[21,22],onc:[1,3,8,16,25,28,31,32,34,46,52,53],one_letter_cod:[21,23,26,31,32,34,36],onli:[0,1,2,4,8,10,11,13,14,15,16,20,21,22,25,26,28,29,31,33,34,35,36,37,39,41,44,47,48,50],only_longest_stretch:26,onto:[1,22,26,28],oparticl:49,open:[13,25,26,27,37,39,41,52],openmm:[2,18,25,32],openstructur:[0,1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43,44,45,46,47,48,49,50,51,52,53,54],oper:[3,10,16,18,21,26,40],opt:[11,13,16],optim:[0,3,10,25,26,27,31,39,41,44,47,48,52],optimis:8,optimize_subrotam:[36,44],option:[0,2,3,5,7,13,26,31,32,35,52],order:[0,5,13,21,25,26,29,31,35,37,40],org:20,organ:[8,26,52],orient:[9,32,41],orig_indic:[31,33],origin:[5,7,9,13,16,20,22,26,31,34,35,40,53],ost:[0,1,3,4],ost_complib:[5,7],ost_double_precis:2,ost_ent:33,ost_librari:4,ost_root:[2,8],other:[0,1,4,8,10,14,16,20,21,22,31,32,35,36,39,41,42],other_index:22,other_res_index:21,otherwis:[1,4,8,10,14,16,20,21,22,25,26,28,29,31,32,34,39,40,41,49,52],our:[4,5,8,16,26,31],out:[0,1,2,4,8,14,16,20,21,25,26,27,28,29,31,34,47,52],out_path:4,out_po:25,out_stream:37,out_stream_:37,outdat:[5,7],outer:[14,26],outlier:33,output:0,output_dir:4,outsid:[8,40],outstand:20,over:[2,4,13,16,26,32,34,35,49],overal:[10,34,40,46],overhead:25,overlap:[25,34,35,36],overli:16,overload:37,overrid:[2,5,25],overridden:4,overriden:5,overview:[8,16],overwrit:31,overwritten:25,own:[1,3,4,5],owner:20,ownership:20,oxt:[9,21,25],oxygen:[22,35,43,49,50],pack:21,packag:[4,8,16],pad:[22,37],page:[2,8,20],pai:1,pair:[9,25,26,27,28,32,34,36,37,39,40,41,44,49,52],pairwis:[3,8,10,22,28,31,35,39],pairwise_energi:10,pairwiseenergi:49,pairwisefunct:[40,41],pairwisefunctiontyp:40,pairwisescor:[8,35],paper:[43,44,47,49],paragraph:[1,8],parallel:26,paramet:[1,4,8,9,10,11,13,14,15,21,22,24,25,26,27,28,29,31,32,33,34,35,36,38,39,40,41,43,44,45,46,48,49,50,51,52,53],parameter_index:26,parametr:[32,35,36,50],parent:35,pars:[0,11,12],parser:12,part:[1,8,16,18,20,21,26,34,35,40,44,46,47,49],partial:29,particip:[36,44],particl:[25,26,32,41,43,44,45,47],particular:[8,10,20,26,31,32,34,49,52],partner:[39,40,41,49],pass:[13,16,21,25,26,28,29,32,34,44,45,49,50],past:[8,16,22,29],patent:20,path:[1,2,4,5,8,11,16,18,25,26,27,33,39,41,52],path_to_chemlib:15,path_to_dockerfile_dir:5,path_to_promod3_checkout:6,pattern:38,paus:14,pdb:[0,5,8,11,13,18,21,22,23,24,25,26,30,31,32,33,34,35,36,42,47],penal:[29,35],penalti:[29,35],penultim:3,peopl:16,pep:[0,1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43,44,45,46,47,48,49,50,51,52,53,54],peptid:[3,21,23,25,26,35,36,47],per:[4,8,10,12,16,21,27,31,34,35,39,40,41,44],percent:20,percentag:33,perfect:8,perfectli:8,perform:[0,10,16,18,19,20,25,28,31,32,33,34,35,37,40,44],period:25,periodic_dihedr:25,periodic_improp:25,permiss:[8,20],permut:10,perpetu:20,pertain:20,phase:25,phe:[51,52],phenix:33,phenylalanin:51,phi:[21,22,26,27,32,34,41,47,50,52],phi_bin:[41,52],phi_handl:47,philippsen:38,phipsisampl:34,phosphoserin:35,phrase:8,pick:[31,34],pictur:8,piec:[8,28],pipelin:[0,3,14],pivot:[31,32,34],pivot_on:[31,32],pivot_thre:[31,32],pivot_two:[31,32],place:[1,2,4,8,11,13,16,20,26],plain:[0,13],plan:16,plane:33,platform:[18,25],playground:7,pleas:[2,8,16,28,31,32,35],plot:27,plt:27,plu:[8,13,15,26,44,49],pm3_csc:16,pm3_openmm_cpu_thread:[18,25,35],pm3_runtime_profiling_level:14,pm3argpars:[0,11,12],pm3argumentpars:[0,11,13],pm_action:[1,4,8],pm_action_init:8,pm_bin:1,png:27,point:[2,7,8,13,15,21,26,28,34,35,40,52],pointer:[2,8,37],polar:[49,50],polar_direct:49,polici:8,pop:[16,31,34,40],popul:[2,16],port_str_db:26,portabl:[4,17,25,26,27],portable_binary_seri:37,portable_fil:4,portablebinarydatasink:37,portablebinarydatasourc:37,pos_end:28,pos_on:28,pos_start:28,pos_two:28,posit:[3,8,9],possibl:[0,3,8,10,13,16,20,22,25,26,27,29,31,32,34,35,36,37,39,40,41,44,46,49,51,52],post:13,postprocess:36,pot:25,pot_:32,potenti:[10,23,25,26,31,32,35,36,37,38,41],power:20,pqhpg:0,practic:[4,8,25,26],pre:[8,16],pre_commit:[8,16],preceed:36,precis:[2,31,35],precomput:23,pred:40,predefin:[4,18,25,35,39,41],predict:[26,28,35,38,40,41],prefactor:49,prefer:[2,4,20,26,52,53],prefilt:35,prefix:[1,4,8,11],prepar:[8,20,35],present:[22,28,32,36,49,50,52],prev_aa:34,prevent:[1,8],previous:[25,26,31,36,40],primary_rot_angl:22,principl:[34,40],print:[1,2,5,20,22,23,25,26,31,32,33,35,42],printstatist:26,printsummari:14,prior:35,privat:[1,37],pro:[21,27,51,52],probabilist:[26,50],probability_cutoff:50,probabl:[4,8,10,16,26,27,28,31,32,34,49,50,52],problem:[3,7,10,13,16,26,31,32,34,35,40,42,44,46,48,53],problemat:[3,5,28],proce:42,procedur:[10,28,34,36],process:[1,13,16,21,25,28,32,34,35,37,40,45,49,52],processor:5,produc:[0,1,2,4,8,10,26,29,33,35,50],product:[1,3,16,20],prof:[0,26,31],prof_dir:26,prof_path:26,profil:[0,3,12,13],profiledb:26,profilehandl:[13,26,28,31,35],prog:13,program:[4,5,8,12],project:[3,4,8,16],prolin:[22,33,50,51],promin:[0,20],promod3_mod:4,promod3_nam:4,promod3_name_head:4,promod3_path:8,promod3_root:8,promod3_shared_data_path:[8,37],promod3_unittest:[1,4,8],promod:[5,7],promot:8,propag:[8,22],proper:[16,26,50],properli:[1,35,39,41,50],properti:[21,22,35,52],propos:[29,31,32,34,44],proposed_posit:34,proposestep:34,prot:[8,23,26,32,34,36,47],prot_rec:8,protein:[0,18,24,25],proton:[21,25,51,52],prototyp:19,provid:[0,1,2,3,4,5,7,8,13,16,20,21,22,23,25,26,28,29,31,32,33,34,35,36,37,40,48,49,50,52],prune:[10,53],pseudo:[34,35,39,41],psi:[21,22,26,27,32,34,41,47,50,52],psi_bin:[41,52],psi_handl:47,psipr:[26,28,40,41],psipred_confid:41,psipred_pr:28,psipred_predict:[26,28,35],psipred_st:41,psipredpredict:23,pssm:[0,13],publicli:20,pull:[7,8,16],punch:[1,3,30],pure:0,purpos:[8,10,20,35,52],push:[7,16],pushverbositylevel:13,put:[1,4,8,11,13,35],pwd:5,py_run:[1,4,8],pyc:1,pylint:16,pylintrc:16,pymod:[4,8,16],pyplot:27,pytest:8,python2:8,python:[0,1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43,44,45,46,47,48,49,50,51,52,53,54],python_root:2,pythonpath:8,qmean:2,qmeandisco:40,qualiti:35,quantum:38,queri:[26,52],querylib:52,question:[3,27],quickli:[5,8,32],quit:[8,13],rackovski:38,radian:[9,22,25,27],radii:[33,43],radiu:[8,33,39,41],raihvhqfgdlsqgcestgphynplavph:0,rais:[0,9,10,13,21,22,25,26,27,28,29,31,32,33,34,35,36,39,40,41,44,45,49,50,52],rama_iffi:33,ramachandran:33,random:[10,22,24,27,31,32,34],random_se:31,randomized_frag:22,randomli:[27,34],rang:[8,9,21,22,23,25,26,27,28,29,32,34,35,39,40,41,52],rank:31,rapid:38,rare:8,rather:[5,7,8,11,16,34,52],raw:[7,18,25,26,27,30,31],rawmodel:[3,8],reach:[0,29,32],read:[0,8,11,13,16,25,26,27,29,36,37,39,41,48,52],readabl:[0,8,13,20,52],readdunbrackfil:48,reader:[16,18],readi:[2,52],readm:[2,48],real:[8,13,37,50],realli:[1,2,8,11,16],reappear:16,reason:[8,16,20,32,34,53],rebas:16,rebuild:[2,8],recalcul:27,receiv:20,recent:16,recip:[3,6,7],recipi:20,recoginz:51,recogn:[0,13],recognis:[1,8,16],recognit:38,recommend:[2,5,8,20,25,35],reconstruct:[0,3,8,18,21,22,25,30,32,35],reconstructcbetaposit:22,reconstructcstemoxygen:22,reconstructor:[32,35,36],reconstructoxygenposit:22,reconstructsidechain:[8,35,36],reconstructtest:8,record:[1,35],recreat:16,redistribut:20,reduc:[3,25,28,35,41],reduced_scor:37,reducedscor:[35,37],redund:[24,31],ref_backbon:[23,26],ref_fil:8,refactor:3,refer:[1,4,8,18,21,22,23,25,26,34],referenc:8,refresh:31,regard:[20,32,44],region:[25,28,29,32,34,35,45,50],regist:[4,8],registri:7,regress:38,regularli:5,reinterpret_cast:37,reject:[31,32,34],rel:[4,5,9,10,26,28,32,41],relat:[4,8,13,26,28,37,38,49],relax:30,relev:[2,3,4,7,25,36],reli:5,remain:[20,30,34,35],rememb:[1,8,34],remodel:[31,36],remodel_cutoff:36,remov:[2,3,10,22,25,26,29,31,33,35,36,40,47,49],removecoordin:26,removeterminalgap:35,renumb:[26,35],reorder:35,reordergap:35,replac:[3,20,21,22,34,35],replacefrag:22,report:[1,8,35],reportmolprobityscor:33,repositori:[1,4,8,16],repres:[10,20,21],represent:[22,23,25,26,27,37,39,41,49,52],reproduc:[3,20,35],reproduct:20,request:[26,28,48,52],requir:[0,2,3,5,8,13,16,19,20,21,22,26,27,28,31,32,35,36,37,42,49,50,51,52],reread:26,res_depth:26,res_idx:49,res_index:21,res_indic:[21,25,36],res_list:[21,25,32,36],res_num:21,resembl:16,reserv:11,reset:[10,21,25,32,34,40,49],resid:5,residu:[0,3,8,9,21,22,23,24,25,26,27,28,29,31,32,33,34,35,36,38,39,40,41,42,44,45,47,49],residue_depth:26,residue_index:[45,49,50],residuedepth:26,residuehandl:[9,21,22,26,29,31,32,33,34,49,50,52],residuehandlelist:21,resiz:[22,37],resnum:[21,22,29,31,35,36,40],resnum_on:40,resnum_rang:35,resnum_two:40,resolut:[22,32],resolv:[16,21,32],resolvecystein:44,resort:35,respect:[9,25,35],respons:[8,16,20],rest:[0,1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43,44,45,46,47,48,49,50,51,52,53,54],restart:7,restor:[22,31,34,40],restraint:[26,32],restrict:[8,16,29],restructuredtext:[0,1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43,44,45,46,47,48,49,50,51,52,53,54],result:[0,2,8,10,20,25,27,28,31,32,33,34,35,36,38,44,52],resum:14,retain:20,reus:[35,36],review:16,revis:20,reviv:16,rewrit:1,richardson:38,ridig:36,right:[1,2,8,13,20],rigid:[0,3],rigid_frame_cutoff:36,rigidblock:28,rij:43,ring:[3,30],ring_punch_detect:35,risk:20,rmsd:[22,23,26,28,31,32],rmsd_cutoff:[26,31,32],rmsd_thresh:[26,28],rnum:40,robot:38,role:13,root:[2,4,8,16],rosetta:41,rot:36,rot_constructor:47,rot_group:[47,50],rot_lib:50,rot_lib_entri:50,rota_out:33,rotam:[0,3,33,36,38,44,45],rotamer:[48,52],rotamer_group:[44,46,47],rotamer_id:47,rotamer_librari:[3,35,36,48],rotamer_model:36,rotamer_on:44,rotamer_res_indic:36,rotamer_two:44,rotamergraph:[36,46,47,49,53],rotamergroup:49,rotamerid:[47,50],rotamerlib:[35,36,37,48,50,52],rotamerlibentri:[50,52],rotat:[9,22],rotatearoundomegators:22,rotatearoundphipsitors:22,rotatearoundphitors:22,rotatearoundpsitors:22,rotationaroundlin:9,roughli:24,round:52,routin:[1,18,31],royalti:20,rrm:36,rrmrotam:[44,49],rrmrotamergroup:[44,46,49,50],rst1:4,rst2:4,rst:[4,8,16],rsync:8,rule:[5,8,9,16],run:0,runact:1,runexitstatustest:1,runmolprob:33,runmolprobityent:33,runnabl:8,runner:1,runtest:[1,8],runtim:[3,10,12],runtimeerror:[9,10,21,22,25,26,27,29,31,32,34,35,36,39,40,41,44,45,48,49,50,52],runtimeexcept:27,s_id:26,safe:2,said:4,same:[0,1,2,4,7,8,10,13,14,20,21,25,26,28,31,32,34,35,36,37,39,40,41,42,45,48,49,50,52],samiti:35,sampl:[3,8,22,23],sampled_frag:34,samplemontecarlo:[3,34],sampler:[3,23,24,26],samplerbas:34,sampling_start_index:34,sander:38,saniti:2,sanity_check:2,satisfi:51,save:[8,16,22,25,26,27,28,31,34,37,39,40,41,52],savebb:26,savecach:28,savefig:27,savepdb:[18,21,22,25,26,30,31,32,34,35,36,47],saveport:[25,26,27,37,39,41,52],sc_data:32,sc_rec:[32,36],sc_rec_test:36,sc_result:32,scale:22,scatter:27,scheme:[1,8,13,21,26,29,34],schenk:38,schmidt:38,schwede:38,sci:38,scondari:35,scope:14,score:[0,3,8,23,26,28,29,30],score_contain:31,score_env:[31,34,42],score_threshold:44,score_vari:35,scorecontain:31,scorer:3,scorer_env:[28,31,34],scorerbas:34,scoring_weight:28,scoringgapextend:[29,35],scoringweight:[28,31,35],scratch:[26,34],scriptnam:11,scriptpath:8,scwrl3:42,scwrl3disulfidscor:[43,44],scwrl3pairwisescor:43,scwrl4:[38,44,47,49,50],scwrlrotamerconstructor:[47,49,50],seamlessli:16,search:[2,3,8,21,26,28,31,33,35,36,41,44,49,50],searchdb:[23,26],second:[8,10,22,25,26,28,31,32,35,39,40,41,43,44],secondari:[3,26,28,38,41],secondli:8,section:[1,4,7,17,20,54],see:[0,1,8,9,10,11,13,16,18,20,21,25,26,27,29,31,33,34,35,37,39,40,41,52],seed:[10,24,27,31,32,34],seem:16,segment:22,select:[3,10,26,28,34,35,36,47],selenium:35,self:[1,8,10,44,47,49],self_energi:[10,49],sell:20,send:11,sensibl:35,sent:20,seok:38,separ:[1,3,8,10,20,25,27,35,39,41,44],seq:[13,21,23,26,28,29,31,35,40,42],seq_idx_on:28,seq_idx_two:28,seq_one_idx:28,seq_sep:[39,41],seq_tpl:[31,35],seq_trg:[31,35],seq_two_idx:28,seqid:[24,26],seqprof:13,seqr:[0,21,23,26,28,29,31,34,35,36,39,40,41],seqres_str:[21,32,36],seqsim:26,sequenc:[0,3,8,13,18,21,22,23],sequencefromchain:42,sequencehandl:[21,26,28,29,35,40],sequencelist:[21,35,40],sequenceprofil:26,sequenti:[22,35],ser:51,serial:[26,37],serializ:37,serin:51,serv:[1,13,26,28,31,34],servic:[16,20],set:[1,2,4,8,10,11,13,15,16,18,21,22,25,26,28,31,32,33,34,35,36,37,39,40,41,44,47,49,50,52,53],setaa:22,setactivesubrotam:49,setallatomscoringkei:31,setaroundomegators:22,setaroundphipsitors:22,setaroundphitors:22,setaroundpsitors:22,setbackbonescoringkei:31,setbackrub:22,setc:22,setca:22,setcb:22,setcharg:25,setcpuplatformsupport:25,setdefault:25,setdisulfidconnect:25,setenergi:[39,41],setenviron:[21,32,36,40],setepsilon:25,setframeenergi:[47,49],setfudgelj:25,setfudgeqq:25,setinitialenviron:[21,31,32,34,36,40,42],setinternalconnect:25,setinternalenergi:49,setinternalenergyprefactor:49,setinterpol:52,setmass:25,setn:22,setnonbondedcutoff:32,seto:22,setolc:22,setpeptideboundconnect:25,setphitors:22,setpo:21,setpolardirect:49,setprob:49,setpsipredpredict:[35,40,41],setpsitors:22,setresidu:21,setscor:41,setsequ:22,setsequenceoffset:35,setsequenceprofil:35,setsequenceprofilescoreskei:31,setsigma:25,setstemrmsdskei:31,setstructureprofil:26,setstructureprofilescoreskei:31,settemperatur:49,setup:[5,7,8],setupdefaultallatomscor:[31,35],setupdefaultbackbonescor:[31,35],setupsystem:25,setweight:31,sever:[0,2,3,5,8,10,13,24,26,27,28,31,32,36,40,41,42,44,48,49,52,53],sg_pos_on:43,sg_pos_two:43,shake:34,shall:20,shanno:35,shapovalov2011:[38,48],shapovalov:38,shared_ptr:37,shebang:8,sheet:35,shelenkov:38,shell:[1,2,8,11],shift:[22,26,29],shiftctermin:29,shiftextens:29,ship:[5,48],shorten:35,shorter:35,shortest:31,shortli:8,should:[1,2,4,5,7,8,10,11,13,16,18,20,22,23,26,27,28,31,32,34,35,36,37,40,45,47,49],show:[1,8,13,14,31,34,47,50],showcas:[1,21,25,27],shown:[8,14,35],shrink:22,shrug:38,side:[8,35,38],sidechain_pymod:8,sidechain_reconstructor:35,sidechain_rst:8,sidechain_test_data:8,sidechain_test_orig:36,sidechain_test_rec:36,sidechain_unit_test:8,sidechainparticl:[49,50],sidechainreconstructiondata:[30,32],sidechainreconstructor:[25,30,32,35],sidenot:[26,36],sig1:52,sig2:52,sig3:52,sig4:52,sigma:25,silent:1,sim:25,similar:[1,2,16,23,26,28,40,41,52],similardihedr:52,similarli:[2,25,35],simpl:[0,9,22,26,34,39,40,41,52],simpler:[25,35],simplest:[5,8,30],simpli:[21,22,31,32,34,35,50,51,52],simplic:[23,26],simplif:13,simplifi:[3,22,25,26],simul:[10,25,31,32,34],sinc:[1,2,4,8,10,11,16,18,22,25,26,27,28,51],singl:[2,4,8,10,21,22,25,26,28,31,32,34,35,36,40,41,45,48,49,50,53],singleton:25,singular:[3,6],singularity_nohttp:7,sink:37,sit:8,site:[5,8],size:[8,21,22,26,27,32,34,37,39,40,41],sizeof:37,skip:[0,1,8,16,26,35,50],slide:28,slight:35,slightli:35,slow:37,slower:[18,25,26,27,35,39,41,52],small:[8,26,32,35,36],smaller:[22,26,28,32,41],smallest:47,smallish:[2,8],smart:16,smng:3,smooth:38,smtl:35,soding2005:[26,38],softsampl:34,softwar:[8,20,38],sol:47,sole:[1,16,20],soli:38,solis2006:[24,38],solut:[8,10,28,31,32,34,35,36,46,47],solv:[10,16,47,53],solvent:26,solventaccess:26,solver:3,some:[1,2,4,5,6,7,8,13,16,21,23,26,30,33,34,35,36,37,40,42,47,50,52],somedata:37,someth:[1,7,8,11,16,26],sometim:16,somewher:4,soon:[7,10,32,41,47,52],sort:[1,4,10,14,31,34,52],sound:16,sourc:[1,2,4,7,8,11,13,15,16,20,26,28,31,32,33,34,35,36,37,52],source1:[4,16],source2:[4,16],source3:4,source4:4,source_chain_idx:35,source_mhandl:35,sp3:52,space:[10,34,38],span:35,sparticl:49,spatial:[8,42],spawn:[1,8],spdbv:35,spdbv_style:35,special:[1,2,4,8,20,25,34,50,51,52],specif:[1,8,20,25,26,27,28,31,34,38,40,48,50,52],specifi:[0,2,4,5,9,10,22,26,27,31,32,35,36,40,49,52],specimen:11,speed:[3,25,35],spent:[14,18],sphere:43,sphinx:[0,1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43,44,45,46,47,48,49,50,51,52,53,54],spin:38,spit:[29,34],split:42,sport:8,squar:26,src:[8,16],ss_agreement:41,ss_agreement_scor:37,ssagre:26,ssagreementscor:37,sse:2,sstream:37,stabil:38,stabl:16,stack:16,stage:[1,4,8],stai:[1,8,10,16,34],standalon:7,standard:[2,8,12,13,16,21,27,37,41,52],start:[0,1,4,7],start_idx:31,start_resnum:[21,22,26,31,34,35,36,39,40,41],start_resnum_list:36,start_rnum:40,start_temperatur:[10,34],starter:1,startscop:14,stash:[16,31,34,40],state:[1,2,8,20,21,26,31,34,40,41,44,51,52],statement:20,staticruntimeprofil:14,statist:[14,26,38],statu:[1,8],std:37,stderr:1,stdout:1,steadili:[10,34],steepest:[32,35],stem:[9,22,25,26,29,31,32,34,35,36],stemcoord:9,stempairorient:9,step:[8,10,14,16,18,28,29,30,31,32,34],stereochem:[3,35],steric:52,still:[8,14,25,26,35,37],stop:[1,8,14,29,32],stop_criterion:32,stoppag:20,storabl:26,storag:[8,21,25,39,41],store:[0,1,3,8,9,16,18,21,22,25,26,27,28,29,31,32,34,35,36,37,47],stori:8,str:[1,11,13,14,15,21,22,25,26,27,28,29,31,32,33,34,35,36,37,39,40,41,49,51,52],str_len:37,straight:16,strategi:52,stream:37,stretch:[21,26,31,34,35,40,41],strict:16,strictli:3,string:[0,3,11,13,26,27,29,37],stringstream:37,strip:[0,35],struc:5,struct:[5,26,37],struct_db:23,structral:[21,40],structur:[0,3,8,13],structural_db:31,structuralgap:[29,33],structuralgaplist:[29,35],structure_db:[26,28,31,35,37],structure_db_on:26,structure_db_two:26,structure_dir:26,structure_id:26,structure_path:26,structure_sourc:13,structuredb:[3,24,26,28,31,35,37],structuredbdatatyp:26,structureprofil:26,studer:38,stuff:[26,39],style:[35,40,41],sub:[8,26],sub_frag:22,sub_res_list:26,subdir:8,subfold:8,subject:[8,20],sublicens:20,submiss:20,submit:20,submodul:8,submodule1:16,subpart:28,subrotam:[0,3,44,47,49],subrotameroptim:[36,53],subsequ:[10,20,22,35],subset:[0,13,25,26,28,31,32,35,36],subst:26,subst_matrix:26,substitut:26,substweightmatrix:26,subtre:[4,8],succeed:29,success:[10,11,34],successfulli:5,sudo:[5,7],suffici:26,suffix:11,sugar:6,suggest:[5,8,43],suit:[1,8,26],sulfur:[43,44,49,50],sum:[14,29,35,36,43,44],summari:[14,26],superpos:[22,26,28,31,32,34],superpose_stem:22,superposed_rmsd:[22,31],superposeonto:22,superposit:[3,28,31,34],superpost:28,supersed:20,supervis:1,support:[1,8,11,13,18,20,25,32,35],suppos:[16,34],sure:[2,7,8,13,16,26],surfac:26,surotam:49,surround:[25,26,32,36,39,41],symmetr:[26,40,52],symmetri:[39,41],sync:8,syntax:20,system:[1,4,8,16,20,23],t_sampler:27,tabl:26,tag:[5,7],tail:22,tailor:[21,35],take:[8,10,21,26,27,28,31,32,34,35,37,41,44,50,53],taken:[0,21,25,32,34,35,50],talk:1,target:[0,1,2,4,8,13,18,26,28,30,31,32,34,35,40],target_chain_idx:35,target_mhandl:35,target_pdb:33,target_sequ:26,task:[8,16,32,35,37,40],techniqu:10,tell:[1,8,11,13,16,26],temperatur:[10,31,34,49],templat:[0,1,13,18,30,35,37,40],temporari:[26,35],temporarili:16,term:[8,20,26,49,51,52,53],termin:[1,9,11,18,20,21,22,25,29,31,32,34,35,36],terminal_len:34,terminal_seqr:34,termini:[29,34,35],terminu:[26,34,35,50],test_:8,test_action_:1,test_action_do_awesom:1,test_action_help:1,test_awesome_featur:8,test_check_io:37,test_cod:8,test_doctest:8,test_foo:4,test_portable_binari:37,test_reconstruct_sidechain:8,test_sidechain_reconstruct:8,test_submodule1:16,test_suite_:4,test_suite_your_module_run:8,test_your_modul:16,testcas:[1,8],testcasenam:8,testexit0:1,testpmexist:1,testreconstruct:8,testutil:[1,8],text:[1,13,20],than:[4,8,13,14,16,21,22,26,28,31,32,33,35,36,41,44],thei:[2,5,8,16,21,22,25,26,27,31,32,33,34,35,44,49,50,51,52],them:[4,8,16,22,25,26,27,28,29,31,35,36,40,45],themselv:25,theoret:34,theori:[20,38],therefor:[5,8,22,24,26,28,32,34,35,52],thereof:[20,25],thi:[0,1,2,3,4,5,7,8,10,11,12,13,14,15,16,17,18,20,21,22,23,25,26,27,28,29,30,31,32,33,34,35,36,37,39,40,41,42,44,47,49,50,51,52,53,54],thing:[1,2,8,16,26,28,35,52],think:10,thoroughli:16,those:[0,1,2,4,8,10,13,16,20,25,31,35,36,37,39,41,47,52],though:[25,35,37],thr:51,thread:[18,25,35,38],three:[1,4,16,21,22,27,31,33,34,41,51,52],threonin:51,thresh:[22,49,52],threshold:[10,26,28,32,35,36,40,52],through:[1,8,9,20,22,26,29,35,39,41],throughout:[13,16,24,25],thrown:26,thu:[5,11],tidi:16,tightli:16,time:[1,5,8,13,14,16,18,28,35],timer:14,tini:[16,35],titl:[20,27],tlc:[21,51],tlc_an:21,tlctorotid:[47,51],tmp_buf:37,todens:22,toentiti:[18,21,22,25,26,32,34,36],toframeresidu:49,togeth:[8,16,26,44],too:[13,16,31,32,35,37,49],tool:[3,4,23,37,42,47],toolbox:16,top:[2,6,7,8,14,15,16,32],topic:[1,8,16],topolog:[25,32],torrmrotam:49,torsion:[21,22,23,24,26],torsion_angl:47,torsion_bin:41,torsion_plot:27,torsion_sampl:[22,26,31,32,34,35,37],torsion_sampler_coil:[28,37],torsion_sampler_extend:[28,37],torsion_sampler_hel:37,torsion_sampler_helix:28,torsion_sampler_list:26,torsion_scor:37,torsionprob:26,torsionsampl:[22,24,26,27,28,31,32,34,35,37,41],torsionscor:[35,37],tort:20,total:[10,14,26,28],touch:[1,8,25,32],toward:[0,3,8,13,26,29,32,35,39,41,47,49,50,53],tpl:[0,30,31,35],tpr:[51,52],trace:35,track:[11,20,30],trade:20,trademark:20,tradition:11,trail:0,train:[24,31,35],trajectori:[28,34],tran:[22,51,52],transfer:20,transform:[9,20,22,28,34,35,52],translat:[4,8,20,26,51,52],transomegators:22,treat:[3,8,25,35,36,37,52],treatment:50,tree:[1,4,8,10,16,46,47],treepack:3,treesolv:[10,36,47],trg:[0,13,31,35],tri:[10,28,29,35,44,52],trick:[1,7,16],trigger:[1,4,8,48],tripeptid:27,tripl:11,triplet:23,trp:[51,52],trustworthi:16,tryptophan:51,ttccpsivarsnfnvcrlpgtpea:[31,35],ttccpsivarsnfnvcrlpgtpeaicatgytciiipgatcpgdyan:35,ttccpsivarsnfnvcrlpgtpeaicatytgciiipgatcpgdyan:[31,35],tupl:[9,10,11,22,25,26,28,29,33,35,36,44],turn:[0,1,11,14,16,35],tutori:8,tweak:35,twice:[14,40],two:[1,7,8,10,16,21,22,25,26,28,29,31,32,35,36,37,39,40,41,43,44,47,49,51,52],txt:[1,2,4,8,16,20],type:[0,1,8,9,10,11,13,14,20,21,22,24,25,26,27,29,31,32,33,34,35,36,37,39,40,41,43,47,48,49,50],typedef:37,typenam:37,typic:[22,28,34,47,52],tyr:[51,52],tyrosin:51,uint32_t:37,uint:37,ultra:26,uncertain:8,uncharg:50,undefin:25,under:[4,8,20],undergo:[28,32,34,36],underli:[29,31],underscor:1,understand:16,understood:0,undo:10,unexpect:2,unfavor:[22,32],unfavour:[32,34,44],unfortun:16,unhandl:[0,13],uniform:32,union:20,uniqu:[0,13,28,31,34,52],unittest:[1,8,16],unix:16,unknown:25,unless:[13,20,21,22,25,31,39,41],unlik:47,unrecognis:11,unset:[21,25,36],unsupport:[13,37],until:[8,10,32,35,40,50],untouch:22,untrack:1,unus:16,upat:5,updat:[3,5,7,8,16,21,25,29,31,32,35,36,40,42],updatedistribut:27,updateposit:[25,32],upon:[26,32,34],urei:25,urey_bradley_angl:25,usabl:16,usag:[0,3,10,13,24,26,31,32,36],use_amber_ff:35,use_bbdep_lib:36,use_frm:36,use_full_extend:35,use_scoring_extend:35,user:[1,5,8],userlevel:1,usr:[2,5,7,8],usual:[1,2,4,8,13,14,16,22,31,35,39],utilis:[8,16],v_size:37,val:[27,51],valid:[0,10,16,22,26,29,34,35,36,48,52],valin:51,valu:[2,10,11,13,21,22,25,26,28,31,34,35,37,39,40,41,44,47,49,51,52,53],valueerror:[28,35],vanish:40,varadarajan:38,vari:[4,37],variabl:[1,2,8,14,18,25,33,35,37],variant:[25,31],variou:[1,2,4,16,30],vec3:[9,21,22,26,32,33,43,44,49],vec3list:28,vector:[25,27,31,37],verbal:20,verbos:1,veri:[1,8,11,16,25,28,35,37],verif:13,verifi:[1,11,16],version:[2,3,5,8,16,20,26,35,37,48,51],via:[1,5,8,13,15,25],view:[13,16,27,35,40],virtual:8,visibl:36,visual:18,volum:5,wai:[1,2,4,5,8,16,22,23,25,31,41,47,51],wait:8,walk:[1,8],want:[1,2,3,7,8,15,16,22,26,28,31,32,35,40,49,50,52,53],warn:[8,16,35],warranti:20,watch:8,web:[2,8],weight:[3,26,28,31,34,35,39,41],weird:[28,32,47],well:[0,4,16,21,27,28,29,31,35,37,41,47,52],went:[0,8],were:[16,26,31,35],wester:38,wether:10,what:[1,8,11,13,16,23,26,40],when:[1,3,4,5,8,10,13,14,21,22,25,26,27,28,29,31,34,35,36,37,38,40,41,44,47,48,49,50,52],whenev:[8,21,31,40],where:[0,1,3,4,5,8,10,11,13,14,16,20,21,22,25,26,27,31,35,37,39,40,41,48,49,50,52],wherea:26,wherev:20,whether:[3,5,8,10,11,20,22,25,26,31,32,34,36,39,40,41,49,50,52],which:[0,1,4,8,9,11,12,13,16,18,20,21,22,25,26,27,28,29,31,32,33,34,35,36,37,39,40,41,49,50,52],whistl:8,whitespac:0,who:[10,47],whole:[1,2,8,16,20,22,26,35,49],whom:20,why:[1,16,50],width:[10,37,47],wild:4,window:28,window_length:28,wise:4,wish:[2,17,27,35],with_aa:31,with_db:31,within:[2,3,4,8,14,16,20,21,25,28,29,33,35,36,39,41,52],without:[1,4,8,11,13,20,25,29,32,35,40,52],won:[35,36,50],word:[4,7],work:[1,2,4,5,7,8,14,16,18,20,25,29,35,37],worldwid:20,worst:16,would:[1,2,8,11,22,26,27,44,49],wrap:26,wrapper:[1,4,8,15,35],write:0,writebasetyp:37,writemagicnumb:37,writetypes:37,writeversionnumb:37,written:[8,20,37],wrong:[2,13],wwpdb:5,www:20,xlabel:27,xlim:27,xml:8,xxx:[22,51],xxx_num_atom:21,xxx_num_hydrogen:21,year:1,yet:[26,31],ylabel:27,ylim:27,you:[0,1,2,3,4,5,7,8,10,11,13,14,15,16,18,20,21,22,23,25,26,27,28,30,31,32,34,35,36,37,39,40,41,47,48,49,50,52,53],your:[1,4,5,7],your_modul:[8,16],yourself:[2,8,10,16,35,50],yyyi:20,zero:[0,26,35,52],zhou2005:[26,38],zhou:38,zip:[26,47]},titles:["ProMod3 Actions","<code class=\"docutils literal\"><span class=\"pre\">test_actions</span></code> - Testing Actions","Building ProMod3","Changelog","ProMod3‘s Share Of CMake","Docker","ProMod3 and Containers","Singularity","Contributing","Geometry functions","Graph Minimizer","<code class=\"docutils literal\"><span class=\"pre\">helper</span></code> - Shared Functionality For the Everything","<code class=\"docutils literal\"><span class=\"pre\">core</span></code> - ProMod3 Core Functionality","<code class=\"docutils literal\"><span class=\"pre\">pm3argparse</span></code> - Parsing Command Lines","Runtime profiling","<code class=\"docutils literal\"><span class=\"pre\">SetCompoundsChemlib()</span></code>","ProMod3 Setup","Documentation For Developers","Getting Started","ProMod3","License","Handling All Atom Positions","Representing Loops","<code class=\"docutils literal\"><span class=\"pre\">loop</span></code> - Loop Handling","Loading Precomputed Objects","Generate <code class=\"docutils literal\"><span class=\"pre\">ost.mol.mm</span></code> systems","Structural Data","Sampling Dihedral Angles","Modelling Algorithms","Handling Gaps","<code class=\"docutils literal\"><span class=\"pre\">modelling</span></code> - Protein Modelling","Handling Loop Candidates","Fitting Loops Into Gaps","Model Checking","Generating Loops De Novo","Modelling Pipeline","Sidechain Reconstruction","Using Binary Files In ProMod3","References","All Atom Scorers","Backbone Score Environment","Backbone Scorers","<code class=\"docutils literal\"><span class=\"pre\">scoring</span></code> - Loop Scoring","Other Scoring Functions","Disulfid Bond Evaluation","Frame","Rotamer Graph","<code class=\"docutils literal\"><span class=\"pre\">sidechain</span></code> - Sidechain Modelling","Loading Rotamer Libraries","Rotamers","Rotamer Constructor","RotamerID","Rotamer Library","Subrotamer Optimization","Documentation For Users"],titleterms:{"class":[21,22,26,27,29,31,36,39,40,41],"default":35,"function":[4,9,11,12,29,36,40,43],acid:[21,25,27],action:[0,1,4,5,7,8],actiontestcas:1,algorithm:28,all:[21,32,39],allatomclashscor:39,allatomenv:21,allatomenvposit:21,allatominteractionscor:39,allatomoverallscor:39,allatompackingscor:39,allatomposit:21,allatomscor:39,amino:[21,25,27],angl:27,api:1,argument:13,atom:[21,32,39],backbon:[32,40,41,52],backbonelist:22,backboneoverallscor:41,backbonescor:41,backbonescoreenv:40,base:[26,39,41],binari:37,block:[28,49],bond:44,branch:16,build:[0,2,5,7,35,49],can:51,candid:31,cbetascor:41,cbpackingscor:41,ccd:32,chain:26,changelog:3,check:33,clashscor:41,closer:34,cmake:[1,2,4,16],code:37,command:13,compound:[5,7],configur:52,construct:[40,50],constructor:50,contain:6,contribut:8,conveni:40,cooler:34,core:12,creat:[1,25],data:[26,37],databas:26,defin:[26,27],definit:4,depend:[2,52],detect:33,develop:17,dihedr:27,directori:16,distinguish:21,disulfid:44,docker:5,document:[4,8,17,19,54],entri:52,environ:40,evalu:44,everyth:11,exampl:[31,37],execut:1,exisit:37,extend:29,featur:[8,26],file:[11,37],find:26,fit:32,forcefield:25,fragment:26,frame:[45,50],from:43,gap:[29,32],gener:[25,34],geometr:26,geometri:9,get:[18,51],git:16,graph:[10,46],group:49,handl:[21,23,29,31,35],have:1,hbondscor:41,header:37,helper:11,hook:16,how:[8,51],imag:[5,7],instal:2,integr:1,introduct:[4,11,13],issu:8,keep:31,kic:32,librari:[5,7,48,52],licens:[8,20],line:13,load:[24,48],lookup:25,loop:[22,23,25,31,32,34,42],loopcandid:31,mainten:4,make:[1,2],messag:11,minim:10,model:[0,18,28,30,31,33,35,47],modul:[4,8],mol:25,molprob:33,must:1,non:52,novo:[28,34],object:[24,34,45],optim:53,ost:[5,7,25],other:43,output:1,own:8,pairwis:40,pairwisescor:41,pars:13,parser:13,parti:8,particl:49,pipelin:[18,35],pm3argpars:13,portabl:37,posit:21,precomput:24,profil:14,promod3:[0,2,4,6,8,12,16,18,19,37],protein:30,psipredpredict:26,punch:33,quick:8,raw:35,reconstruct:36,reducedscor:41,refer:38,relax:32,releas:3,repres:22,residu:50,rigid:28,ring:33,rotam:[46,48,49,50,52],rotamerid:51,run:[1,2,5,7,18],runtim:14,sampl:27,sampler:[27,34],score:[31,40,42,43],scorer:[8,34,39,41],script:[1,5,7],scwrl3:43,sequenc:26,setcompoundschemlib:15,setup:16,share:[4,11],sidechain:[0,36,47],sidechainreconstructiondata:36,sidechainreconstructor:36,singular:7,smallest:49,ssagreementscor:41,stage:16,start:[8,18],step:35,structur:[16,26],subclass:1,subrotam:53,system:25,test:[1,4,8,11],test_act:1,third:8,torsion:27,torsionscor:41,track:31,triplet:27,type:52,unit:[1,4,8],user:54,write:8,your:8}}) \ No newline at end of file diff --git a/doc/html/sidechain/disulfid.html b/doc/html/sidechain/disulfid.html index 0d6a6e1c..40a2bd96 100644 --- a/doc/html/sidechain/disulfid.html +++ b/doc/html/sidechain/disulfid.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Disulfid Bond Evaluation — ProMod3 1.2.0 documentation</title> + <title>Disulfid Bond Evaluation — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="sidechain - Sidechain Modelling" href="index.html" /> <link rel="next" title="Loading Rotamer Libraries" href="loading.html" /> <link rel="prev" title="Rotamer Graph" href="graph.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -171,9 +173,6 @@ describe the optimal rotamers in the according rotamer groups.</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -184,8 +183,8 @@ describe the optimal rotamers in the according rotamer groups.</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/sidechain/disulfid.txt" diff --git a/doc/html/sidechain/frame.html b/doc/html/sidechain/frame.html index a2b34846..f43158c0 100644 --- a/doc/html/sidechain/frame.html +++ b/doc/html/sidechain/frame.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Frame — ProMod3 1.2.0 documentation</title> + <title>Frame — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="sidechain - Sidechain Modelling" href="index.html" /> <link rel="next" title="Rotamer Library" href="rotamer_lib.html" /> <link rel="prev" title="Rotamers" href="rotamer.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -160,9 +162,6 @@ can be passed to rotamer groups for calculating frame energies.</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -173,8 +172,8 @@ can be passed to rotamer groups for calculating frame energies.</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/sidechain/frame.txt" diff --git a/doc/html/sidechain/graph.html b/doc/html/sidechain/graph.html index e90aa3a9..c0032b48 100644 --- a/doc/html/sidechain/graph.html +++ b/doc/html/sidechain/graph.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Rotamer Graph — ProMod3 1.2.0 documentation</title> + <title>Rotamer Graph — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="sidechain - Sidechain Modelling" href="index.html" /> <link rel="next" title="Disulfid Bond Evaluation" href="disulfid.html" /> <link rel="prev" title="Rotamer Constructor" href="rotamer_constructor.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -111,9 +113,6 @@ conformations for every amino acid position.</td> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -124,8 +123,8 @@ conformations for every amino acid position.</td> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/sidechain/graph.txt" diff --git a/doc/html/sidechain/index.html b/doc/html/sidechain/index.html index bbe62850..e4fe610f 100644 --- a/doc/html/sidechain/index.html +++ b/doc/html/sidechain/index.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>sidechain - Sidechain Modelling — ProMod3 1.2.0 documentation</title> + <title>sidechain - Sidechain Modelling — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="Documentation For Users" href="../users.html" /> <link rel="next" title="RotamerID" href="rotamer_id.html" /> <link rel="prev" title="Modelling Algorithms" href="../modelling/algorithms.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -52,8 +54,8 @@ algorithm using the functionality in the module. Note, that this code will crash as soon as you have structures containing all the weirdness the PDB throws at us. In this case, you should use the full fletched sidechain reconstruction pipelines available in the modelling module.</p> -<div class="highlight-python"><div class="highlight"><pre><span class="kn">from</span> <span class="nn">ost</span> <span class="kn">import</span> <span class="n">io</span><span class="p">,</span><span class="n">mol</span> -<span class="kn">from</span> <span class="nn">promod3</span> <span class="kn">import</span> <span class="n">sidechain</span> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="kn">from</span> <span class="nn">ost</span> <span class="k">import</span> <span class="n">io</span><span class="p">,</span><span class="n">mol</span> +<span class="kn">from</span> <span class="nn">promod3</span> <span class="k">import</span> <span class="n">sidechain</span> <span class="c1"># load a protein</span> <span class="n">prot</span> <span class="o">=</span> <span class="n">io</span><span class="o">.</span><span class="n">LoadPDB</span><span class="p">(</span><span class="s1">'data/1CRN.pdb'</span><span class="p">)</span> @@ -61,10 +63,10 @@ pipelines available in the modelling module.</p> <span class="n">library</span> <span class="o">=</span> <span class="n">sidechain</span><span class="o">.</span><span class="n">LoadBBDepLib</span><span class="p">()</span> <span class="c1"># we need a rotamer constructor to create any rotamers or </span> <span class="c1"># frame residues </span> -<span class="n">rot_constructor</span> <span class="o">=</span> <span class="n">sidechain</span><span class="o">.</span><span class="n">SCWRLRotamerConstructor</span><span class="p">(</span><span class="bp">False</span><span class="p">)</span> +<span class="n">rot_constructor</span> <span class="o">=</span> <span class="n">sidechain</span><span class="o">.</span><span class="n">SCWRLRotamerConstructor</span><span class="p">(</span><span class="kc">False</span><span class="p">)</span> <span class="c1"># create new entity from protein only containing the amino acids</span> -<span class="n">prot</span> <span class="o">=</span> <span class="n">mol</span><span class="o">.</span><span class="n">CreateEntityFromView</span><span class="p">(</span><span class="n">prot</span><span class="o">.</span><span class="n">Select</span><span class="p">(</span><span class="s2">"peptide=true"</span><span class="p">),</span> <span class="bp">True</span><span class="p">)</span> +<span class="n">prot</span> <span class="o">=</span> <span class="n">mol</span><span class="o">.</span><span class="n">CreateEntityFromView</span><span class="p">(</span><span class="n">prot</span><span class="o">.</span><span class="n">Select</span><span class="p">(</span><span class="s2">"peptide=true"</span><span class="p">),</span> <span class="kc">True</span><span class="p">)</span> <span class="c1"># gather some data, the rotamer ids and backbone torsion angles</span> <span class="n">torsion_angles</span> <span class="o">=</span> <span class="nb">list</span><span class="p">()</span> @@ -205,9 +207,6 @@ pipelines available in the modelling module.</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -218,8 +217,8 @@ pipelines available in the modelling module.</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/sidechain/index.txt" diff --git a/doc/html/sidechain/loading.html b/doc/html/sidechain/loading.html index 4abbd843..e45d778f 100644 --- a/doc/html/sidechain/loading.html +++ b/doc/html/sidechain/loading.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Loading Rotamer Libraries — ProMod3 1.2.0 documentation</title> + <title>Loading Rotamer Libraries — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="sidechain - Sidechain Modelling" href="index.html" /> <link rel="next" title="Subrotamer Optimization" href="subrotamer_optimizer.html" /> <link rel="prev" title="Disulfid Bond Evaluation" href="disulfid.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -150,9 +152,6 @@ incomplete if the last problem gets triggered.</td> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -163,8 +162,8 @@ incomplete if the last problem gets triggered.</td> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/sidechain/loading.txt" diff --git a/doc/html/sidechain/rotamer.html b/doc/html/sidechain/rotamer.html index 77b98022..05a35906 100644 --- a/doc/html/sidechain/rotamer.html +++ b/doc/html/sidechain/rotamer.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Rotamers — ProMod3 1.2.0 documentation</title> + <title>Rotamers — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="sidechain - Sidechain Modelling" href="index.html" /> <link rel="next" title="Frame" href="frame.html" /> <link rel="prev" title="RotamerID" href="rotamer_id.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -1216,9 +1218,6 @@ rotamers with <em>self_energy</em> > <em>l_e</em> + <em>thresh</em></p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -1229,8 +1228,8 @@ rotamers with <em>self_energy</em> > <em>l_e</em> + <em>thresh</em></p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/sidechain/rotamer.txt" diff --git a/doc/html/sidechain/rotamer_constructor.html b/doc/html/sidechain/rotamer_constructor.html index 67893a18..f787eed4 100644 --- a/doc/html/sidechain/rotamer_constructor.html +++ b/doc/html/sidechain/rotamer_constructor.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Rotamer Constructor — ProMod3 1.2.0 documentation</title> + <title>Rotamer Constructor — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="sidechain - Sidechain Modelling" href="index.html" /> <link rel="next" title="Rotamer Graph" href="graph.html" /> <link rel="prev" title="Rotamer Library" href="rotamer_lib.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -360,9 +362,6 @@ to be assigned</td> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -373,8 +372,8 @@ to be assigned</td> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/sidechain/rotamer_constructor.txt" diff --git a/doc/html/sidechain/rotamer_id.html b/doc/html/sidechain/rotamer_id.html index 8cfa78a5..d63d36c4 100644 --- a/doc/html/sidechain/rotamer_id.html +++ b/doc/html/sidechain/rotamer_id.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>RotamerID — ProMod3 1.2.0 documentation</title> + <title>RotamerID — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="sidechain - Sidechain Modelling" href="index.html" /> <link rel="next" title="Rotamers" href="rotamer.html" /> <link rel="prev" title="sidechain - Sidechain Modelling" href="index.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -175,9 +177,6 @@ defined in <a class="reference external" href="https://www.openstructure.org/doc <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -188,8 +187,8 @@ defined in <a class="reference external" href="https://www.openstructure.org/doc ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/sidechain/rotamer_id.txt" diff --git a/doc/html/sidechain/rotamer_lib.html b/doc/html/sidechain/rotamer_lib.html index 28ed4bbb..ef5d1822 100644 --- a/doc/html/sidechain/rotamer_lib.html +++ b/doc/html/sidechain/rotamer_lib.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Rotamer Library — ProMod3 1.2.0 documentation</title> + <title>Rotamer Library — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="sidechain - Sidechain Modelling" href="index.html" /> <link rel="next" title="Rotamer Constructor" href="rotamer_constructor.html" /> <link rel="prev" title="Frame" href="frame.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -81,7 +83,7 @@ less machine-dependent).</p> <tr class="field-odd field"><th class="field-name">Return type:</th><td class="field-body"><a class="reference internal" href="#promod3.sidechain.RotamerLib" title="promod3.sidechain.RotamerLib"><code class="xref py py-class docutils literal"><span class="pre">RotamerLib</span></code></a></td> </tr> <tr class="field-even field"><th class="field-name">Raises:</th><td class="field-body"><a class="reference external" href="https://docs.python.org/2.7/library/exceptions.html#exceptions.RuntimeError" title="(in Python v2.7)"><code class="xref py py-exc docutils literal"><span class="pre">RuntimeError</span></code></a> if file cannot be opened or if -file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> for details).</td> +file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details).</td> </tr> </tbody> </table> @@ -93,7 +95,7 @@ file cannot be parsed (see <a class="reference internal" href="../portableIO.htm <dt id="promod3.sidechain.RotamerLib.SavePortable"> <code class="descname">SavePortable</code><span class="sig-paren">(</span><em>filename</em><span class="sig-paren">)</span><a class="headerlink" href="#promod3.sidechain.RotamerLib.SavePortable" title="Permalink to this definition">¶</a></dt> <dd><p>Saves a raw / portable binary representation. Use portable files for -distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> +distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details.</p> <table class="docutils field-list" frame="void" rules="none"> <col class="field-name" /> @@ -201,7 +203,7 @@ less machine-dependent).</p> <tr class="field-odd field"><th class="field-name">Return type:</th><td class="field-body"><a class="reference internal" href="#promod3.sidechain.BBDepRotamerLib" title="promod3.sidechain.BBDepRotamerLib"><code class="xref py py-class docutils literal"><span class="pre">BBDepRotamerLib</span></code></a></td> </tr> <tr class="field-even field"><th class="field-name">Raises:</th><td class="field-body"><a class="reference external" href="https://docs.python.org/2.7/library/exceptions.html#exceptions.RuntimeError" title="(in Python v2.7)"><code class="xref py py-exc docutils literal"><span class="pre">RuntimeError</span></code></a> if file cannot be opened or if -file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> for details).</td> +file cannot be parsed (see <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details).</td> </tr> </tbody> </table> @@ -213,7 +215,7 @@ file cannot be parsed (see <a class="reference internal" href="../portableIO.htm <dt id="promod3.sidechain.BBDepRotamerLib.SavePortable"> <code class="descname">SavePortable</code><span class="sig-paren">(</span><em>filename</em><span class="sig-paren">)</span><a class="headerlink" href="#promod3.sidechain.BBDepRotamerLib.SavePortable" title="Permalink to this definition">¶</a></dt> <dd><p>Saves a raw / portable binary representation. Use portable files for -distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span>here</span></a> +distribution and convert locally to raw files. See <a class="reference internal" href="../portableIO.html#portableio"><span class="std std-ref">here</span></a> for details.</p> <table class="docutils field-list" frame="void" rules="none"> <col class="field-name" /> @@ -711,9 +713,6 @@ valid and non rotameric, INVALID otherwise.</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -724,8 +723,8 @@ valid and non rotameric, INVALID otherwise.</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/sidechain/rotamer_lib.txt" diff --git a/doc/html/sidechain/subrotamer_optimizer.html b/doc/html/sidechain/subrotamer_optimizer.html index 91795b7e..9527a393 100644 --- a/doc/html/sidechain/subrotamer_optimizer.html +++ b/doc/html/sidechain/subrotamer_optimizer.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Subrotamer Optimization — ProMod3 1.2.0 documentation</title> + <title>Subrotamer Optimization — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="../_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="../_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: '../', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,16 +24,18 @@ <script type="text/javascript" src="../_static/underscore.js"></script> <script type="text/javascript" src="../_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="../index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="../index.html" /> <link rel="up" title="sidechain - Sidechain Modelling" href="index.html" /> <link rel="next" title="scoring - Loop Scoring" href="../scoring/index.html" /> <link rel="prev" title="Loading Rotamer Libraries" href="loading.html" /> + <link rel="stylesheet" href="../_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -117,9 +119,6 @@ internal <a class="reference internal" href="graph.html#promod3.sidechain.Rotame <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -130,8 +129,8 @@ internal <a class="reference internal" href="graph.html#promod3.sidechain.Rotame ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="../_sources/sidechain/subrotamer_optimizer.txt" diff --git a/doc/html/users.html b/doc/html/users.html index 2de97d20..241d3631 100644 --- a/doc/html/users.html +++ b/doc/html/users.html @@ -6,7 +6,7 @@ <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> - <title>Documentation For Users — ProMod3 1.2.0 documentation</title> + <title>Documentation For Users — ProMod3 1.3.0 documentation</title> <link rel="stylesheet" href="_static/alabaster.css" type="text/css" /> <link rel="stylesheet" href="_static/pygments.css" type="text/css" /> @@ -14,7 +14,7 @@ <script type="text/javascript"> var DOCUMENTATION_OPTIONS = { URL_ROOT: './', - VERSION: '1.2.0', + VERSION: '1.3.0', COLLAPSE_INDEX: false, FILE_SUFFIX: '.html', HAS_SOURCE: true @@ -24,15 +24,17 @@ <script type="text/javascript" src="_static/underscore.js"></script> <script type="text/javascript" src="_static/doctools.js"></script> <script type="text/javascript" src="https://cdnjs.cloudflare.com/ajax/libs/mathjax/2.7.5/MathJax.js?config=TeX-MML-AM_CHTML"></script> - <link rel="top" title="ProMod3 1.2.0 documentation" href="index.html" /> + <link rel="top" title="ProMod3 1.3.0 documentation" href="index.html" /> <link rel="next" title="Getting Started" href="gettingstarted.html" /> <link rel="prev" title="ProMod3" href="index.html" /> + <link rel="stylesheet" href="_static/custom.css" type="text/css" /> <meta name="viewport" content="width=device-width, initial-scale=0.9, maximum-scale=0.9" /> </head> - <body role="document"> + <body role="document"> + <div class="document"> <div class="documentwrapper"> @@ -149,9 +151,6 @@ scripts using the functionality of this library.</p> <input type="hidden" name="check_keywords" value="yes" /> <input type="hidden" name="area" value="default" /> </form> - <p class="searchtip" style="font-size: 90%"> - Enter search terms or a module, class or function name. - </p> </div> <script type="text/javascript">$('#searchbox').show(0);</script> </div> @@ -162,8 +161,8 @@ scripts using the functionality of this library.</p> ©2013-2018, SIB - Swiss Institute of Bioinformatics and Biozentrum - University of Basel. | - Powered by <a href="http://sphinx-doc.org/">Sphinx 1.3.6</a> - & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.7</a> + Powered by <a href="http://sphinx-doc.org/">Sphinx 1.4.1</a> + & <a href="https://github.com/bitprophet/alabaster">Alabaster 0.7.8</a> | <a href="_sources/users.txt" -- GitLab