diff --git a/CHANGELOG.txt b/CHANGELOG.txt
index 01e85e9cf5e605b142e1f032f30eb99e1776bf61..5f9bc2b36e8823186f9f2df44f2a706239cfbc37 100644
--- a/CHANGELOG.txt
+++ b/CHANGELOG.txt
@@ -1,3 +1,23 @@
+Changes in Release 2.6.0
+--------------------------------------------------------------------------------
+
+ * Reporting of unassigned ligands in the LigandScorer.
+ * Experimental support for V3000 SDF files.
+ * Rotamer based compression in OMF file format.
+ * Chain mapping updates. Default chain mapping strategy now uses increased
+ sampling - only marginal runtime increase.
+ * The compound library now knows about SMILES strings, atom charges, and
+ contain information that a compound is obsolete (including the replacement,
+ if available). Compound libraries created by OST 1.5.0 or later can still be
+ read (SMILES will be empty, charges set to 0, no information about the
+ obsolete status of compounds, with warnings). Older files are no
+ longer supported.
+ * New FindCompounds method of CompoundLib to query compounds by SMILES
+ string, InChI code, InChI key or formula.
+ * The compound library now reads the "InChI=" part of InChI codes.
+ * Implemented ICS/IPS scores to assess oligomeric complexes.
+ * Several bug fixes and improvements.
+
Changes in Release 2.5.0
--------------------------------------------------------------------------------
diff --git a/CMakeLists.txt b/CMakeLists.txt
index aa7daa5413e1039eb3ec3181d824caa050686f3a..f8dc63080242f57e5c5edf4fa34c9db0a72c4f77 100644
--- a/CMakeLists.txt
+++ b/CMakeLists.txt
@@ -14,7 +14,7 @@ cmake_policy(SET CMP0060 NEW)
project(OpenStructure CXX C)
set (CMAKE_EXPORT_COMPILE_COMMANDS 1)
set (OST_VERSION_MAJOR 2)
-set (OST_VERSION_MINOR 5)
+set (OST_VERSION_MINOR 6)
set (OST_VERSION_PATCH 0)
set (OST_VERSION_STRING ${OST_VERSION_MAJOR}.${OST_VERSION_MINOR}.${OST_VERSION_PATCH} )
set(CMAKE_MODULE_PATH ${CMAKE_MODULE_PATH} ${PROJECT_SOURCE_DIR}/cmake_support)
@@ -329,6 +329,7 @@ add_subdirectory(modules)
add_subdirectory(scripts)
add_subdirectory(tools)
add_subdirectory(actions)
+add_subdirectory(doxygen)
# deployment has to come last, to ensure that all install commands are run before deployment
# magic is done
add_subdirectory(deployment)
diff --git a/actions/ost-compare-ligand-structures b/actions/ost-compare-ligand-structures
index 176cd5e1f6028c096d9b1bdc3dbd4b6f3fdce673..17a16f229ea6336d4ed4b304e0a17d4de67ac20d 100644
--- a/actions/ost-compare-ligand-structures
+++ b/actions/ost-compare-ligand-structures
@@ -48,7 +48,8 @@ options, this is a dictionary with three keys:
Each score is opt-in and, be enabled with optional arguments and is added
to the output. Keys correspond to the values in "model_ligands" above.
-Only assigned (mapped) ligands are reported.
+Unassigned ligands are reported with a message in "unassigned_model_ligands"
+and "unassigned_reference_ligands".
"""
import argparse
@@ -167,13 +168,20 @@ def _ParseArgs():
action="store_true",
help=("Allow incomplete target ligands."))
+ parser.add_argument(
+ "-cd",
+ "--coverage-delta",
+ dest="coverage_delta",
+ default=False,
+ action="store_true",
+ help=("Allow incomplete target ligands."))
+
parser.add_argument(
"-gcm",
"--global-chain-mapping",
dest="global_chain_mapping",
- default=False,
- action="store_true",
- help=("Use a global chain mapping."))
+ default=0.2,
+ help=("Coverage delta for partial ligand assignment."))
parser.add_argument(
"-c",
@@ -193,6 +201,16 @@ def _ParseArgs():
action="store_true",
help=("Use RMSD for ligand assignment."))
+ parser.add_argument(
+ "-u",
+ "--unassigned",
+ dest="unassigned",
+ default=False,
+ action="store_true",
+ help=("Report unassigned model ligands in the output together with "
+ "assigned ligands, with a null score, and reason for not being "
+ "assigned."))
+
parser.add_argument(
"--lddt-pli",
dest="lddt_pli",
@@ -224,7 +242,7 @@ def _ParseArgs():
parser.add_argument(
"--lddt-lp-radius",
dest="lddt_lp_radius",
- default=4.0,
+ default=10.0,
help=("lDDT inclusion radius for lDDT-LP."))
parser.add_argument(
@@ -352,8 +370,10 @@ def _Process(model, model_ligands, reference, reference_ligands, args):
check_resnames=args.enforce_consistency,
rename_ligand_chain=True,
substructure_match=args.substructure_match,
+ coverage_delta=args.coverage_delta,
global_chain_mapping=args.global_chain_mapping,
rmsd_assignment=args.rmsd_assignment,
+ unassigned=args.unassigned,
radius=args.radius,
lddt_pli_radius=args.lddt_pli_radius,
lddt_lp_radius=args.lddt_lp_radius,
@@ -367,8 +387,6 @@ def _Process(model, model_ligands, reference, reference_ligands, args):
# Replace model ligand by path
if len(model_ligands) == len(scorer.model_ligands):
# Map ligand => path
- model_ligands_map = {k: v for k, v in zip(scorer.model_ligands,
- args.model_ligands)}
out["model_ligands"] = args.model_ligands
elif len(model_ligands) < len(scorer.model_ligands):
# Multi-ligand SDF files were given
@@ -384,16 +402,16 @@ def _Process(model, model_ligands, reference, reference_ligands, args):
"(%d) than given (%d)" % (
len(scorer.model_ligands), len(model_ligands)))
else:
- model_ligands_map = {l: _QualifiedResidueNotation(l)
- for l in scorer.model_ligands}
- out["model_ligands"] = list(model_ligands_map.values())
+ # Map ligand => qualified residue
+ out["model_ligands"] = [_QualifiedResidueNotation(l) for l in scorer.model_ligands]
+
+ model_ligands_map = {k.hash_code: v for k, v in zip(
+ scorer.model_ligands, out["model_ligands"])}
if reference_ligands is not None:
# Replace reference ligand by path
if len(reference_ligands) == len(scorer.target_ligands):
# Map ligand => path
- reference_ligands_map = {k: v for k, v in zip(scorer.target_ligands,
- args.reference_ligands)}
out["reference_ligands"] = args.reference_ligands
elif len(reference_ligands) < len(scorer.target_ligands):
# Multi-ligand SDF files were given
@@ -410,53 +428,83 @@ def _Process(model, model_ligands, reference, reference_ligands, args):
len(scorer.target_ligands), len(reference_ligands)))
else:
- reference_ligands_map = {l: _QualifiedResidueNotation(l)
- for l in scorer.target_ligands}
- out["reference_ligands"] = list(reference_ligands_map.values())
+ # Map ligand => qualified residue
+ out["reference_ligands"] = [_QualifiedResidueNotation(l) for l in scorer.target_ligands]
+
+ reference_ligands_map = {k.hash_code: v for k, v in zip(
+ scorer.target_ligands, out["reference_ligands"])}
+
+
+ if not (args.lddt_pli or args.rmsd):
+ ost.LogWarning("No score selected, output will be empty.")
+ else:
+ out["unassigned_model_ligands"] = {}
+ for chain, unassigned_residues in scorer.unassigned_model_ligands.items():
+ for resnum, unassigned in unassigned_residues.items():
+ mdl_lig = scorer.model.FindResidue(chain, resnum)
+ out["unassigned_model_ligands"][model_ligands_map[
+ mdl_lig.hash_code]] = unassigned
+ out["unassigned_reference_ligands"] = {}
+ for chain, unassigned_residues in scorer.unassigned_target_ligands.items():
+ for resnum, unassigned in unassigned_residues.items():
+ trg_lig = scorer.target.FindResidue(chain, resnum)
+ out["unassigned_reference_ligands"][reference_ligands_map[
+ trg_lig.hash_code]] = unassigned
+ out["unassigned_model_ligand_descriptions"] = scorer.unassigned_model_ligand_descriptions
+ out["unassigned_reference_ligand_descriptions"] = scorer.unassigned_target_ligand_descriptions
+
if args.lddt_pli:
out["lddt_pli"] = {}
for chain, lddt_pli_results in scorer.lddt_pli_details.items():
- for _, lddt_pli in lddt_pli_results.items():
- model_key = model_ligands_map[lddt_pli["model_ligand"]]
- lddt_pli["reference_ligand"] = reference_ligands_map[
- lddt_pli.pop("target_ligand")]
- lddt_pli["model_ligand"] = model_key
- transform_data = lddt_pli["transform"].data
- lddt_pli["transform"] = [transform_data[i:i + 4]
- for i in range(0, len(transform_data),
- 4)]
- lddt_pli["bs_ref_res"] = [_QualifiedResidueNotation(r) for r in
- lddt_pli["bs_ref_res"]]
- lddt_pli["bs_ref_res_mapped"] = [_QualifiedResidueNotation(r) for r in
- lddt_pli["bs_ref_res_mapped"]]
- lddt_pli["bs_mdl_res_mapped"] = [_QualifiedResidueNotation(r) for r in
- lddt_pli["bs_mdl_res_mapped"]]
- lddt_pli["inconsistent_residues"] = ["%s-%s" %(
- _QualifiedResidueNotation(x), _QualifiedResidueNotation(y)) for x,y in lddt_pli[
- "inconsistent_residues"]]
+ for resnum, lddt_pli in lddt_pli_results.items():
+ if args.unassigned and lddt_pli["unassigned"]:
+ mdl_lig = scorer.model.FindResidue(chain, resnum)
+ model_key = model_ligands_map[mdl_lig.hash_code]
+ else:
+ model_key = model_ligands_map[lddt_pli["model_ligand"].hash_code]
+ lddt_pli["reference_ligand"] = reference_ligands_map[
+ lddt_pli.pop("target_ligand").hash_code]
+ lddt_pli["model_ligand"] = model_key
+ transform_data = lddt_pli["transform"].data
+ lddt_pli["transform"] = [transform_data[i:i + 4]
+ for i in range(0, len(transform_data),
+ 4)]
+ lddt_pli["bs_ref_res"] = [_QualifiedResidueNotation(r) for r in
+ lddt_pli["bs_ref_res"]]
+ lddt_pli["bs_ref_res_mapped"] = [_QualifiedResidueNotation(r) for r in
+ lddt_pli["bs_ref_res_mapped"]]
+ lddt_pli["bs_mdl_res_mapped"] = [_QualifiedResidueNotation(r) for r in
+ lddt_pli["bs_mdl_res_mapped"]]
+ lddt_pli["inconsistent_residues"] = ["%s-%s" %(
+ _QualifiedResidueNotation(x), _QualifiedResidueNotation(y)) for x,y in lddt_pli[
+ "inconsistent_residues"]]
out["lddt_pli"][model_key] = lddt_pli
if args.rmsd:
out["rmsd"] = {}
for chain, rmsd_results in scorer.rmsd_details.items():
for _, rmsd in rmsd_results.items():
- model_key = model_ligands_map[rmsd["model_ligand"]]
- rmsd["reference_ligand"] = reference_ligands_map[
- rmsd.pop("target_ligand")]
- rmsd["model_ligand"] = model_key
- transform_data = rmsd["transform"].data
- rmsd["transform"] = [transform_data[i:i + 4]
- for i in range(0, len(transform_data), 4)]
- rmsd["bs_ref_res"] = [_QualifiedResidueNotation(r) for r in
- rmsd["bs_ref_res"]]
- rmsd["bs_ref_res_mapped"] = [_QualifiedResidueNotation(r) for r in
- rmsd["bs_ref_res_mapped"]]
- rmsd["bs_mdl_res_mapped"] = [_QualifiedResidueNotation(r) for r in
- rmsd["bs_mdl_res_mapped"]]
- rmsd["inconsistent_residues"] = ["%s-%s" %(
- _QualifiedResidueNotation(x), _QualifiedResidueNotation(y)) for x,y in rmsd[
- "inconsistent_residues"]]
+ if args.unassigned and rmsd["unassigned"]:
+ mdl_lig = scorer.model.FindResidue(chain, resnum)
+ model_key = model_ligands_map[mdl_lig.hash_code]
+ else:
+ model_key = model_ligands_map[rmsd["model_ligand"].hash_code]
+ rmsd["reference_ligand"] = reference_ligands_map[
+ rmsd.pop("target_ligand").hash_code]
+ rmsd["model_ligand"] = model_key
+ transform_data = rmsd["transform"].data
+ rmsd["transform"] = [transform_data[i:i + 4]
+ for i in range(0, len(transform_data), 4)]
+ rmsd["bs_ref_res"] = [_QualifiedResidueNotation(r) for r in
+ rmsd["bs_ref_res"]]
+ rmsd["bs_ref_res_mapped"] = [_QualifiedResidueNotation(r) for r in
+ rmsd["bs_ref_res_mapped"]]
+ rmsd["bs_mdl_res_mapped"] = [_QualifiedResidueNotation(r) for r in
+ rmsd["bs_mdl_res_mapped"]]
+ rmsd["inconsistent_residues"] = ["%s-%s" %(
+ _QualifiedResidueNotation(x), _QualifiedResidueNotation(y)) for x,y in rmsd[
+ "inconsistent_residues"]]
out["rmsd"][model_key] = rmsd
return out
diff --git a/actions/ost-compare-structures b/actions/ost-compare-structures
index 48d33839e43ff0dba2fb1f5e259ea95bce9d9d3d..fbae451dcb0dcaf34f906674b84d22c3063ad67a 100644
--- a/actions/ost-compare-structures
+++ b/actions/ost-compare-structures
@@ -297,13 +297,112 @@ def _ParseArgs():
help=("Path to USalign executable to compute TM-score. If not given, "
"an OpenStructure internal copy of USalign code is used."))
+ parser.add_argument(
+ "--override-usalign-mapping",
+ dest="oum",
+ default=False,
+ action="store_true",
+ help=("Override USalign mapping and inject our own mapping. Only works "
+ "if external usalign executable is provided that is reasonably "
+ "new and contains that feature."))
+
parser.add_argument(
"--qs-score",
dest="qs_score",
default=False,
action="store_true",
help=("Compute QS-score, stored as key \"qs_global\", and the QS-best "
- "variant, stored as key \"qs_best\"."))
+ "variant, stored as key \"qs_best\". Interfaces in the reference "
+ "with non-zero contribution to QS-score are available as key "
+ "\"qs_reference_interfaces\", the ones from the model as key "
+ "\"qs_model_interfaces\". \"qs_interfaces\" is a subset of "
+ "\"qs_reference_interfaces\" that contains interfaces that "
+ "can be mapped to the model. They are stored as lists in format "
+ "[ref_ch1, ref_ch2, mdl_ch1, mdl_ch2]. The respective "
+ "per-interface scores for \"qs_interfaces\" are available as "
+ "keys \"per_interface_qs_global\" and \"per_interface_qs_best\""))
+
+ parser.add_argument(
+ "--dockq",
+ dest="dockq",
+ default=False,
+ action="store_true",
+ help=("Compute DockQ scores and its components. Relevant interfaces "
+ "with at least one contact (any atom within 5A) of the reference "
+ "structure are available as key \"dockq_reference_interfaces\". "
+ "Only interfaces between peptide chains are considered here! "
+ "Key \"dockq_interfaces\" is a subset of "
+ "\"dockq_reference_interfaces\" that contains interfaces that "
+ "can be mapped to the model. They are stored as lists in format "
+ "[ref_ch1, ref_ch2, mdl_ch1, mdl_ch2]. The respective "
+ "DockQ scores for \"dockq_interfaces\" are available as key "
+ "\"dockq\". It's components are available as keys: "
+ "\"fnat\" (fraction of reference contacts which are also there "
+ "in model) \"irmsd\" (interface RMSD), \"lrmsd\" (ligand RMSD). "
+ "The DockQ score is strictly designed to score each interface "
+ "individually. We also provide two averaged versions to get one "
+ "full model score: \"dockq_ave\", \"dockq_wave\". The first is "
+ "simply the average of \"dockq_scores\", the latter is a "
+ "weighted average with weights derived from number of contacts "
+ "in the reference interfaces. These two scores only consider "
+ "interfaces that are present in both, the model and the "
+ "reference. \"dockq_ave_full\" and \"dockq_wave_full\" add zeros "
+ "in the average computation for each interface that is only "
+ "present in the reference but not in the model."))
+
+ parser.add_argument(
+ "--ics",
+ dest="ics",
+ default=False,
+ action="store_true",
+ help=("Computes interface contact similarity (ICS) related scores. "
+ "A contact between two residues of different chains is defined "
+ "as having at least one heavy atom within 5A. Contacts in "
+ "reference structure are available as key "
+ "\"reference_contacts\". Each contact specifies the interacting "
+ "residues in format \"<cname>.<rnum>.<ins_code>\". Model "
+ "contacts are available as key \"model_contacts\". The precision "
+ "which is available as key \"ics_precision\" reports the "
+ "fraction of model contacts that are also present in the "
+ "reference. The recall which is available as key \"ics_recall\" "
+ "reports the fraction of reference contacts that are correctly "
+ "reproduced in the model. "
+ "The ICS score (Interface Contact Similarity) available as key "
+ "\"ics\" combines precision and recall using the F1-measure. "
+ "All these measures are also available on a per-interface basis "
+ "for each interface in the reference structure that are defined "
+ "as chain pairs with at least one contact (available as key "
+ " \"contact_reference_interfaces\"). The respective metrics are "
+ "available as keys \"per_interface_ics_precision\", "
+ "\"per_interface_ics_recall\" and \"per_interface_ics\"."))
+
+ parser.add_argument(
+ "--ips",
+ dest="ips",
+ default=False,
+ action="store_true",
+ help=("Computes interface patch similarity (IPS) related scores. "
+ "They focus on interface residues. They are defined as having "
+ "at least one contact to a residue from any other chain. "
+ "In short: if they show up in the contact lists used to compute "
+ "ICS. If ips is enabled, these contacts get reported too and are "
+ "available as keys \"reference_contacts\" and \"model_contacts\"."
+ "The precision which is available as key \"ips_precision\" "
+ "reports the fraction of model interface residues, that are also "
+ "interface residues in the reference. "
+ "The recall which is available as key \"ips_recall\" "
+ "reports the fraction of reference interface residues that are "
+ "also interface residues in the model. "
+ "The IPS score (Interface Patch Similarity) available as key "
+ "\"ips\" is the Jaccard coefficient between interface residues "
+ "in reference and model. "
+ "All these measures are also available on a per-interface basis "
+ "for each interface in the reference structure that are defined "
+ "as chain pairs with at least one contact (available as key "
+ " \"contact_reference_interfaces\"). The respective metrics are "
+ "available as keys \"per_interface_ips_precision\", "
+ "\"per_interface_ips_recall\" and \"per_interface_ips\"."))
+
parser.add_argument(
"--rigid-scores",
@@ -319,36 +418,6 @@ def _ParseArgs():
"these positions and transformation, \"transform\": the used 4x4 "
"transformation matrix that superposes model onto reference."))
- parser.add_argument(
- "--interface-scores",
- dest="interface_scores",
- default=False,
- action="store_true",
- help=("Per interface scores for each interface that has at least one "
- "contact in the reference, i.e. at least one pair of heavy atoms "
- "within 5A. The respective interfaces are available from key "
- "\"interfaces\" which is a list of tuples in form (ref_ch1, "
- "ref_ch2, mdl_ch1, mdl_ch2). Per-interface scores are available "
- "as lists referring to these interfaces and have the following "
- "keys: \"nnat\" (number of contacts in reference), \"nmdl\" "
- "(number of contacts in model), \"fnat\" (fraction of reference "
- "contacts which are also there in model), \"fnonnat\" (fraction "
- "of model contacts which are not there in target), \"irmsd\" "
- "(interface RMSD), \"lrmsd\" (ligand RMSD), \"dockq_scores\" "
- "(per-interface score computed from \"fnat\", \"irmsd\" and "
- "\"lrmsd\"), \"interface_qs_global\" and \"interface_qs_best\" "
- "(per-interface versions of the two QS-score variants). The "
- "DockQ score is strictly designed to score each interface "
- "individually. We also provide two averaged versions to get one "
- "full model score: \"dockq_ave\", \"dockq_wave\". The first is "
- "simply the average of \"dockq_scores\", the latter is a "
- "weighted average with weights derived from \"nnat\". These two "
- "scores only consider interfaces that are present in both, the "
- "model and the reference. \"dockq_ave_full\" and "
- "\"dockq_wave_full\" add zeros in the average computation for "
- "each interface that is only present in the reference but not in "
- "the model."))
-
parser.add_argument(
"--patch-scores",
dest="patch_scores",
@@ -388,14 +457,50 @@ def _ParseArgs():
"--n-max-naive",
dest="n_max_naive",
required=False,
- default=12,
+ default=40320,
type=int,
- help=("If number of chains in model and reference are below or equal "
- "that number, the chain mapping will naively enumerate all "
- "possible mappings. A heuristic is used otherwise."))
+ help=("Parameter for chain mapping. If the number of possible "
+ "mappings is <= *n_max_naive*, the full "
+ "mapping solution space is enumerated to find the "
+ "the mapping with optimal QS-score. A heuristic is used "
+ "otherwise. The default of 40320 corresponds to an octamer "
+ "(8! = 40320). A structure with stoichiometry A6B2 would be "
+ "6!*2! = 1440 etc."))
+
+ parser.add_argument(
+ "--dump-aligned-residues",
+ dest="dump_aligned_residues",
+ default=False,
+ action="store_true",
+ help=("Dump additional info on aligned model and reference residues."))
+ parser.add_argument(
+ "--dump-pepnuc-alns",
+ dest="dump_pepnuc_alns",
+ default=False,
+ action="store_true",
+ help=("Dump alignments of mapped chains but with sequences that did "
+ "not undergo Molck preprocessing in the scorer. Sequences are "
+ "extracted from model/target after undergoing selection for "
+ "peptide and nucleotide residues."))
+
+ parser.add_argument(
+ "--dump-pepnuc-aligned-residues",
+ dest="dump_pepnuc_aligned_residues",
+ default=False,
+ action="store_true",
+ help=("Dump additional info on model and reference residues that occur "
+ "in pepnuc alignments."))
+
return parser.parse_args()
+def _RoundOrNone(num, decimals = 3):
+ """ Helper to create valid JSON output
+ """
+ if num is None:
+ return None
+ return round(num, decimals)
+
def _Rename(ent):
"""Revert chain names to original names.
@@ -489,7 +594,7 @@ def _AlnToFastaStr(aln):
"""
s1 = aln.GetSequence(0)
s2 = aln.GetSequence(1)
- return f">reference:{s1.name}\n{str(s1)}\nmodel:{s2.name}\n{str(s2)}"
+ return f">reference:{s1.name}\n{str(s1)}\n>model:{s2.name}\n{str(s2)}"
def _GetInconsistentResidues(alns):
lst = list()
@@ -516,7 +621,7 @@ def _LocalScoresToJSONDict(score_dict):
for ch, ch_scores in score_dict.items():
for num, s in ch_scores.items():
ins_code = num.ins_code.strip("\u0000")
- json_dict[f"{ch}.{num.num}.{ins_code}"] = s
+ json_dict[f"{ch}.{num.num}.{ins_code}"] = _RoundOrNone(s)
return json_dict
def _InterfaceResiduesToJSONList(interface_dict):
@@ -537,9 +642,45 @@ def _PatchScoresToJSONList(interface_dict, score_dict):
"""
json_list = list()
for ch, ch_nums in interface_dict.items():
- json_list += score_dict[ch]
+ for item in score_dict[ch]:
+ json_list.append(_RoundOrNone(item))
return json_list
+def _GetAlignedResidues(aln):
+ aligned_residues = list()
+ for a in aln:
+ mdl_lst = list()
+ ref_lst = list()
+ for c in a:
+ mdl_r = c.GetResidue(1)
+ ref_r = c.GetResidue(0)
+ if mdl_r.IsValid():
+ olc = mdl_r.one_letter_code
+ num = mdl_r.GetNumber().num
+ ins_code = mdl_r.GetNumber().ins_code.strip("\u0000")
+ mdl_lst.append({"olc": olc,
+ "num": f"{num}.{ins_code}"})
+ else:
+ mdl_lst.append(None)
+
+ if ref_r.IsValid():
+ olc = ref_r.one_letter_code
+ num = ref_r.GetNumber().num
+ ins_code = ref_r.GetNumber().ins_code.strip("\u0000")
+ ref_lst.append({"olc": olc,
+ "num": f"{num}.{ins_code}"})
+ else:
+ ref_lst.append(None)
+
+ mdl_dct = {"chain": a.GetSequence(1).GetName(),
+ "residues": mdl_lst}
+ ref_dct = {"chain": a.GetSequence(0).GetName(),
+ "residues": ref_lst}
+
+ aligned_residues.append({"model": mdl_dct,
+ "reference": ref_dct})
+ return aligned_residues
+
def _Process(model, reference, args):
mapping = None
@@ -552,7 +693,8 @@ def _Process(model, reference, args):
custom_mapping = mapping,
usalign_exec = args.usalign_exec,
lddt_no_stereochecks = args.lddt_no_stereochecks,
- n_max_naive = args.n_max_naive)
+ n_max_naive = args.n_max_naive,
+ oum = args.oum)
ir = _GetInconsistentResidues(scorer.aln)
if len(ir) > 0 and args.enforce_consistency:
@@ -567,8 +709,17 @@ def _Process(model, reference, args):
out["aln"] = [_AlnToFastaStr(aln) for aln in scorer.aln]
out["inconsistent_residues"] = ir
+ if args.dump_aligned_residues:
+ out["aligned_residues"] = _GetAlignedResidues(scorer.aln)
+
+ if args.dump_pepnuc_alns:
+ out["pepnuc_aln"] = [_AlnToFastaStr(aln) for aln in scorer.pepnuc_aln]
+
+ if args.dump_pepnuc_aligned_residues:
+ out["pepnuc_aligned_residues"] = _GetAlignedResidues(scorer.pepnuc_aln)
+
if args.lddt:
- out["lddt"] = scorer.lddt
+ out["lddt"] = _RoundOrNone(scorer.lddt)
if args.local_lddt:
out["local_lddt"] = _LocalScoresToJSONDict(scorer.local_lddt)
@@ -582,7 +733,7 @@ def _Process(model, reference, args):
out["reference_bad_angles"] = [x.ToJSON() for x in scorer.target_bad_angles]
if args.bb_lddt:
- out["bb_lddt"] = scorer.bb_lddt
+ out["bb_lddt"] = _RoundOrNone(scorer.bb_lddt)
if args.bb_local_lddt:
out["bb_local_lddt"] = _LocalScoresToJSONDict(scorer.bb_local_lddt)
@@ -594,32 +745,64 @@ def _Process(model, reference, args):
out["local_cad_score"] = _LocalScoresToJSONDict(scorer.local_cad_score)
if args.qs_score:
- out["qs_global"] = scorer.qs_global
- out["qs_best"] = scorer.qs_best
+ out["qs_global"] = _RoundOrNone(scorer.qs_global)
+ out["qs_best"] = _RoundOrNone(scorer.qs_best)
+ out["qs_reference_interfaces"] = scorer.qs_target_interfaces
+ out["qs_model_interfaces"] = scorer.qs_model_interfaces
+ out["qs_interfaces"] = scorer.qs_interfaces
+ out["per_interface_qs_global"] = \
+ [_RoundOrNone(x) for x in scorer.per_interface_qs_global]
+ out["per_interface_qs_best"] = \
+ [_RoundOrNone(x) for x in scorer.per_interface_qs_best]
+
+ if args.ics or args.ips:
+ out["reference_contacts"] = scorer.native_contacts
+ out["model_contacts"] = scorer.model_contacts
+ out["contact_reference_interfaces"] = scorer.contact_target_interfaces
+
+ if args.ics:
+ out["ics_precision"] = _RoundOrNone(scorer.ics_precision)
+ out["ics_recall"] = _RoundOrNone(scorer.ics_recall)
+ out["ics"] = _RoundOrNone(scorer.ics)
+ out["per_interface_ics_precision"] = \
+ [_RoundOrNone(x) for x in scorer.per_interface_ics_precision]
+ out["per_interface_ics_recall"] = \
+ [_RoundOrNone(x) for x in scorer.per_interface_ics_recall]
+ out["per_interface_ics"] = \
+ [_RoundOrNone(x) for x in scorer.per_interface_ics]
+
+ if args.ips:
+ out["ips_precision"] = _RoundOrNone(scorer.ips_precision)
+ out["ips_recall"] = _RoundOrNone(scorer.ips_recall)
+ out["ips"] = _RoundOrNone(scorer.ips)
+ out["per_interface_ips_precision"] = \
+ [_RoundOrNone(x) for x in scorer.per_interface_ips_precision]
+ out["per_interface_ips_recall"] = \
+ [_RoundOrNone(x) for x in scorer.per_interface_ips_recall]
+ out["per_interface_ips"] = \
+ [_RoundOrNone(x) for x in scorer.per_interface_ips]
+
+ if args.dockq:
+ out["dockq_reference_interfaces"] = scorer.dockq_target_interfaces
+ out["dockq_interfaces"] = scorer.dockq_interfaces
+ out["dockq"] = [_RoundOrNone(x) for x in scorer.dockq_scores]
+ out["fnat"] = [_RoundOrNone(x) for x in scorer.fnat]
+ out["irmsd"] = [_RoundOrNone(x) for x in scorer.irmsd]
+ out["lrmsd"] = [_RoundOrNone(x) for x in scorer.lrmsd]
+ out["nnat"] = scorer.nnat
+ out["nmdl"] = scorer.nmdl
+ out["dockq_ave"] = _RoundOrNone(scorer.dockq_ave)
+ out["dockq_wave"] = _RoundOrNone(scorer.dockq_wave)
+ out["dockq_ave_full"] = _RoundOrNone(scorer.dockq_ave_full)
+ out["dockq_wave_full"] = _RoundOrNone(scorer.dockq_wave_full)
if args.rigid_scores:
- out["oligo_gdtts"] = scorer.gdtts
- out["oligo_gdtha"] = scorer.gdtha
- out["rmsd"] = scorer.rmsd
+ out["oligo_gdtts"] = _RoundOrNone(scorer.gdtts)
+ out["oligo_gdtha"] = _RoundOrNone(scorer.gdtha)
+ out["rmsd"] = _RoundOrNone(scorer.rmsd)
data = scorer.transform.data
out["transform"] = [data[i:i + 4] for i in range(0, len(data), 4)]
- if args.interface_scores:
- out["interfaces"] = scorer.interfaces
- out["nnat"] = scorer.native_contacts
- out["nmdl"] = scorer.model_contacts
- out["fnat"] = scorer.fnat
- out["fnonnat"] = scorer.fnonnat
- out["irmsd"] = scorer.irmsd
- out["lrmsd"] = scorer.lrmsd
- out["dockq_scores"] = scorer.dockq_scores
- out["interface_qs_global"] = scorer.interface_qs_global
- out["interface_qs_best"] = scorer.interface_qs_best
- out["dockq_ave"] = scorer.dockq_ave
- out["dockq_wave"] = scorer.dockq_wave
- out["dockq_ave_full"] = scorer.dockq_ave_full
- out["dockq_wave_full"] = scorer.dockq_wave_full
-
if args.patch_scores:
out["model_interface_residues"] = \
_InterfaceResiduesToJSONList(scorer.model_interface_residues)
@@ -627,11 +810,12 @@ def _Process(model, reference, args):
_InterfaceResiduesToJSONList(scorer.target_interface_residues)
out["patch_qs"] = _PatchScoresToJSONList(scorer.model_interface_residues,
scorer.patch_qs)
+
out["patch_dockq"] = _PatchScoresToJSONList(scorer.model_interface_residues,
scorer.patch_dockq)
if args.tm_score:
- out["tm_score"] = scorer.tm_score
+ out["tm_score"] = _RoundOrNone(scorer.tm_score)
out["usalign_mapping"] = scorer.usalign_mapping
if args.dump_structures:
diff --git a/docker/Dockerfile b/docker/Dockerfile
index e019bcef45d8742129ea99819072b09b9baea6eb..f2924ede64d7ea85e398986b16fd907c3fc596c2 100644
--- a/docker/Dockerfile
+++ b/docker/Dockerfile
@@ -2,7 +2,7 @@ FROM ubuntu:22.04
# ARGUMENTS
###########
-ARG OPENSTRUCTURE_VERSION="2.5.0"
+ARG OPENSTRUCTURE_VERSION="2.6.0"
ARG SRC_FOLDER="/usr/local/src"
ARG CPUS_FOR_MAKE=2
ARG OPENMM_VERSION="7.7.0"
diff --git a/doxygen/CMakeLists.txt b/doxygen/CMakeLists.txt
new file mode 100644
index 0000000000000000000000000000000000000000..4f64fab5020072578a019e5f650725454addea68
--- /dev/null
+++ b/doxygen/CMakeLists.txt
@@ -0,0 +1,3 @@
+set(BUILD_DIR ${CMAKE_BINARY_DIR})
+set(SOURCE_DIR ${CMAKE_SOURCE_DIR})
+configure_file("Doxyfile.in" "Doxyfile")
diff --git a/doxygen/Doxyfile.in b/doxygen/Doxyfile.in
new file mode 100644
index 0000000000000000000000000000000000000000..56cdc843409d3d4c5365cc16c51e7c106379d215
--- /dev/null
+++ b/doxygen/Doxyfile.in
@@ -0,0 +1,2581 @@
+# Doxyfile 1.9.1
+
+# This file describes the settings to be used by the documentation system
+# doxygen (www.doxygen.org) for a project.
+#
+# All text after a double hash (##) is considered a comment and is placed in
+# front of the TAG it is preceding.
+#
+# All text after a single hash (#) is considered a comment and will be ignored.
+# The format is:
+# TAG = value [value, ...]
+# For lists, items can also be appended using:
+# TAG += value [value, ...]
+# Values that contain spaces should be placed between quotes (\" \").
+
+#---------------------------------------------------------------------------
+# Project related configuration options
+#---------------------------------------------------------------------------
+
+# This tag specifies the encoding used for all characters in the configuration
+# file that follow. The default is UTF-8 which is also the encoding used for all
+# text before the first occurrence of this tag. Doxygen uses libiconv (or the
+# iconv built into libc) for the transcoding. See
+# https://www.gnu.org/software/libiconv/ for the list of possible encodings.
+# The default value is: UTF-8.
+
+DOXYFILE_ENCODING = UTF-8
+
+# The PROJECT_NAME tag is a single word (or a sequence of words surrounded by
+# double-quotes, unless you are using Doxywizard) that should identify the
+# project for which the documentation is generated. This name is used in the
+# title of most generated pages and in a few other places.
+# The default value is: My Project.
+
+PROJECT_NAME = OpenStructure
+
+# The PROJECT_NUMBER tag can be used to enter a project or revision number. This
+# could be handy for archiving the generated documentation or if some version
+# control system is used.
+
+PROJECT_NUMBER =
+
+# Using the PROJECT_BRIEF tag one can provide an optional one line description
+# for a project that appears at the top of each page and should give viewer a
+# quick idea about the purpose of the project. Keep the description short.
+
+PROJECT_BRIEF =
+
+# With the PROJECT_LOGO tag one can specify a logo or an icon that is included
+# in the documentation. The maximum height of the logo should not exceed 55
+# pixels and the maximum width should not exceed 200 pixels. Doxygen will copy
+# the logo to the output directory.
+
+PROJECT_LOGO =
+
+# The OUTPUT_DIRECTORY tag is used to specify the (relative or absolute) path
+# into which the generated documentation will be written. If a relative path is
+# entered, it will be relative to the location where doxygen was started. If
+# left blank the current directory will be used.
+
+OUTPUT_DIRECTORY = @BUILD_DIR@/doc
+
+# If the CREATE_SUBDIRS tag is set to YES then doxygen will create 4096 sub-
+# directories (in 2 levels) under the output directory of each output format and
+# will distribute the generated files over these directories. Enabling this
+# option can be useful when feeding doxygen a huge amount of source files, where
+# putting all generated files in the same directory would otherwise causes
+# performance problems for the file system.
+# The default value is: NO.
+
+CREATE_SUBDIRS = YES
+
+# If the ALLOW_UNICODE_NAMES tag is set to YES, doxygen will allow non-ASCII
+# characters to appear in the names of generated files. If set to NO, non-ASCII
+# characters will be escaped, for example _xE3_x81_x84 will be used for Unicode
+# U+3044.
+# The default value is: NO.
+
+ALLOW_UNICODE_NAMES = NO
+
+# The OUTPUT_LANGUAGE tag is used to specify the language in which all
+# documentation generated by doxygen is written. Doxygen will use this
+# information to generate all constant output in the proper language.
+# Possible values are: Afrikaans, Arabic, Armenian, Brazilian, Catalan, Chinese,
+# Chinese-Traditional, Croatian, Czech, Danish, Dutch, English (United States),
+# Esperanto, Farsi (Persian), Finnish, French, German, Greek, Hungarian,
+# Indonesian, Italian, Japanese, Japanese-en (Japanese with English messages),
+# Korean, Korean-en (Korean with English messages), Latvian, Lithuanian,
+# Macedonian, Norwegian, Persian (Farsi), Polish, Portuguese, Romanian, Russian,
+# Serbian, Serbian-Cyrillic, Slovak, Slovene, Spanish, Swedish, Turkish,
+# Ukrainian and Vietnamese.
+# The default value is: English.
+
+OUTPUT_LANGUAGE = English
+
+# The OUTPUT_TEXT_DIRECTION tag is used to specify the direction in which all
+# documentation generated by doxygen is written. Doxygen will use this
+# information to generate all generated output in the proper direction.
+# Possible values are: None, LTR, RTL and Context.
+# The default value is: None.
+
+OUTPUT_TEXT_DIRECTION = None
+
+# If the BRIEF_MEMBER_DESC tag is set to YES, doxygen will include brief member
+# descriptions after the members that are listed in the file and class
+# documentation (similar to Javadoc). Set to NO to disable this.
+# The default value is: YES.
+
+BRIEF_MEMBER_DESC = NO
+
+# If the REPEAT_BRIEF tag is set to YES, doxygen will prepend the brief
+# description of a member or function before the detailed description
+#
+# Note: If both HIDE_UNDOC_MEMBERS and BRIEF_MEMBER_DESC are set to NO, the
+# brief descriptions will be completely suppressed.
+# The default value is: YES.
+
+REPEAT_BRIEF = YES
+
+# This tag implements a quasi-intelligent brief description abbreviator that is
+# used to form the text in various listings. Each string in this list, if found
+# as the leading text of the brief description, will be stripped from the text
+# and the result, after processing the whole list, is used as the annotated
+# text. Otherwise, the brief description is used as-is. If left blank, the
+# following values are used ($name is automatically replaced with the name of
+# the entity):The $name class, The $name widget, The $name file, is, provides,
+# specifies, contains, represents, a, an and the.
+
+ABBREVIATE_BRIEF = "The $name class" \
+ "The $name widget" \
+ "The $name file" \
+ is \
+ provides \
+ specifies \
+ contains \
+ represents \
+ a \
+ an \
+ the
+
+# If the ALWAYS_DETAILED_SEC and REPEAT_BRIEF tags are both set to YES then
+# doxygen will generate a detailed section even if there is only a brief
+# description.
+# The default value is: NO.
+
+ALWAYS_DETAILED_SEC = NO
+
+# If the INLINE_INHERITED_MEMB tag is set to YES, doxygen will show all
+# inherited members of a class in the documentation of that class as if those
+# members were ordinary class members. Constructors, destructors and assignment
+# operators of the base classes will not be shown.
+# The default value is: NO.
+
+INLINE_INHERITED_MEMB = NO
+
+# If the FULL_PATH_NAMES tag is set to YES, doxygen will prepend the full path
+# before files name in the file list and in the header files. If set to NO the
+# shortest path that makes the file name unique will be used
+# The default value is: YES.
+
+FULL_PATH_NAMES = YES
+
+# The STRIP_FROM_PATH tag can be used to strip a user-defined part of the path.
+# Stripping is only done if one of the specified strings matches the left-hand
+# part of the path. The tag can be used to show relative paths in the file list.
+# If left blank the directory from which doxygen is run is used as the path to
+# strip.
+#
+# Note that you can specify absolute paths here, but also relative paths, which
+# will be relative from the directory where doxygen is started.
+# This tag requires that the tag FULL_PATH_NAMES is set to YES.
+
+STRIP_FROM_PATH =
+
+# The STRIP_FROM_INC_PATH tag can be used to strip a user-defined part of the
+# path mentioned in the documentation of a class, which tells the reader which
+# header file to include in order to use a class. If left blank only the name of
+# the header file containing the class definition is used. Otherwise one should
+# specify the list of include paths that are normally passed to the compiler
+# using the -I flag.
+
+STRIP_FROM_INC_PATH =
+
+# If the SHORT_NAMES tag is set to YES, doxygen will generate much shorter (but
+# less readable) file names. This can be useful is your file systems doesn't
+# support long names like on DOS, Mac, or CD-ROM.
+# The default value is: NO.
+
+SHORT_NAMES = NO
+
+# If the JAVADOC_AUTOBRIEF tag is set to YES then doxygen will interpret the
+# first line (until the first dot) of a Javadoc-style comment as the brief
+# description. If set to NO, the Javadoc-style will behave just like regular Qt-
+# style comments (thus requiring an explicit @brief command for a brief
+# description.)
+# The default value is: NO.
+
+JAVADOC_AUTOBRIEF = NO
+
+# If the JAVADOC_BANNER tag is set to YES then doxygen will interpret a line
+# such as
+# /***************
+# as being the beginning of a Javadoc-style comment "banner". If set to NO, the
+# Javadoc-style will behave just like regular comments and it will not be
+# interpreted by doxygen.
+# The default value is: NO.
+
+JAVADOC_BANNER = NO
+
+# If the QT_AUTOBRIEF tag is set to YES then doxygen will interpret the first
+# line (until the first dot) of a Qt-style comment as the brief description. If
+# set to NO, the Qt-style will behave just like regular Qt-style comments (thus
+# requiring an explicit \brief command for a brief description.)
+# The default value is: NO.
+
+QT_AUTOBRIEF = NO
+
+# The MULTILINE_CPP_IS_BRIEF tag can be set to YES to make doxygen treat a
+# multi-line C++ special comment block (i.e. a block of //! or /// comments) as
+# a brief description. This used to be the default behavior. The new default is
+# to treat a multi-line C++ comment block as a detailed description. Set this
+# tag to YES if you prefer the old behavior instead.
+#
+# Note that setting this tag to YES also means that rational rose comments are
+# not recognized any more.
+# The default value is: NO.
+
+MULTILINE_CPP_IS_BRIEF = NO
+
+# By default Python docstrings are displayed as preformatted text and doxygen's
+# special commands cannot be used. By setting PYTHON_DOCSTRING to NO the
+# doxygen's special commands can be used and the contents of the docstring
+# documentation blocks is shown as doxygen documentation.
+# The default value is: YES.
+
+PYTHON_DOCSTRING = YES
+
+# If the INHERIT_DOCS tag is set to YES then an undocumented member inherits the
+# documentation from any documented member that it re-implements.
+# The default value is: YES.
+
+INHERIT_DOCS = YES
+
+# If the SEPARATE_MEMBER_PAGES tag is set to YES then doxygen will produce a new
+# page for each member. If set to NO, the documentation of a member will be part
+# of the file/class/namespace that contains it.
+# The default value is: NO.
+
+SEPARATE_MEMBER_PAGES = NO
+
+# The TAB_SIZE tag can be used to set the number of spaces in a tab. Doxygen
+# uses this value to replace tabs by spaces in code fragments.
+# Minimum value: 1, maximum value: 16, default value: 4.
+
+TAB_SIZE = 2
+
+# This tag can be used to specify a number of aliases that act as commands in
+# the documentation. An alias has the form:
+# name=value
+# For example adding
+# "sideeffect=@par Side Effects:\n"
+# will allow you to put the command \sideeffect (or @sideeffect) in the
+# documentation, which will result in a user-defined paragraph with heading
+# "Side Effects:". You can put \n's in the value part of an alias to insert
+# newlines (in the resulting output). You can put ^^ in the value part of an
+# alias to insert a newline as if a physical newline was in the original file.
+# When you need a literal { or } or , in the value part of an alias you have to
+# escape them by means of a backslash (\), this can lead to conflicts with the
+# commands \{ and \} for these it is advised to use the version @{ and @} or use
+# a double escape (\\{ and \\})
+
+ALIASES =
+
+# Set the OPTIMIZE_OUTPUT_FOR_C tag to YES if your project consists of C sources
+# only. Doxygen will then generate output that is more tailored for C. For
+# instance, some of the names that are used will be different. The list of all
+# members will be omitted, etc.
+# The default value is: NO.
+
+OPTIMIZE_OUTPUT_FOR_C = YES
+
+# Set the OPTIMIZE_OUTPUT_JAVA tag to YES if your project consists of Java or
+# Python sources only. Doxygen will then generate output that is more tailored
+# for that language. For instance, namespaces will be presented as packages,
+# qualified scopes will look different, etc.
+# The default value is: NO.
+
+OPTIMIZE_OUTPUT_JAVA = NO
+
+# Set the OPTIMIZE_FOR_FORTRAN tag to YES if your project consists of Fortran
+# sources. Doxygen will then generate output that is tailored for Fortran.
+# The default value is: NO.
+
+OPTIMIZE_FOR_FORTRAN = NO
+
+# Set the OPTIMIZE_OUTPUT_VHDL tag to YES if your project consists of VHDL
+# sources. Doxygen will then generate output that is tailored for VHDL.
+# The default value is: NO.
+
+OPTIMIZE_OUTPUT_VHDL = NO
+
+# Set the OPTIMIZE_OUTPUT_SLICE tag to YES if your project consists of Slice
+# sources only. Doxygen will then generate output that is more tailored for that
+# language. For instance, namespaces will be presented as modules, types will be
+# separated into more groups, etc.
+# The default value is: NO.
+
+OPTIMIZE_OUTPUT_SLICE = NO
+
+# Doxygen selects the parser to use depending on the extension of the files it
+# parses. With this tag you can assign which parser to use for a given
+# extension. Doxygen has a built-in mapping, but you can override or extend it
+# using this tag. The format is ext=language, where ext is a file extension, and
+# language is one of the parsers supported by doxygen: IDL, Java, JavaScript,
+# Csharp (C#), C, C++, D, PHP, md (Markdown), Objective-C, Python, Slice, VHDL,
+# Fortran (fixed format Fortran: FortranFixed, free formatted Fortran:
+# FortranFree, unknown formatted Fortran: Fortran. In the later case the parser
+# tries to guess whether the code is fixed or free formatted code, this is the
+# default for Fortran type files). For instance to make doxygen treat .inc files
+# as Fortran files (default is PHP), and .f files as C (default is Fortran),
+# use: inc=Fortran f=C.
+#
+# Note: For files without extension you can use no_extension as a placeholder.
+#
+# Note that for custom extensions you also need to set FILE_PATTERNS otherwise
+# the files are not read by doxygen. When specifying no_extension you should add
+# * to the FILE_PATTERNS.
+#
+# Note see also the list of default file extension mappings.
+
+EXTENSION_MAPPING =
+
+# If the MARKDOWN_SUPPORT tag is enabled then doxygen pre-processes all comments
+# according to the Markdown format, which allows for more readable
+# documentation. See https://daringfireball.net/projects/markdown/ for details.
+# The output of markdown processing is further processed by doxygen, so you can
+# mix doxygen, HTML, and XML commands with Markdown formatting. Disable only in
+# case of backward compatibilities issues.
+# The default value is: YES.
+
+MARKDOWN_SUPPORT = YES
+
+# When the TOC_INCLUDE_HEADINGS tag is set to a non-zero value, all headings up
+# to that level are automatically included in the table of contents, even if
+# they do not have an id attribute.
+# Note: This feature currently applies only to Markdown headings.
+# Minimum value: 0, maximum value: 99, default value: 5.
+# This tag requires that the tag MARKDOWN_SUPPORT is set to YES.
+
+TOC_INCLUDE_HEADINGS = 5
+
+# When enabled doxygen tries to link words that correspond to documented
+# classes, or namespaces to their corresponding documentation. Such a link can
+# be prevented in individual cases by putting a % sign in front of the word or
+# globally by setting AUTOLINK_SUPPORT to NO.
+# The default value is: YES.
+
+AUTOLINK_SUPPORT = YES
+
+# If you use STL classes (i.e. std::string, std::vector, etc.) but do not want
+# to include (a tag file for) the STL sources as input, then you should set this
+# tag to YES in order to let doxygen match functions declarations and
+# definitions whose arguments contain STL classes (e.g. func(std::string);
+# versus func(std::string) {}). This also make the inheritance and collaboration
+# diagrams that involve STL classes more complete and accurate.
+# The default value is: NO.
+
+BUILTIN_STL_SUPPORT = NO
+
+# If you use Microsoft's C++/CLI language, you should set this option to YES to
+# enable parsing support.
+# The default value is: NO.
+
+CPP_CLI_SUPPORT = NO
+
+# Set the SIP_SUPPORT tag to YES if your project consists of sip (see:
+# https://www.riverbankcomputing.com/software/sip/intro) sources only. Doxygen
+# will parse them like normal C++ but will assume all classes use public instead
+# of private inheritance when no explicit protection keyword is present.
+# The default value is: NO.
+
+SIP_SUPPORT = NO
+
+# For Microsoft's IDL there are propget and propput attributes to indicate
+# getter and setter methods for a property. Setting this option to YES will make
+# doxygen to replace the get and set methods by a property in the documentation.
+# This will only work if the methods are indeed getting or setting a simple
+# type. If this is not the case, or you want to show the methods anyway, you
+# should set this option to NO.
+# The default value is: YES.
+
+IDL_PROPERTY_SUPPORT = YES
+
+# If member grouping is used in the documentation and the DISTRIBUTE_GROUP_DOC
+# tag is set to YES then doxygen will reuse the documentation of the first
+# member in the group (if any) for the other members of the group. By default
+# all members of a group must be documented explicitly.
+# The default value is: NO.
+
+DISTRIBUTE_GROUP_DOC = NO
+
+# If one adds a struct or class to a group and this option is enabled, then also
+# any nested class or struct is added to the same group. By default this option
+# is disabled and one has to add nested compounds explicitly via \ingroup.
+# The default value is: NO.
+
+GROUP_NESTED_COMPOUNDS = NO
+
+# Set the SUBGROUPING tag to YES to allow class member groups of the same type
+# (for instance a group of public functions) to be put as a subgroup of that
+# type (e.g. under the Public Functions section). Set it to NO to prevent
+# subgrouping. Alternatively, this can be done per class using the
+# \nosubgrouping command.
+# The default value is: YES.
+
+SUBGROUPING = YES
+
+# When the INLINE_GROUPED_CLASSES tag is set to YES, classes, structs and unions
+# are shown inside the group in which they are included (e.g. using \ingroup)
+# instead of on a separate page (for HTML and Man pages) or section (for LaTeX
+# and RTF).
+#
+# Note that this feature does not work in combination with
+# SEPARATE_MEMBER_PAGES.
+# The default value is: NO.
+
+INLINE_GROUPED_CLASSES = NO
+
+# When the INLINE_SIMPLE_STRUCTS tag is set to YES, structs, classes, and unions
+# with only public data fields or simple typedef fields will be shown inline in
+# the documentation of the scope in which they are defined (i.e. file,
+# namespace, or group documentation), provided this scope is documented. If set
+# to NO, structs, classes, and unions are shown on a separate page (for HTML and
+# Man pages) or section (for LaTeX and RTF).
+# The default value is: NO.
+
+INLINE_SIMPLE_STRUCTS = NO
+
+# When TYPEDEF_HIDES_STRUCT tag is enabled, a typedef of a struct, union, or
+# enum is documented as struct, union, or enum with the name of the typedef. So
+# typedef struct TypeS {} TypeT, will appear in the documentation as a struct
+# with name TypeT. When disabled the typedef will appear as a member of a file,
+# namespace, or class. And the struct will be named TypeS. This can typically be
+# useful for C code in case the coding convention dictates that all compound
+# types are typedef'ed and only the typedef is referenced, never the tag name.
+# The default value is: NO.
+
+TYPEDEF_HIDES_STRUCT = NO
+
+# The size of the symbol lookup cache can be set using LOOKUP_CACHE_SIZE. This
+# cache is used to resolve symbols given their name and scope. Since this can be
+# an expensive process and often the same symbol appears multiple times in the
+# code, doxygen keeps a cache of pre-resolved symbols. If the cache is too small
+# doxygen will become slower. If the cache is too large, memory is wasted. The
+# cache size is given by this formula: 2^(16+LOOKUP_CACHE_SIZE). The valid range
+# is 0..9, the default is 0, corresponding to a cache size of 2^16=65536
+# symbols. At the end of a run doxygen will report the cache usage and suggest
+# the optimal cache size from a speed point of view.
+# Minimum value: 0, maximum value: 9, default value: 0.
+
+LOOKUP_CACHE_SIZE = 0
+
+# The NUM_PROC_THREADS specifies the number threads doxygen is allowed to use
+# during processing. When set to 0 doxygen will based this on the number of
+# cores available in the system. You can set it explicitly to a value larger
+# than 0 to get more control over the balance between CPU load and processing
+# speed. At this moment only the input processing can be done using multiple
+# threads. Since this is still an experimental feature the default is set to 1,
+# which efficively disables parallel processing. Please report any issues you
+# encounter. Generating dot graphs in parallel is controlled by the
+# DOT_NUM_THREADS setting.
+# Minimum value: 0, maximum value: 32, default value: 1.
+
+NUM_PROC_THREADS = 1
+
+#---------------------------------------------------------------------------
+# Build related configuration options
+#---------------------------------------------------------------------------
+
+# If the EXTRACT_ALL tag is set to YES, doxygen will assume all entities in
+# documentation are documented, even if no documentation was available. Private
+# class members and static file members will be hidden unless the
+# EXTRACT_PRIVATE respectively EXTRACT_STATIC tags are set to YES.
+# Note: This will also disable the warnings about undocumented members that are
+# normally produced when WARNINGS is set to YES.
+# The default value is: NO.
+
+EXTRACT_ALL = YES
+
+# If the EXTRACT_PRIVATE tag is set to YES, all private members of a class will
+# be included in the documentation.
+# The default value is: NO.
+
+EXTRACT_PRIVATE = NO
+
+# If the EXTRACT_PRIV_VIRTUAL tag is set to YES, documented private virtual
+# methods of a class will be included in the documentation.
+# The default value is: NO.
+
+EXTRACT_PRIV_VIRTUAL = NO
+
+# If the EXTRACT_PACKAGE tag is set to YES, all members with package or internal
+# scope will be included in the documentation.
+# The default value is: NO.
+
+EXTRACT_PACKAGE = NO
+
+# If the EXTRACT_STATIC tag is set to YES, all static members of a file will be
+# included in the documentation.
+# The default value is: NO.
+
+EXTRACT_STATIC = YES
+
+# If the EXTRACT_LOCAL_CLASSES tag is set to YES, classes (and structs) defined
+# locally in source files will be included in the documentation. If set to NO,
+# only classes defined in header files are included. Does not have any effect
+# for Java sources.
+# The default value is: YES.
+
+EXTRACT_LOCAL_CLASSES = YES
+
+# This flag is only useful for Objective-C code. If set to YES, local methods,
+# which are defined in the implementation section but not in the interface are
+# included in the documentation. If set to NO, only methods in the interface are
+# included.
+# The default value is: NO.
+
+EXTRACT_LOCAL_METHODS = NO
+
+# If this flag is set to YES, the members of anonymous namespaces will be
+# extracted and appear in the documentation as a namespace called
+# 'anonymous_namespace{file}', where file will be replaced with the base name of
+# the file that contains the anonymous namespace. By default anonymous namespace
+# are hidden.
+# The default value is: NO.
+
+EXTRACT_ANON_NSPACES = NO
+
+# If this flag is set to YES, the name of an unnamed parameter in a declaration
+# will be determined by the corresponding definition. By default unnamed
+# parameters remain unnamed in the output.
+# The default value is: YES.
+
+RESOLVE_UNNAMED_PARAMS = YES
+
+# If the HIDE_UNDOC_MEMBERS tag is set to YES, doxygen will hide all
+# undocumented members inside documented classes or files. If set to NO these
+# members will be included in the various overviews, but no documentation
+# section is generated. This option has no effect if EXTRACT_ALL is enabled.
+# The default value is: NO.
+
+HIDE_UNDOC_MEMBERS = NO
+
+# If the HIDE_UNDOC_CLASSES tag is set to YES, doxygen will hide all
+# undocumented classes that are normally visible in the class hierarchy. If set
+# to NO, these classes will be included in the various overviews. This option
+# has no effect if EXTRACT_ALL is enabled.
+# The default value is: NO.
+
+HIDE_UNDOC_CLASSES = NO
+
+# If the HIDE_FRIEND_COMPOUNDS tag is set to YES, doxygen will hide all friend
+# declarations. If set to NO, these declarations will be included in the
+# documentation.
+# The default value is: NO.
+
+HIDE_FRIEND_COMPOUNDS = NO
+
+# If the HIDE_IN_BODY_DOCS tag is set to YES, doxygen will hide any
+# documentation blocks found inside the body of a function. If set to NO, these
+# blocks will be appended to the function's detailed documentation block.
+# The default value is: NO.
+
+HIDE_IN_BODY_DOCS = NO
+
+# The INTERNAL_DOCS tag determines if documentation that is typed after a
+# \internal command is included. If the tag is set to NO then the documentation
+# will be excluded. Set it to YES to include the internal documentation.
+# The default value is: NO.
+
+INTERNAL_DOCS = NO
+
+# With the correct setting of option CASE_SENSE_NAMES doxygen will better be
+# able to match the capabilities of the underlying filesystem. In case the
+# filesystem is case sensitive (i.e. it supports files in the same directory
+# whose names only differ in casing), the option must be set to YES to properly
+# deal with such files in case they appear in the input. For filesystems that
+# are not case sensitive the option should be be set to NO to properly deal with
+# output files written for symbols that only differ in casing, such as for two
+# classes, one named CLASS and the other named Class, and to also support
+# references to files without having to specify the exact matching casing. On
+# Windows (including Cygwin) and MacOS, users should typically set this option
+# to NO, whereas on Linux or other Unix flavors it should typically be set to
+# YES.
+# The default value is: system dependent.
+
+CASE_SENSE_NAMES = NO
+
+# If the HIDE_SCOPE_NAMES tag is set to NO then doxygen will show members with
+# their full class and namespace scopes in the documentation. If set to YES, the
+# scope will be hidden.
+# The default value is: NO.
+
+HIDE_SCOPE_NAMES = YES
+
+# If the HIDE_COMPOUND_REFERENCE tag is set to NO (default) then doxygen will
+# append additional text to a page's title, such as Class Reference. If set to
+# YES the compound reference will be hidden.
+# The default value is: NO.
+
+HIDE_COMPOUND_REFERENCE= NO
+
+# If the SHOW_INCLUDE_FILES tag is set to YES then doxygen will put a list of
+# the files that are included by a file in the documentation of that file.
+# The default value is: YES.
+
+SHOW_INCLUDE_FILES = YES
+
+# If the SHOW_GROUPED_MEMB_INC tag is set to YES then Doxygen will add for each
+# grouped member an include statement to the documentation, telling the reader
+# which file to include in order to use the member.
+# The default value is: NO.
+
+SHOW_GROUPED_MEMB_INC = NO
+
+# If the FORCE_LOCAL_INCLUDES tag is set to YES then doxygen will list include
+# files with double quotes in the documentation rather than with sharp brackets.
+# The default value is: NO.
+
+FORCE_LOCAL_INCLUDES = NO
+
+# If the INLINE_INFO tag is set to YES then a tag [inline] is inserted in the
+# documentation for inline members.
+# The default value is: YES.
+
+INLINE_INFO = YES
+
+# If the SORT_MEMBER_DOCS tag is set to YES then doxygen will sort the
+# (detailed) documentation of file and class members alphabetically by member
+# name. If set to NO, the members will appear in declaration order.
+# The default value is: YES.
+
+SORT_MEMBER_DOCS = YES
+
+# If the SORT_BRIEF_DOCS tag is set to YES then doxygen will sort the brief
+# descriptions of file, namespace and class members alphabetically by member
+# name. If set to NO, the members will appear in declaration order. Note that
+# this will also influence the order of the classes in the class list.
+# The default value is: NO.
+
+SORT_BRIEF_DOCS = NO
+
+# If the SORT_MEMBERS_CTORS_1ST tag is set to YES then doxygen will sort the
+# (brief and detailed) documentation of class members so that constructors and
+# destructors are listed first. If set to NO the constructors will appear in the
+# respective orders defined by SORT_BRIEF_DOCS and SORT_MEMBER_DOCS.
+# Note: If SORT_BRIEF_DOCS is set to NO this option is ignored for sorting brief
+# member documentation.
+# Note: If SORT_MEMBER_DOCS is set to NO this option is ignored for sorting
+# detailed member documentation.
+# The default value is: NO.
+
+SORT_MEMBERS_CTORS_1ST = NO
+
+# If the SORT_GROUP_NAMES tag is set to YES then doxygen will sort the hierarchy
+# of group names into alphabetical order. If set to NO the group names will
+# appear in their defined order.
+# The default value is: NO.
+
+SORT_GROUP_NAMES = NO
+
+# If the SORT_BY_SCOPE_NAME tag is set to YES, the class list will be sorted by
+# fully-qualified names, including namespaces. If set to NO, the class list will
+# be sorted only by class name, not including the namespace part.
+# Note: This option is not very useful if HIDE_SCOPE_NAMES is set to YES.
+# Note: This option applies only to the class list, not to the alphabetical
+# list.
+# The default value is: NO.
+
+SORT_BY_SCOPE_NAME = NO
+
+# If the STRICT_PROTO_MATCHING option is enabled and doxygen fails to do proper
+# type resolution of all parameters of a function it will reject a match between
+# the prototype and the implementation of a member function even if there is
+# only one candidate or it is obvious which candidate to choose by doing a
+# simple string match. By disabling STRICT_PROTO_MATCHING doxygen will still
+# accept a match between prototype and implementation in such cases.
+# The default value is: NO.
+
+STRICT_PROTO_MATCHING = NO
+
+# The GENERATE_TODOLIST tag can be used to enable (YES) or disable (NO) the todo
+# list. This list is created by putting \todo commands in the documentation.
+# The default value is: YES.
+
+GENERATE_TODOLIST = YES
+
+# The GENERATE_TESTLIST tag can be used to enable (YES) or disable (NO) the test
+# list. This list is created by putting \test commands in the documentation.
+# The default value is: YES.
+
+GENERATE_TESTLIST = YES
+
+# The GENERATE_BUGLIST tag can be used to enable (YES) or disable (NO) the bug
+# list. This list is created by putting \bug commands in the documentation.
+# The default value is: YES.
+
+GENERATE_BUGLIST = YES
+
+# The GENERATE_DEPRECATEDLIST tag can be used to enable (YES) or disable (NO)
+# the deprecated list. This list is created by putting \deprecated commands in
+# the documentation.
+# The default value is: YES.
+
+GENERATE_DEPRECATEDLIST= YES
+
+# The ENABLED_SECTIONS tag can be used to enable conditional documentation
+# sections, marked by \if <section_label> ... \endif and \cond <section_label>
+# ... \endcond blocks.
+
+ENABLED_SECTIONS =
+
+# The MAX_INITIALIZER_LINES tag determines the maximum number of lines that the
+# initial value of a variable or macro / define can have for it to appear in the
+# documentation. If the initializer consists of more lines than specified here
+# it will be hidden. Use a value of 0 to hide initializers completely. The
+# appearance of the value of individual variables and macros / defines can be
+# controlled using \showinitializer or \hideinitializer command in the
+# documentation regardless of this setting.
+# Minimum value: 0, maximum value: 10000, default value: 30.
+
+MAX_INITIALIZER_LINES = 30
+
+# Set the SHOW_USED_FILES tag to NO to disable the list of files generated at
+# the bottom of the documentation of classes and structs. If set to YES, the
+# list will mention the files that were used to generate the documentation.
+# The default value is: YES.
+
+SHOW_USED_FILES = YES
+
+# Set the SHOW_FILES tag to NO to disable the generation of the Files page. This
+# will remove the Files entry from the Quick Index and from the Folder Tree View
+# (if specified).
+# The default value is: YES.
+
+SHOW_FILES = YES
+
+# Set the SHOW_NAMESPACES tag to NO to disable the generation of the Namespaces
+# page. This will remove the Namespaces entry from the Quick Index and from the
+# Folder Tree View (if specified).
+# The default value is: YES.
+
+SHOW_NAMESPACES = YES
+
+# The FILE_VERSION_FILTER tag can be used to specify a program or script that
+# doxygen should invoke to get the current version for each file (typically from
+# the version control system). Doxygen will invoke the program by executing (via
+# popen()) the command command input-file, where command is the value of the
+# FILE_VERSION_FILTER tag, and input-file is the name of an input file provided
+# by doxygen. Whatever the program writes to standard output is used as the file
+# version. For an example see the documentation.
+
+FILE_VERSION_FILTER =
+
+# The LAYOUT_FILE tag can be used to specify a layout file which will be parsed
+# by doxygen. The layout file controls the global structure of the generated
+# output files in an output format independent way. To create the layout file
+# that represents doxygen's defaults, run doxygen with the -l option. You can
+# optionally specify a file name after the option, if omitted DoxygenLayout.xml
+# will be used as the name of the layout file.
+#
+# Note that if you run doxygen from a directory containing a file called
+# DoxygenLayout.xml, doxygen will parse it automatically even if the LAYOUT_FILE
+# tag is left empty.
+
+LAYOUT_FILE =
+
+# The CITE_BIB_FILES tag can be used to specify one or more bib files containing
+# the reference definitions. This must be a list of .bib files. The .bib
+# extension is automatically appended if omitted. This requires the bibtex tool
+# to be installed. See also https://en.wikipedia.org/wiki/BibTeX for more info.
+# For LaTeX the style of the bibliography can be controlled using
+# LATEX_BIB_STYLE. To use this feature you need bibtex and perl available in the
+# search path. See also \cite for info how to create references.
+
+CITE_BIB_FILES =
+
+#---------------------------------------------------------------------------
+# Configuration options related to warning and progress messages
+#---------------------------------------------------------------------------
+
+# The QUIET tag can be used to turn on/off the messages that are generated to
+# standard output by doxygen. If QUIET is set to YES this implies that the
+# messages are off.
+# The default value is: NO.
+
+QUIET = YES
+
+# The WARNINGS tag can be used to turn on/off the warning messages that are
+# generated to standard error (stderr) by doxygen. If WARNINGS is set to YES
+# this implies that the warnings are on.
+#
+# Tip: Turn warnings on while writing the documentation.
+# The default value is: YES.
+
+WARNINGS = NO
+
+# If the WARN_IF_UNDOCUMENTED tag is set to YES then doxygen will generate
+# warnings for undocumented members. If EXTRACT_ALL is set to YES then this flag
+# will automatically be disabled.
+# The default value is: YES.
+
+WARN_IF_UNDOCUMENTED = NO
+
+# If the WARN_IF_DOC_ERROR tag is set to YES, doxygen will generate warnings for
+# potential errors in the documentation, such as not documenting some parameters
+# in a documented function, or documenting parameters that don't exist or using
+# markup commands wrongly.
+# The default value is: YES.
+
+WARN_IF_DOC_ERROR = YES
+
+# This WARN_NO_PARAMDOC option can be enabled to get warnings for functions that
+# are documented, but have no documentation for their parameters or return
+# value. If set to NO, doxygen will only warn about wrong or incomplete
+# parameter documentation, but not about the absence of documentation. If
+# EXTRACT_ALL is set to YES then this flag will automatically be disabled.
+# The default value is: NO.
+
+WARN_NO_PARAMDOC = NO
+
+# If the WARN_AS_ERROR tag is set to YES then doxygen will immediately stop when
+# a warning is encountered. If the WARN_AS_ERROR tag is set to FAIL_ON_WARNINGS
+# then doxygen will continue running as if WARN_AS_ERROR tag is set to NO, but
+# at the end of the doxygen process doxygen will return with a non-zero status.
+# Possible values are: NO, YES and FAIL_ON_WARNINGS.
+# The default value is: NO.
+
+WARN_AS_ERROR = NO
+
+# The WARN_FORMAT tag determines the format of the warning messages that doxygen
+# can produce. The string should contain the $file, $line, and $text tags, which
+# will be replaced by the file and line number from which the warning originated
+# and the warning text. Optionally the format may contain $version, which will
+# be replaced by the version of the file (if it could be obtained via
+# FILE_VERSION_FILTER)
+# The default value is: $file:$line: $text.
+
+WARN_FORMAT = "$file:$line: $text"
+
+# The WARN_LOGFILE tag can be used to specify a file to which warning and error
+# messages should be written. If left blank the output is written to standard
+# error (stderr).
+
+WARN_LOGFILE =
+
+#---------------------------------------------------------------------------
+# Configuration options related to the input files
+#---------------------------------------------------------------------------
+
+# The INPUT tag is used to specify the files and/or directories that contain
+# documented source files. You may enter file names like myfile.cpp or
+# directories like /usr/src/myproject. Separate the files or directories with
+# spaces. See also FILE_PATTERNS and EXTENSION_MAPPING
+# Note: If this tag is empty the current directory is searched.
+
+INPUT = @SOURCE_DIR@/modules \
+ @BUILD_DIR@/stage
+
+# This tag can be used to specify the character encoding of the source files
+# that doxygen parses. Internally doxygen uses the UTF-8 encoding. Doxygen uses
+# libiconv (or the iconv built into libc) for the transcoding. See the libiconv
+# documentation (see:
+# https://www.gnu.org/software/libiconv/) for the list of possible encodings.
+# The default value is: UTF-8.
+
+INPUT_ENCODING = UTF-8
+
+# If the value of the INPUT tag contains directories, you can use the
+# FILE_PATTERNS tag to specify one or more wildcard patterns (like *.cpp and
+# *.h) to filter out the source-files in the directories.
+#
+# Note that for custom extensions or not directly supported extensions you also
+# need to set EXTENSION_MAPPING for the extension otherwise the files are not
+# read by doxygen.
+#
+# Note the list of default checked file patterns might differ from the list of
+# default file extension mappings.
+#
+# If left blank the following patterns are tested:*.c, *.cc, *.cxx, *.cpp,
+# *.c++, *.java, *.ii, *.ixx, *.ipp, *.i++, *.inl, *.idl, *.ddl, *.odl, *.h,
+# *.hh, *.hxx, *.hpp, *.h++, *.cs, *.d, *.php, *.php4, *.php5, *.phtml, *.inc,
+# *.m, *.markdown, *.md, *.mm, *.dox (to be provided as doxygen C comment),
+# *.py, *.pyw, *.f90, *.f95, *.f03, *.f08, *.f18, *.f, *.for, *.vhd, *.vhdl,
+# *.ucf, *.qsf and *.ice.
+
+FILE_PATTERNS = *.hh \
+ *.dox \
+ *.py
+
+# The RECURSIVE tag can be used to specify whether or not subdirectories should
+# be searched for input files as well.
+# The default value is: NO.
+
+RECURSIVE = YES
+
+# The EXCLUDE tag can be used to specify files and/or directories that should be
+# excluded from the INPUT source files. This way you can easily exclude a
+# subdirectory from a directory tree whose root is specified with the INPUT tag.
+#
+# Note that relative paths are relative to the directory from which doxygen is
+# run.
+
+EXCLUDE =
+
+# The EXCLUDE_SYMLINKS tag can be used to select whether or not files or
+# directories that are symbolic links (a Unix file system feature) are excluded
+# from the input.
+# The default value is: NO.
+
+EXCLUDE_SYMLINKS = NO
+
+# If the value of the INPUT tag contains directories, you can use the
+# EXCLUDE_PATTERNS tag to specify one or more wildcard patterns to exclude
+# certain files from those directories.
+#
+# Note that the wildcards are matched against the file with absolute path, so to
+# exclude all test directories for example use the pattern */test/*
+
+EXCLUDE_PATTERNS = *CMakeFiles* \
+ *src* \
+ *pymod* \
+ *tests* \
+ *scratch*
+
+# The EXCLUDE_SYMBOLS tag can be used to specify one or more symbol names
+# (namespaces, classes, functions, etc.) that should be excluded from the
+# output. The symbol name can be a fully qualified name, a word, or if the
+# wildcard * is used, a substring. Examples: ANamespace, AClass,
+# AClass::ANamespace, ANamespace::*Test
+#
+# Note that the wildcards are matched against the file with absolute path, so to
+# exclude all test directories use the pattern */test/*
+
+EXCLUDE_SYMBOLS =
+
+# The EXAMPLE_PATH tag can be used to specify one or more files or directories
+# that contain example code fragments that are included (see the \include
+# command).
+
+EXAMPLE_PATH = @SOURCE_DIR@/examples
+
+# If the value of the EXAMPLE_PATH tag contains directories, you can use the
+# EXAMPLE_PATTERNS tag to specify one or more wildcard pattern (like *.cpp and
+# *.h) to filter out the source-files in the directories. If left blank all
+# files are included.
+
+EXAMPLE_PATTERNS = *
+
+# If the EXAMPLE_RECURSIVE tag is set to YES then subdirectories will be
+# searched for input files to be used with the \include or \dontinclude commands
+# irrespective of the value of the RECURSIVE tag.
+# The default value is: NO.
+
+EXAMPLE_RECURSIVE = NO
+
+# The IMAGE_PATH tag can be used to specify one or more files or directories
+# that contain images that are to be included in the documentation (see the
+# \image command).
+
+IMAGE_PATH =
+
+# The INPUT_FILTER tag can be used to specify a program that doxygen should
+# invoke to filter for each input file. Doxygen will invoke the filter program
+# by executing (via popen()) the command:
+#
+# <filter> <input-file>
+#
+# where <filter> is the value of the INPUT_FILTER tag, and <input-file> is the
+# name of an input file. Doxygen will then use the output that the filter
+# program writes to standard output. If FILTER_PATTERNS is specified, this tag
+# will be ignored.
+#
+# Note that the filter must not add or remove lines; it is applied before the
+# code is scanned, but not when the output code is generated. If lines are added
+# or removed, the anchors will not be placed correctly.
+#
+# Note that for custom extensions or not directly supported extensions you also
+# need to set EXTENSION_MAPPING for the extension otherwise the files are not
+# properly processed by doxygen.
+
+INPUT_FILTER =
+
+# The FILTER_PATTERNS tag can be used to specify filters on a per file pattern
+# basis. Doxygen will compare the file name with each pattern and apply the
+# filter if there is a match. The filters are a list of the form: pattern=filter
+# (like *.cpp=my_cpp_filter). See INPUT_FILTER for further information on how
+# filters are used. If the FILTER_PATTERNS tag is empty or if none of the
+# patterns match the file name, INPUT_FILTER is applied.
+#
+# Note that for custom extensions or not directly supported extensions you also
+# need to set EXTENSION_MAPPING for the extension otherwise the files are not
+# properly processed by doxygen.
+
+FILTER_PATTERNS =
+
+# If the FILTER_SOURCE_FILES tag is set to YES, the input filter (if set using
+# INPUT_FILTER) will also be used to filter the input files that are used for
+# producing the source files to browse (i.e. when SOURCE_BROWSER is set to YES).
+# The default value is: NO.
+
+FILTER_SOURCE_FILES = NO
+
+# The FILTER_SOURCE_PATTERNS tag can be used to specify source filters per file
+# pattern. A pattern will override the setting for FILTER_PATTERN (if any) and
+# it is also possible to disable source filtering for a specific pattern using
+# *.ext= (so without naming a filter).
+# This tag requires that the tag FILTER_SOURCE_FILES is set to YES.
+
+FILTER_SOURCE_PATTERNS =
+
+# If the USE_MDFILE_AS_MAINPAGE tag refers to the name of a markdown file that
+# is part of the input, its contents will be placed on the main page
+# (index.html). This can be useful if you have a project on for instance GitHub
+# and want to reuse the introduction page also for the doxygen output.
+
+USE_MDFILE_AS_MAINPAGE =
+
+#---------------------------------------------------------------------------
+# Configuration options related to source browsing
+#---------------------------------------------------------------------------
+
+# If the SOURCE_BROWSER tag is set to YES then a list of source files will be
+# generated. Documented entities will be cross-referenced with these sources.
+#
+# Note: To get rid of all source code in the generated output, make sure that
+# also VERBATIM_HEADERS is set to NO.
+# The default value is: NO.
+
+SOURCE_BROWSER = YES
+
+# Setting the INLINE_SOURCES tag to YES will include the body of functions,
+# classes and enums directly into the documentation.
+# The default value is: NO.
+
+INLINE_SOURCES = NO
+
+# Setting the STRIP_CODE_COMMENTS tag to YES will instruct doxygen to hide any
+# special comment blocks from generated source code fragments. Normal C, C++ and
+# Fortran comments will always remain visible.
+# The default value is: YES.
+
+STRIP_CODE_COMMENTS = YES
+
+# If the REFERENCED_BY_RELATION tag is set to YES then for each documented
+# entity all documented functions referencing it will be listed.
+# The default value is: NO.
+
+REFERENCED_BY_RELATION = NO
+
+# If the REFERENCES_RELATION tag is set to YES then for each documented function
+# all documented entities called/used by that function will be listed.
+# The default value is: NO.
+
+REFERENCES_RELATION = NO
+
+# If the REFERENCES_LINK_SOURCE tag is set to YES and SOURCE_BROWSER tag is set
+# to YES then the hyperlinks from functions in REFERENCES_RELATION and
+# REFERENCED_BY_RELATION lists will link to the source code. Otherwise they will
+# link to the documentation.
+# The default value is: YES.
+
+REFERENCES_LINK_SOURCE = YES
+
+# If SOURCE_TOOLTIPS is enabled (the default) then hovering a hyperlink in the
+# source code will show a tooltip with additional information such as prototype,
+# brief description and links to the definition and documentation. Since this
+# will make the HTML file larger and loading of large files a bit slower, you
+# can opt to disable this feature.
+# The default value is: YES.
+# This tag requires that the tag SOURCE_BROWSER is set to YES.
+
+SOURCE_TOOLTIPS = YES
+
+# If the USE_HTAGS tag is set to YES then the references to source code will
+# point to the HTML generated by the htags(1) tool instead of doxygen built-in
+# source browser. The htags tool is part of GNU's global source tagging system
+# (see https://www.gnu.org/software/global/global.html). You will need version
+# 4.8.6 or higher.
+#
+# To use it do the following:
+# - Install the latest version of global
+# - Enable SOURCE_BROWSER and USE_HTAGS in the configuration file
+# - Make sure the INPUT points to the root of the source tree
+# - Run doxygen as normal
+#
+# Doxygen will invoke htags (and that will in turn invoke gtags), so these
+# tools must be available from the command line (i.e. in the search path).
+#
+# The result: instead of the source browser generated by doxygen, the links to
+# source code will now point to the output of htags.
+# The default value is: NO.
+# This tag requires that the tag SOURCE_BROWSER is set to YES.
+
+USE_HTAGS = NO
+
+# If the VERBATIM_HEADERS tag is set the YES then doxygen will generate a
+# verbatim copy of the header file for each class for which an include is
+# specified. Set to NO to disable this.
+# See also: Section \class.
+# The default value is: YES.
+
+VERBATIM_HEADERS = YES
+
+#---------------------------------------------------------------------------
+# Configuration options related to the alphabetical class index
+#---------------------------------------------------------------------------
+
+# If the ALPHABETICAL_INDEX tag is set to YES, an alphabetical index of all
+# compounds will be generated. Enable this if the project contains a lot of
+# classes, structs, unions or interfaces.
+# The default value is: YES.
+
+ALPHABETICAL_INDEX = YES
+
+# In case all classes in a project start with a common prefix, all classes will
+# be put under the same header in the alphabetical index. The IGNORE_PREFIX tag
+# can be used to specify a prefix (or a list of prefixes) that should be ignored
+# while generating the index headers.
+# This tag requires that the tag ALPHABETICAL_INDEX is set to YES.
+
+IGNORE_PREFIX =
+
+#---------------------------------------------------------------------------
+# Configuration options related to the HTML output
+#---------------------------------------------------------------------------
+
+# If the GENERATE_HTML tag is set to YES, doxygen will generate HTML output
+# The default value is: YES.
+
+GENERATE_HTML = YES
+
+# The HTML_OUTPUT tag is used to specify where the HTML docs will be put. If a
+# relative path is entered the value of OUTPUT_DIRECTORY will be put in front of
+# it.
+# The default directory is: html.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+HTML_OUTPUT = html
+
+# The HTML_FILE_EXTENSION tag can be used to specify the file extension for each
+# generated HTML page (for example: .htm, .php, .asp).
+# The default value is: .html.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+HTML_FILE_EXTENSION = .html
+
+# The HTML_HEADER tag can be used to specify a user-defined HTML header file for
+# each generated HTML page. If the tag is left blank doxygen will generate a
+# standard header.
+#
+# To get valid HTML the header file that includes any scripts and style sheets
+# that doxygen needs, which is dependent on the configuration options used (e.g.
+# the setting GENERATE_TREEVIEW). It is highly recommended to start with a
+# default header using
+# doxygen -w html new_header.html new_footer.html new_stylesheet.css
+# YourConfigFile
+# and then modify the file new_header.html. See also section "Doxygen usage"
+# for information on how to generate the default header that doxygen normally
+# uses.
+# Note: The header is subject to change so you typically have to regenerate the
+# default header when upgrading to a newer version of doxygen. For a description
+# of the possible markers and block names see the documentation.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+HTML_HEADER =
+
+# The HTML_FOOTER tag can be used to specify a user-defined HTML footer for each
+# generated HTML page. If the tag is left blank doxygen will generate a standard
+# footer. See HTML_HEADER for more information on how to generate a default
+# footer and what special commands can be used inside the footer. See also
+# section "Doxygen usage" for information on how to generate the default footer
+# that doxygen normally uses.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+HTML_FOOTER =
+
+# The HTML_STYLESHEET tag can be used to specify a user-defined cascading style
+# sheet that is used by each HTML page. It can be used to fine-tune the look of
+# the HTML output. If left blank doxygen will generate a default style sheet.
+# See also section "Doxygen usage" for information on how to generate the style
+# sheet that doxygen normally uses.
+# Note: It is recommended to use HTML_EXTRA_STYLESHEET instead of this tag, as
+# it is more robust and this tag (HTML_STYLESHEET) will in the future become
+# obsolete.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+HTML_STYLESHEET =
+
+# The HTML_EXTRA_STYLESHEET tag can be used to specify additional user-defined
+# cascading style sheets that are included after the standard style sheets
+# created by doxygen. Using this option one can overrule certain style aspects.
+# This is preferred over using HTML_STYLESHEET since it does not replace the
+# standard style sheet and is therefore more robust against future updates.
+# Doxygen will copy the style sheet files to the output directory.
+# Note: The order of the extra style sheet files is of importance (e.g. the last
+# style sheet in the list overrules the setting of the previous ones in the
+# list). For an example see the documentation.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+HTML_EXTRA_STYLESHEET =
+
+# The HTML_EXTRA_FILES tag can be used to specify one or more extra images or
+# other source files which should be copied to the HTML output directory. Note
+# that these files will be copied to the base HTML output directory. Use the
+# $relpath^ marker in the HTML_HEADER and/or HTML_FOOTER files to load these
+# files. In the HTML_STYLESHEET file, use the file name only. Also note that the
+# files will be copied as-is; there are no commands or markers available.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+HTML_EXTRA_FILES =
+
+# The HTML_COLORSTYLE_HUE tag controls the color of the HTML output. Doxygen
+# will adjust the colors in the style sheet and background images according to
+# this color. Hue is specified as an angle on a colorwheel, see
+# https://en.wikipedia.org/wiki/Hue for more information. For instance the value
+# 0 represents red, 60 is yellow, 120 is green, 180 is cyan, 240 is blue, 300
+# purple, and 360 is red again.
+# Minimum value: 0, maximum value: 359, default value: 220.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+HTML_COLORSTYLE_HUE = 220
+
+# The HTML_COLORSTYLE_SAT tag controls the purity (or saturation) of the colors
+# in the HTML output. For a value of 0 the output will use grayscales only. A
+# value of 255 will produce the most vivid colors.
+# Minimum value: 0, maximum value: 255, default value: 100.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+HTML_COLORSTYLE_SAT = 100
+
+# The HTML_COLORSTYLE_GAMMA tag controls the gamma correction applied to the
+# luminance component of the colors in the HTML output. Values below 100
+# gradually make the output lighter, whereas values above 100 make the output
+# darker. The value divided by 100 is the actual gamma applied, so 80 represents
+# a gamma of 0.8, The value 220 represents a gamma of 2.2, and 100 does not
+# change the gamma.
+# Minimum value: 40, maximum value: 240, default value: 80.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+HTML_COLORSTYLE_GAMMA = 80
+
+# If the HTML_TIMESTAMP tag is set to YES then the footer of each generated HTML
+# page will contain the date and time when the page was generated. Setting this
+# to YES can help to show when doxygen was last run and thus if the
+# documentation is up to date.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+HTML_TIMESTAMP = NO
+
+# If the HTML_DYNAMIC_MENUS tag is set to YES then the generated HTML
+# documentation will contain a main index with vertical navigation menus that
+# are dynamically created via JavaScript. If disabled, the navigation index will
+# consists of multiple levels of tabs that are statically embedded in every HTML
+# page. Disable this option to support browsers that do not have JavaScript,
+# like the Qt help browser.
+# The default value is: YES.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+HTML_DYNAMIC_MENUS = YES
+
+# If the HTML_DYNAMIC_SECTIONS tag is set to YES then the generated HTML
+# documentation will contain sections that can be hidden and shown after the
+# page has loaded.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+HTML_DYNAMIC_SECTIONS = YES
+
+# With HTML_INDEX_NUM_ENTRIES one can control the preferred number of entries
+# shown in the various tree structured indices initially; the user can expand
+# and collapse entries dynamically later on. Doxygen will expand the tree to
+# such a level that at most the specified number of entries are visible (unless
+# a fully collapsed tree already exceeds this amount). So setting the number of
+# entries 1 will produce a full collapsed tree by default. 0 is a special value
+# representing an infinite number of entries and will result in a full expanded
+# tree by default.
+# Minimum value: 0, maximum value: 9999, default value: 100.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+HTML_INDEX_NUM_ENTRIES = 100
+
+# If the GENERATE_DOCSET tag is set to YES, additional index files will be
+# generated that can be used as input for Apple's Xcode 3 integrated development
+# environment (see:
+# https://developer.apple.com/xcode/), introduced with OSX 10.5 (Leopard). To
+# create a documentation set, doxygen will generate a Makefile in the HTML
+# output directory. Running make will produce the docset in that directory and
+# running make install will install the docset in
+# ~/Library/Developer/Shared/Documentation/DocSets so that Xcode will find it at
+# startup. See https://developer.apple.com/library/archive/featuredarticles/Doxy
+# genXcode/_index.html for more information.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+GENERATE_DOCSET = NO
+
+# This tag determines the name of the docset feed. A documentation feed provides
+# an umbrella under which multiple documentation sets from a single provider
+# (such as a company or product suite) can be grouped.
+# The default value is: Doxygen generated docs.
+# This tag requires that the tag GENERATE_DOCSET is set to YES.
+
+DOCSET_FEEDNAME = "Doxygen generated docs"
+
+# This tag specifies a string that should uniquely identify the documentation
+# set bundle. This should be a reverse domain-name style string, e.g.
+# com.mycompany.MyDocSet. Doxygen will append .docset to the name.
+# The default value is: org.doxygen.Project.
+# This tag requires that the tag GENERATE_DOCSET is set to YES.
+
+DOCSET_BUNDLE_ID = org.doxygen.Project
+
+# The DOCSET_PUBLISHER_ID tag specifies a string that should uniquely identify
+# the documentation publisher. This should be a reverse domain-name style
+# string, e.g. com.mycompany.MyDocSet.documentation.
+# The default value is: org.doxygen.Publisher.
+# This tag requires that the tag GENERATE_DOCSET is set to YES.
+
+DOCSET_PUBLISHER_ID = org.doxygen.Publisher
+
+# The DOCSET_PUBLISHER_NAME tag identifies the documentation publisher.
+# The default value is: Publisher.
+# This tag requires that the tag GENERATE_DOCSET is set to YES.
+
+DOCSET_PUBLISHER_NAME = Publisher
+
+# If the GENERATE_HTMLHELP tag is set to YES then doxygen generates three
+# additional HTML index files: index.hhp, index.hhc, and index.hhk. The
+# index.hhp is a project file that can be read by Microsoft's HTML Help Workshop
+# (see:
+# https://www.microsoft.com/en-us/download/details.aspx?id=21138) on Windows.
+#
+# The HTML Help Workshop contains a compiler that can convert all HTML output
+# generated by doxygen into a single compiled HTML file (.chm). Compiled HTML
+# files are now used as the Windows 98 help format, and will replace the old
+# Windows help format (.hlp) on all Windows platforms in the future. Compressed
+# HTML files also contain an index, a table of contents, and you can search for
+# words in the documentation. The HTML workshop also contains a viewer for
+# compressed HTML files.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+GENERATE_HTMLHELP = NO
+
+# The CHM_FILE tag can be used to specify the file name of the resulting .chm
+# file. You can add a path in front of the file if the result should not be
+# written to the html output directory.
+# This tag requires that the tag GENERATE_HTMLHELP is set to YES.
+
+CHM_FILE =
+
+# The HHC_LOCATION tag can be used to specify the location (absolute path
+# including file name) of the HTML help compiler (hhc.exe). If non-empty,
+# doxygen will try to run the HTML help compiler on the generated index.hhp.
+# The file has to be specified with full path.
+# This tag requires that the tag GENERATE_HTMLHELP is set to YES.
+
+HHC_LOCATION =
+
+# The GENERATE_CHI flag controls if a separate .chi index file is generated
+# (YES) or that it should be included in the main .chm file (NO).
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTMLHELP is set to YES.
+
+GENERATE_CHI = NO
+
+# The CHM_INDEX_ENCODING is used to encode HtmlHelp index (hhk), content (hhc)
+# and project file content.
+# This tag requires that the tag GENERATE_HTMLHELP is set to YES.
+
+CHM_INDEX_ENCODING =
+
+# The BINARY_TOC flag controls whether a binary table of contents is generated
+# (YES) or a normal table of contents (NO) in the .chm file. Furthermore it
+# enables the Previous and Next buttons.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTMLHELP is set to YES.
+
+BINARY_TOC = NO
+
+# The TOC_EXPAND flag can be set to YES to add extra items for group members to
+# the table of contents of the HTML help documentation and to the tree view.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTMLHELP is set to YES.
+
+TOC_EXPAND = NO
+
+# If the GENERATE_QHP tag is set to YES and both QHP_NAMESPACE and
+# QHP_VIRTUAL_FOLDER are set, an additional index file will be generated that
+# can be used as input for Qt's qhelpgenerator to generate a Qt Compressed Help
+# (.qch) of the generated HTML documentation.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+GENERATE_QHP = NO
+
+# If the QHG_LOCATION tag is specified, the QCH_FILE tag can be used to specify
+# the file name of the resulting .qch file. The path specified is relative to
+# the HTML output folder.
+# This tag requires that the tag GENERATE_QHP is set to YES.
+
+QCH_FILE =
+
+# The QHP_NAMESPACE tag specifies the namespace to use when generating Qt Help
+# Project output. For more information please see Qt Help Project / Namespace
+# (see:
+# https://doc.qt.io/archives/qt-4.8/qthelpproject.html#namespace).
+# The default value is: org.doxygen.Project.
+# This tag requires that the tag GENERATE_QHP is set to YES.
+
+QHP_NAMESPACE = org.doxygen.Project
+
+# The QHP_VIRTUAL_FOLDER tag specifies the namespace to use when generating Qt
+# Help Project output. For more information please see Qt Help Project / Virtual
+# Folders (see:
+# https://doc.qt.io/archives/qt-4.8/qthelpproject.html#virtual-folders).
+# The default value is: doc.
+# This tag requires that the tag GENERATE_QHP is set to YES.
+
+QHP_VIRTUAL_FOLDER = doc
+
+# If the QHP_CUST_FILTER_NAME tag is set, it specifies the name of a custom
+# filter to add. For more information please see Qt Help Project / Custom
+# Filters (see:
+# https://doc.qt.io/archives/qt-4.8/qthelpproject.html#custom-filters).
+# This tag requires that the tag GENERATE_QHP is set to YES.
+
+QHP_CUST_FILTER_NAME =
+
+# The QHP_CUST_FILTER_ATTRS tag specifies the list of the attributes of the
+# custom filter to add. For more information please see Qt Help Project / Custom
+# Filters (see:
+# https://doc.qt.io/archives/qt-4.8/qthelpproject.html#custom-filters).
+# This tag requires that the tag GENERATE_QHP is set to YES.
+
+QHP_CUST_FILTER_ATTRS =
+
+# The QHP_SECT_FILTER_ATTRS tag specifies the list of the attributes this
+# project's filter section matches. Qt Help Project / Filter Attributes (see:
+# https://doc.qt.io/archives/qt-4.8/qthelpproject.html#filter-attributes).
+# This tag requires that the tag GENERATE_QHP is set to YES.
+
+QHP_SECT_FILTER_ATTRS =
+
+# The QHG_LOCATION tag can be used to specify the location (absolute path
+# including file name) of Qt's qhelpgenerator. If non-empty doxygen will try to
+# run qhelpgenerator on the generated .qhp file.
+# This tag requires that the tag GENERATE_QHP is set to YES.
+
+QHG_LOCATION =
+
+# If the GENERATE_ECLIPSEHELP tag is set to YES, additional index files will be
+# generated, together with the HTML files, they form an Eclipse help plugin. To
+# install this plugin and make it available under the help contents menu in
+# Eclipse, the contents of the directory containing the HTML and XML files needs
+# to be copied into the plugins directory of eclipse. The name of the directory
+# within the plugins directory should be the same as the ECLIPSE_DOC_ID value.
+# After copying Eclipse needs to be restarted before the help appears.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+GENERATE_ECLIPSEHELP = NO
+
+# A unique identifier for the Eclipse help plugin. When installing the plugin
+# the directory name containing the HTML and XML files should also have this
+# name. Each documentation set should have its own identifier.
+# The default value is: org.doxygen.Project.
+# This tag requires that the tag GENERATE_ECLIPSEHELP is set to YES.
+
+ECLIPSE_DOC_ID = org.doxygen.Project
+
+# If you want full control over the layout of the generated HTML pages it might
+# be necessary to disable the index and replace it with your own. The
+# DISABLE_INDEX tag can be used to turn on/off the condensed index (tabs) at top
+# of each HTML page. A value of NO enables the index and the value YES disables
+# it. Since the tabs in the index contain the same information as the navigation
+# tree, you can set this option to YES if you also set GENERATE_TREEVIEW to YES.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+DISABLE_INDEX = NO
+
+# The GENERATE_TREEVIEW tag is used to specify whether a tree-like index
+# structure should be generated to display hierarchical information. If the tag
+# value is set to YES, a side panel will be generated containing a tree-like
+# index structure (just like the one that is generated for HTML Help). For this
+# to work a browser that supports JavaScript, DHTML, CSS and frames is required
+# (i.e. any modern browser). Windows users are probably better off using the
+# HTML help feature. Via custom style sheets (see HTML_EXTRA_STYLESHEET) one can
+# further fine-tune the look of the index. As an example, the default style
+# sheet generated by doxygen has an example that shows how to put an image at
+# the root of the tree instead of the PROJECT_NAME. Since the tree basically has
+# the same information as the tab index, you could consider setting
+# DISABLE_INDEX to YES when enabling this option.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+GENERATE_TREEVIEW = NONE
+
+# The ENUM_VALUES_PER_LINE tag can be used to set the number of enum values that
+# doxygen will group on one line in the generated HTML documentation.
+#
+# Note that a value of 0 will completely suppress the enum values from appearing
+# in the overview section.
+# Minimum value: 0, maximum value: 20, default value: 4.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+ENUM_VALUES_PER_LINE = 4
+
+# If the treeview is enabled (see GENERATE_TREEVIEW) then this tag can be used
+# to set the initial width (in pixels) of the frame in which the tree is shown.
+# Minimum value: 0, maximum value: 1500, default value: 250.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+TREEVIEW_WIDTH = 250
+
+# If the EXT_LINKS_IN_WINDOW option is set to YES, doxygen will open links to
+# external symbols imported via tag files in a separate window.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+EXT_LINKS_IN_WINDOW = NO
+
+# If the HTML_FORMULA_FORMAT option is set to svg, doxygen will use the pdf2svg
+# tool (see https://github.com/dawbarton/pdf2svg) or inkscape (see
+# https://inkscape.org) to generate formulas as SVG images instead of PNGs for
+# the HTML output. These images will generally look nicer at scaled resolutions.
+# Possible values are: png (the default) and svg (looks nicer but requires the
+# pdf2svg or inkscape tool).
+# The default value is: png.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+HTML_FORMULA_FORMAT = png
+
+# Use this tag to change the font size of LaTeX formulas included as images in
+# the HTML documentation. When you change the font size after a successful
+# doxygen run you need to manually remove any form_*.png images from the HTML
+# output directory to force them to be regenerated.
+# Minimum value: 8, maximum value: 50, default value: 10.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+FORMULA_FONTSIZE = 10
+
+# Use the FORMULA_TRANSPARENT tag to determine whether or not the images
+# generated for formulas are transparent PNGs. Transparent PNGs are not
+# supported properly for IE 6.0, but are supported on all modern browsers.
+#
+# Note that when changing this option you need to delete any form_*.png files in
+# the HTML output directory before the changes have effect.
+# The default value is: YES.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+FORMULA_TRANSPARENT = YES
+
+# The FORMULA_MACROFILE can contain LaTeX \newcommand and \renewcommand commands
+# to create new LaTeX commands to be used in formulas as building blocks. See
+# the section "Including formulas" for details.
+
+FORMULA_MACROFILE =
+
+# Enable the USE_MATHJAX option to render LaTeX formulas using MathJax (see
+# https://www.mathjax.org) which uses client side JavaScript for the rendering
+# instead of using pre-rendered bitmaps. Use this if you do not have LaTeX
+# installed or if you want to formulas look prettier in the HTML output. When
+# enabled you may also need to install MathJax separately and configure the path
+# to it using the MATHJAX_RELPATH option.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+USE_MATHJAX = NO
+
+# When MathJax is enabled you can set the default output format to be used for
+# the MathJax output. See the MathJax site (see:
+# http://docs.mathjax.org/en/v2.7-latest/output.html) for more details.
+# Possible values are: HTML-CSS (which is slower, but has the best
+# compatibility), NativeMML (i.e. MathML) and SVG.
+# The default value is: HTML-CSS.
+# This tag requires that the tag USE_MATHJAX is set to YES.
+
+MATHJAX_FORMAT = HTML-CSS
+
+# When MathJax is enabled you need to specify the location relative to the HTML
+# output directory using the MATHJAX_RELPATH option. The destination directory
+# should contain the MathJax.js script. For instance, if the mathjax directory
+# is located at the same level as the HTML output directory, then
+# MATHJAX_RELPATH should be ../mathjax. The default value points to the MathJax
+# Content Delivery Network so you can quickly see the result without installing
+# MathJax. However, it is strongly recommended to install a local copy of
+# MathJax from https://www.mathjax.org before deployment.
+# The default value is: https://cdn.jsdelivr.net/npm/mathjax@2.
+# This tag requires that the tag USE_MATHJAX is set to YES.
+
+MATHJAX_RELPATH = https://cdn.jsdelivr.net/npm/mathjax@2
+
+# The MATHJAX_EXTENSIONS tag can be used to specify one or more MathJax
+# extension names that should be enabled during MathJax rendering. For example
+# MATHJAX_EXTENSIONS = TeX/AMSmath TeX/AMSsymbols
+# This tag requires that the tag USE_MATHJAX is set to YES.
+
+MATHJAX_EXTENSIONS =
+
+# The MATHJAX_CODEFILE tag can be used to specify a file with javascript pieces
+# of code that will be used on startup of the MathJax code. See the MathJax site
+# (see:
+# http://docs.mathjax.org/en/v2.7-latest/output.html) for more details. For an
+# example see the documentation.
+# This tag requires that the tag USE_MATHJAX is set to YES.
+
+MATHJAX_CODEFILE =
+
+# When the SEARCHENGINE tag is enabled doxygen will generate a search box for
+# the HTML output. The underlying search engine uses javascript and DHTML and
+# should work on any modern browser. Note that when using HTML help
+# (GENERATE_HTMLHELP), Qt help (GENERATE_QHP), or docsets (GENERATE_DOCSET)
+# there is already a search function so this one should typically be disabled.
+# For large projects the javascript based search engine can be slow, then
+# enabling SERVER_BASED_SEARCH may provide a better solution. It is possible to
+# search using the keyboard; to jump to the search box use <access key> + S
+# (what the <access key> is depends on the OS and browser, but it is typically
+# <CTRL>, <ALT>/<option>, or both). Inside the search box use the <cursor down
+# key> to jump into the search results window, the results can be navigated
+# using the <cursor keys>. Press <Enter> to select an item or <escape> to cancel
+# the search. The filter options can be selected when the cursor is inside the
+# search box by pressing <Shift>+<cursor down>. Also here use the <cursor keys>
+# to select a filter and <Enter> or <escape> to activate or cancel the filter
+# option.
+# The default value is: YES.
+# This tag requires that the tag GENERATE_HTML is set to YES.
+
+SEARCHENGINE = YES
+
+# When the SERVER_BASED_SEARCH tag is enabled the search engine will be
+# implemented using a web server instead of a web client using JavaScript. There
+# are two flavors of web server based searching depending on the EXTERNAL_SEARCH
+# setting. When disabled, doxygen will generate a PHP script for searching and
+# an index file used by the script. When EXTERNAL_SEARCH is enabled the indexing
+# and searching needs to be provided by external tools. See the section
+# "External Indexing and Searching" for details.
+# The default value is: NO.
+# This tag requires that the tag SEARCHENGINE is set to YES.
+
+SERVER_BASED_SEARCH = NO
+
+# When EXTERNAL_SEARCH tag is enabled doxygen will no longer generate the PHP
+# script for searching. Instead the search results are written to an XML file
+# which needs to be processed by an external indexer. Doxygen will invoke an
+# external search engine pointed to by the SEARCHENGINE_URL option to obtain the
+# search results.
+#
+# Doxygen ships with an example indexer (doxyindexer) and search engine
+# (doxysearch.cgi) which are based on the open source search engine library
+# Xapian (see:
+# https://xapian.org/).
+#
+# See the section "External Indexing and Searching" for details.
+# The default value is: NO.
+# This tag requires that the tag SEARCHENGINE is set to YES.
+
+EXTERNAL_SEARCH = NO
+
+# The SEARCHENGINE_URL should point to a search engine hosted by a web server
+# which will return the search results when EXTERNAL_SEARCH is enabled.
+#
+# Doxygen ships with an example indexer (doxyindexer) and search engine
+# (doxysearch.cgi) which are based on the open source search engine library
+# Xapian (see:
+# https://xapian.org/). See the section "External Indexing and Searching" for
+# details.
+# This tag requires that the tag SEARCHENGINE is set to YES.
+
+SEARCHENGINE_URL =
+
+# When SERVER_BASED_SEARCH and EXTERNAL_SEARCH are both enabled the unindexed
+# search data is written to a file for indexing by an external tool. With the
+# SEARCHDATA_FILE tag the name of this file can be specified.
+# The default file is: searchdata.xml.
+# This tag requires that the tag SEARCHENGINE is set to YES.
+
+SEARCHDATA_FILE = searchdata.xml
+
+# When SERVER_BASED_SEARCH and EXTERNAL_SEARCH are both enabled the
+# EXTERNAL_SEARCH_ID tag can be used as an identifier for the project. This is
+# useful in combination with EXTRA_SEARCH_MAPPINGS to search through multiple
+# projects and redirect the results back to the right project.
+# This tag requires that the tag SEARCHENGINE is set to YES.
+
+EXTERNAL_SEARCH_ID =
+
+# The EXTRA_SEARCH_MAPPINGS tag can be used to enable searching through doxygen
+# projects other than the one defined by this configuration file, but that are
+# all added to the same external search index. Each project needs to have a
+# unique id set via EXTERNAL_SEARCH_ID. The search mapping then maps the id of
+# to a relative location where the documentation can be found. The format is:
+# EXTRA_SEARCH_MAPPINGS = tagname1=loc1 tagname2=loc2 ...
+# This tag requires that the tag SEARCHENGINE is set to YES.
+
+EXTRA_SEARCH_MAPPINGS =
+
+#---------------------------------------------------------------------------
+# Configuration options related to the LaTeX output
+#---------------------------------------------------------------------------
+
+# If the GENERATE_LATEX tag is set to YES, doxygen will generate LaTeX output.
+# The default value is: YES.
+
+GENERATE_LATEX = NO
+
+# The LATEX_OUTPUT tag is used to specify where the LaTeX docs will be put. If a
+# relative path is entered the value of OUTPUT_DIRECTORY will be put in front of
+# it.
+# The default directory is: latex.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+
+LATEX_OUTPUT = latex
+
+# The LATEX_CMD_NAME tag can be used to specify the LaTeX command name to be
+# invoked.
+#
+# Note that when not enabling USE_PDFLATEX the default is latex when enabling
+# USE_PDFLATEX the default is pdflatex and when in the later case latex is
+# chosen this is overwritten by pdflatex. For specific output languages the
+# default can have been set differently, this depends on the implementation of
+# the output language.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+
+LATEX_CMD_NAME = latex
+
+# The MAKEINDEX_CMD_NAME tag can be used to specify the command name to generate
+# index for LaTeX.
+# Note: This tag is used in the Makefile / make.bat.
+# See also: LATEX_MAKEINDEX_CMD for the part in the generated output file
+# (.tex).
+# The default file is: makeindex.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+
+MAKEINDEX_CMD_NAME = makeindex
+
+# The LATEX_MAKEINDEX_CMD tag can be used to specify the command name to
+# generate index for LaTeX. In case there is no backslash (\) as first character
+# it will be automatically added in the LaTeX code.
+# Note: This tag is used in the generated output file (.tex).
+# See also: MAKEINDEX_CMD_NAME for the part in the Makefile / make.bat.
+# The default value is: makeindex.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+
+LATEX_MAKEINDEX_CMD = makeindex
+
+# If the COMPACT_LATEX tag is set to YES, doxygen generates more compact LaTeX
+# documents. This may be useful for small projects and may help to save some
+# trees in general.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+
+COMPACT_LATEX = NO
+
+# The PAPER_TYPE tag can be used to set the paper type that is used by the
+# printer.
+# Possible values are: a4 (210 x 297 mm), letter (8.5 x 11 inches), legal (8.5 x
+# 14 inches) and executive (7.25 x 10.5 inches).
+# The default value is: a4.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+
+PAPER_TYPE = a4wide
+
+# The EXTRA_PACKAGES tag can be used to specify one or more LaTeX package names
+# that should be included in the LaTeX output. The package can be specified just
+# by its name or with the correct syntax as to be used with the LaTeX
+# \usepackage command. To get the times font for instance you can specify :
+# EXTRA_PACKAGES=times or EXTRA_PACKAGES={times}
+# To use the option intlimits with the amsmath package you can specify:
+# EXTRA_PACKAGES=[intlimits]{amsmath}
+# If left blank no extra packages will be included.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+
+EXTRA_PACKAGES =
+
+# The LATEX_HEADER tag can be used to specify a personal LaTeX header for the
+# generated LaTeX document. The header should contain everything until the first
+# chapter. If it is left blank doxygen will generate a standard header. See
+# section "Doxygen usage" for information on how to let doxygen write the
+# default header to a separate file.
+#
+# Note: Only use a user-defined header if you know what you are doing! The
+# following commands have a special meaning inside the header: $title,
+# $datetime, $date, $doxygenversion, $projectname, $projectnumber,
+# $projectbrief, $projectlogo. Doxygen will replace $title with the empty
+# string, for the replacement values of the other commands the user is referred
+# to HTML_HEADER.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+
+LATEX_HEADER =
+
+# The LATEX_FOOTER tag can be used to specify a personal LaTeX footer for the
+# generated LaTeX document. The footer should contain everything after the last
+# chapter. If it is left blank doxygen will generate a standard footer. See
+# LATEX_HEADER for more information on how to generate a default footer and what
+# special commands can be used inside the footer.
+#
+# Note: Only use a user-defined footer if you know what you are doing!
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+
+LATEX_FOOTER =
+
+# The LATEX_EXTRA_STYLESHEET tag can be used to specify additional user-defined
+# LaTeX style sheets that are included after the standard style sheets created
+# by doxygen. Using this option one can overrule certain style aspects. Doxygen
+# will copy the style sheet files to the output directory.
+# Note: The order of the extra style sheet files is of importance (e.g. the last
+# style sheet in the list overrules the setting of the previous ones in the
+# list).
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+
+LATEX_EXTRA_STYLESHEET =
+
+# The LATEX_EXTRA_FILES tag can be used to specify one or more extra images or
+# other source files which should be copied to the LATEX_OUTPUT output
+# directory. Note that the files will be copied as-is; there are no commands or
+# markers available.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+
+LATEX_EXTRA_FILES =
+
+# If the PDF_HYPERLINKS tag is set to YES, the LaTeX that is generated is
+# prepared for conversion to PDF (using ps2pdf or pdflatex). The PDF file will
+# contain links (just like the HTML output) instead of page references. This
+# makes the output suitable for online browsing using a PDF viewer.
+# The default value is: YES.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+
+PDF_HYPERLINKS = YES
+
+# If the USE_PDFLATEX tag is set to YES, doxygen will use the engine as
+# specified with LATEX_CMD_NAME to generate the PDF file directly from the LaTeX
+# files. Set this option to YES, to get a higher quality PDF documentation.
+#
+# See also section LATEX_CMD_NAME for selecting the engine.
+# The default value is: YES.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+
+USE_PDFLATEX = YES
+
+# If the LATEX_BATCHMODE tag is set to YES, doxygen will add the \batchmode
+# command to the generated LaTeX files. This will instruct LaTeX to keep running
+# if errors occur, instead of asking the user for help. This option is also used
+# when generating formulas in HTML.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+
+LATEX_BATCHMODE = NO
+
+# If the LATEX_HIDE_INDICES tag is set to YES then doxygen will not include the
+# index chapters (such as File Index, Compound Index, etc.) in the output.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+
+LATEX_HIDE_INDICES = NO
+
+# If the LATEX_SOURCE_CODE tag is set to YES then doxygen will include source
+# code with syntax highlighting in the LaTeX output.
+#
+# Note that which sources are shown also depends on other settings such as
+# SOURCE_BROWSER.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+
+LATEX_SOURCE_CODE = NO
+
+# The LATEX_BIB_STYLE tag can be used to specify the style to use for the
+# bibliography, e.g. plainnat, or ieeetr. See
+# https://en.wikipedia.org/wiki/BibTeX and \cite for more info.
+# The default value is: plain.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+
+LATEX_BIB_STYLE = plain
+
+# If the LATEX_TIMESTAMP tag is set to YES then the footer of each generated
+# page will contain the date and time when the page was generated. Setting this
+# to NO can help when comparing the output of multiple runs.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+
+LATEX_TIMESTAMP = NO
+
+# The LATEX_EMOJI_DIRECTORY tag is used to specify the (relative or absolute)
+# path from which the emoji images will be read. If a relative path is entered,
+# it will be relative to the LATEX_OUTPUT directory. If left blank the
+# LATEX_OUTPUT directory will be used.
+# This tag requires that the tag GENERATE_LATEX is set to YES.
+
+LATEX_EMOJI_DIRECTORY =
+
+#---------------------------------------------------------------------------
+# Configuration options related to the RTF output
+#---------------------------------------------------------------------------
+
+# If the GENERATE_RTF tag is set to YES, doxygen will generate RTF output. The
+# RTF output is optimized for Word 97 and may not look too pretty with other RTF
+# readers/editors.
+# The default value is: NO.
+
+GENERATE_RTF = NO
+
+# The RTF_OUTPUT tag is used to specify where the RTF docs will be put. If a
+# relative path is entered the value of OUTPUT_DIRECTORY will be put in front of
+# it.
+# The default directory is: rtf.
+# This tag requires that the tag GENERATE_RTF is set to YES.
+
+RTF_OUTPUT = rtf
+
+# If the COMPACT_RTF tag is set to YES, doxygen generates more compact RTF
+# documents. This may be useful for small projects and may help to save some
+# trees in general.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_RTF is set to YES.
+
+COMPACT_RTF = NO
+
+# If the RTF_HYPERLINKS tag is set to YES, the RTF that is generated will
+# contain hyperlink fields. The RTF file will contain links (just like the HTML
+# output) instead of page references. This makes the output suitable for online
+# browsing using Word or some other Word compatible readers that support those
+# fields.
+#
+# Note: WordPad (write) and others do not support links.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_RTF is set to YES.
+
+RTF_HYPERLINKS = NO
+
+# Load stylesheet definitions from file. Syntax is similar to doxygen's
+# configuration file, i.e. a series of assignments. You only have to provide
+# replacements, missing definitions are set to their default value.
+#
+# See also section "Doxygen usage" for information on how to generate the
+# default style sheet that doxygen normally uses.
+# This tag requires that the tag GENERATE_RTF is set to YES.
+
+RTF_STYLESHEET_FILE =
+
+# Set optional variables used in the generation of an RTF document. Syntax is
+# similar to doxygen's configuration file. A template extensions file can be
+# generated using doxygen -e rtf extensionFile.
+# This tag requires that the tag GENERATE_RTF is set to YES.
+
+RTF_EXTENSIONS_FILE =
+
+# If the RTF_SOURCE_CODE tag is set to YES then doxygen will include source code
+# with syntax highlighting in the RTF output.
+#
+# Note that which sources are shown also depends on other settings such as
+# SOURCE_BROWSER.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_RTF is set to YES.
+
+RTF_SOURCE_CODE = NO
+
+#---------------------------------------------------------------------------
+# Configuration options related to the man page output
+#---------------------------------------------------------------------------
+
+# If the GENERATE_MAN tag is set to YES, doxygen will generate man pages for
+# classes and files.
+# The default value is: NO.
+
+GENERATE_MAN = NO
+
+# The MAN_OUTPUT tag is used to specify where the man pages will be put. If a
+# relative path is entered the value of OUTPUT_DIRECTORY will be put in front of
+# it. A directory man3 will be created inside the directory specified by
+# MAN_OUTPUT.
+# The default directory is: man.
+# This tag requires that the tag GENERATE_MAN is set to YES.
+
+MAN_OUTPUT = man
+
+# The MAN_EXTENSION tag determines the extension that is added to the generated
+# man pages. In case the manual section does not start with a number, the number
+# 3 is prepended. The dot (.) at the beginning of the MAN_EXTENSION tag is
+# optional.
+# The default value is: .3.
+# This tag requires that the tag GENERATE_MAN is set to YES.
+
+MAN_EXTENSION = .3
+
+# The MAN_SUBDIR tag determines the name of the directory created within
+# MAN_OUTPUT in which the man pages are placed. If defaults to man followed by
+# MAN_EXTENSION with the initial . removed.
+# This tag requires that the tag GENERATE_MAN is set to YES.
+
+MAN_SUBDIR =
+
+# If the MAN_LINKS tag is set to YES and doxygen generates man output, then it
+# will generate one additional man file for each entity documented in the real
+# man page(s). These additional files only source the real man page, but without
+# them the man command would be unable to find the correct page.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_MAN is set to YES.
+
+MAN_LINKS = NO
+
+#---------------------------------------------------------------------------
+# Configuration options related to the XML output
+#---------------------------------------------------------------------------
+
+# If the GENERATE_XML tag is set to YES, doxygen will generate an XML file that
+# captures the structure of the code including all documentation.
+# The default value is: NO.
+
+GENERATE_XML = NO
+
+# The XML_OUTPUT tag is used to specify where the XML pages will be put. If a
+# relative path is entered the value of OUTPUT_DIRECTORY will be put in front of
+# it.
+# The default directory is: xml.
+# This tag requires that the tag GENERATE_XML is set to YES.
+
+XML_OUTPUT = xml
+
+# If the XML_PROGRAMLISTING tag is set to YES, doxygen will dump the program
+# listings (including syntax highlighting and cross-referencing information) to
+# the XML output. Note that enabling this will significantly increase the size
+# of the XML output.
+# The default value is: YES.
+# This tag requires that the tag GENERATE_XML is set to YES.
+
+XML_PROGRAMLISTING = YES
+
+# If the XML_NS_MEMB_FILE_SCOPE tag is set to YES, doxygen will include
+# namespace members in file scope as well, matching the HTML output.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_XML is set to YES.
+
+XML_NS_MEMB_FILE_SCOPE = NO
+
+#---------------------------------------------------------------------------
+# Configuration options related to the DOCBOOK output
+#---------------------------------------------------------------------------
+
+# If the GENERATE_DOCBOOK tag is set to YES, doxygen will generate Docbook files
+# that can be used to generate PDF.
+# The default value is: NO.
+
+GENERATE_DOCBOOK = NO
+
+# The DOCBOOK_OUTPUT tag is used to specify where the Docbook pages will be put.
+# If a relative path is entered the value of OUTPUT_DIRECTORY will be put in
+# front of it.
+# The default directory is: docbook.
+# This tag requires that the tag GENERATE_DOCBOOK is set to YES.
+
+DOCBOOK_OUTPUT = docbook
+
+# If the DOCBOOK_PROGRAMLISTING tag is set to YES, doxygen will include the
+# program listings (including syntax highlighting and cross-referencing
+# information) to the DOCBOOK output. Note that enabling this will significantly
+# increase the size of the DOCBOOK output.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_DOCBOOK is set to YES.
+
+DOCBOOK_PROGRAMLISTING = NO
+
+#---------------------------------------------------------------------------
+# Configuration options for the AutoGen Definitions output
+#---------------------------------------------------------------------------
+
+# If the GENERATE_AUTOGEN_DEF tag is set to YES, doxygen will generate an
+# AutoGen Definitions (see http://autogen.sourceforge.net/) file that captures
+# the structure of the code including all documentation. Note that this feature
+# is still experimental and incomplete at the moment.
+# The default value is: NO.
+
+GENERATE_AUTOGEN_DEF = NO
+
+#---------------------------------------------------------------------------
+# Configuration options related to the Perl module output
+#---------------------------------------------------------------------------
+
+# If the GENERATE_PERLMOD tag is set to YES, doxygen will generate a Perl module
+# file that captures the structure of the code including all documentation.
+#
+# Note that this feature is still experimental and incomplete at the moment.
+# The default value is: NO.
+
+GENERATE_PERLMOD = NO
+
+# If the PERLMOD_LATEX tag is set to YES, doxygen will generate the necessary
+# Makefile rules, Perl scripts and LaTeX code to be able to generate PDF and DVI
+# output from the Perl module output.
+# The default value is: NO.
+# This tag requires that the tag GENERATE_PERLMOD is set to YES.
+
+PERLMOD_LATEX = NO
+
+# If the PERLMOD_PRETTY tag is set to YES, the Perl module output will be nicely
+# formatted so it can be parsed by a human reader. This is useful if you want to
+# understand what is going on. On the other hand, if this tag is set to NO, the
+# size of the Perl module output will be much smaller and Perl will parse it
+# just the same.
+# The default value is: YES.
+# This tag requires that the tag GENERATE_PERLMOD is set to YES.
+
+PERLMOD_PRETTY = YES
+
+# The names of the make variables in the generated doxyrules.make file are
+# prefixed with the string contained in PERLMOD_MAKEVAR_PREFIX. This is useful
+# so different doxyrules.make files included by the same Makefile don't
+# overwrite each other's variables.
+# This tag requires that the tag GENERATE_PERLMOD is set to YES.
+
+PERLMOD_MAKEVAR_PREFIX =
+
+#---------------------------------------------------------------------------
+# Configuration options related to the preprocessor
+#---------------------------------------------------------------------------
+
+# If the ENABLE_PREPROCESSING tag is set to YES, doxygen will evaluate all
+# C-preprocessor directives found in the sources and include files.
+# The default value is: YES.
+
+ENABLE_PREPROCESSING = YES
+
+# If the MACRO_EXPANSION tag is set to YES, doxygen will expand all macro names
+# in the source code. If set to NO, only conditional compilation will be
+# performed. Macro expansion can be done in a controlled way by setting
+# EXPAND_ONLY_PREDEF to YES.
+# The default value is: NO.
+# This tag requires that the tag ENABLE_PREPROCESSING is set to YES.
+
+MACRO_EXPANSION = YES
+
+# If the EXPAND_ONLY_PREDEF and MACRO_EXPANSION tags are both set to YES then
+# the macro expansion is limited to the macros specified with the PREDEFINED and
+# EXPAND_AS_DEFINED tags.
+# The default value is: NO.
+# This tag requires that the tag ENABLE_PREPROCESSING is set to YES.
+
+EXPAND_ONLY_PREDEF = NO
+
+# If the SEARCH_INCLUDES tag is set to YES, the include files in the
+# INCLUDE_PATH will be searched if a #include is found.
+# The default value is: YES.
+# This tag requires that the tag ENABLE_PREPROCESSING is set to YES.
+
+SEARCH_INCLUDES = YES
+
+# The INCLUDE_PATH tag can be used to specify one or more directories that
+# contain include files that are not input files but should be processed by the
+# preprocessor.
+# This tag requires that the tag SEARCH_INCLUDES is set to YES.
+
+INCLUDE_PATH =
+
+# You can use the INCLUDE_FILE_PATTERNS tag to specify one or more wildcard
+# patterns (like *.h and *.hpp) to filter out the header-files in the
+# directories. If left blank, the patterns specified with FILE_PATTERNS will be
+# used.
+# This tag requires that the tag ENABLE_PREPROCESSING is set to YES.
+
+INCLUDE_FILE_PATTERNS = *.hh
+
+# The PREDEFINED tag can be used to specify one or more macro names that are
+# defined before the preprocessor is started (similar to the -D option of e.g.
+# gcc). The argument of the tag is a list of macros of the form: name or
+# name=definition (no spaces). If the definition and the "=" are omitted, "=1"
+# is assumed. To prevent a macro definition from being undefined via #undef or
+# recursively expanded use the := operator instead of the = operator.
+# This tag requires that the tag ENABLE_PREPROCESSING is set to YES.
+
+PREDEFINED =
+
+# If the MACRO_EXPANSION and EXPAND_ONLY_PREDEF tags are set to YES then this
+# tag can be used to specify a list of macro names that should be expanded. The
+# macro definition that is found in the sources will be used. Use the PREDEFINED
+# tag if you want to use a different macro definition that overrules the
+# definition found in the source code.
+# This tag requires that the tag ENABLE_PREPROCESSING is set to YES.
+
+EXPAND_AS_DEFINED =
+
+# If the SKIP_FUNCTION_MACROS tag is set to YES then doxygen's preprocessor will
+# remove all references to function-like macros that are alone on a line, have
+# an all uppercase name, and do not end with a semicolon. Such function macros
+# are typically used for boiler-plate code, and will confuse the parser if not
+# removed.
+# The default value is: YES.
+# This tag requires that the tag ENABLE_PREPROCESSING is set to YES.
+
+SKIP_FUNCTION_MACROS = YES
+
+#---------------------------------------------------------------------------
+# Configuration options related to external references
+#---------------------------------------------------------------------------
+
+# The TAGFILES tag can be used to specify one or more tag files. For each tag
+# file the location of the external documentation should be added. The format of
+# a tag file without this location is as follows:
+# TAGFILES = file1 file2 ...
+# Adding location for the tag files is done as follows:
+# TAGFILES = file1=loc1 "file2 = loc2" ...
+# where loc1 and loc2 can be relative or absolute paths or URLs. See the
+# section "Linking to external documentation" for more information about the use
+# of tag files.
+# Note: Each tag file must have a unique name (where the name does NOT include
+# the path). If a tag file is not located in the directory in which doxygen is
+# run, you must also specify the path to the tagfile here.
+
+TAGFILES =
+
+# When a file name is specified after GENERATE_TAGFILE, doxygen will create a
+# tag file that is based on the input files it reads. See section "Linking to
+# external documentation" for more information about the usage of tag files.
+
+GENERATE_TAGFILE =
+
+# If the ALLEXTERNALS tag is set to YES, all external class will be listed in
+# the class index. If set to NO, only the inherited external classes will be
+# listed.
+# The default value is: NO.
+
+ALLEXTERNALS = NO
+
+# If the EXTERNAL_GROUPS tag is set to YES, all external groups will be listed
+# in the modules index. If set to NO, only the current project's groups will be
+# listed.
+# The default value is: YES.
+
+EXTERNAL_GROUPS = YES
+
+# If the EXTERNAL_PAGES tag is set to YES, all external pages will be listed in
+# the related pages index. If set to NO, only the current project's pages will
+# be listed.
+# The default value is: YES.
+
+EXTERNAL_PAGES = YES
+
+#---------------------------------------------------------------------------
+# Configuration options related to the dot tool
+#---------------------------------------------------------------------------
+
+# If the CLASS_DIAGRAMS tag is set to YES, doxygen will generate a class diagram
+# (in HTML and LaTeX) for classes with base or super classes. Setting the tag to
+# NO turns the diagrams off. Note that this option also works with HAVE_DOT
+# disabled, but it is recommended to install and use dot, since it yields more
+# powerful graphs.
+# The default value is: YES.
+
+CLASS_DIAGRAMS = NO
+
+# You can include diagrams made with dia in doxygen documentation. Doxygen will
+# then run dia to produce the diagram and insert it in the documentation. The
+# DIA_PATH tag allows you to specify the directory where the dia binary resides.
+# If left empty dia is assumed to be found in the default search path.
+
+DIA_PATH =
+
+# If set to YES the inheritance and collaboration graphs will hide inheritance
+# and usage relations if the target is undocumented or is not a class.
+# The default value is: YES.
+
+HIDE_UNDOC_RELATIONS = YES
+
+# If you set the HAVE_DOT tag to YES then doxygen will assume the dot tool is
+# available from the path. This tool is part of Graphviz (see:
+# http://www.graphviz.org/), a graph visualization toolkit from AT&T and Lucent
+# Bell Labs. The other options in this section have no effect if this option is
+# set to NO
+# The default value is: NO.
+
+HAVE_DOT = NO
+
+# The DOT_NUM_THREADS specifies the number of dot invocations doxygen is allowed
+# to run in parallel. When set to 0 doxygen will base this on the number of
+# processors available in the system. You can set it explicitly to a value
+# larger than 0 to get control over the balance between CPU load and processing
+# speed.
+# Minimum value: 0, maximum value: 32, default value: 0.
+# This tag requires that the tag HAVE_DOT is set to YES.
+
+DOT_NUM_THREADS = 0
+
+# When you want a differently looking font in the dot files that doxygen
+# generates you can specify the font name using DOT_FONTNAME. You need to make
+# sure dot is able to find the font, which can be done by putting it in a
+# standard location or by setting the DOTFONTPATH environment variable or by
+# setting DOT_FONTPATH to the directory containing the font.
+# The default value is: Helvetica.
+# This tag requires that the tag HAVE_DOT is set to YES.
+
+DOT_FONTNAME = Helvetica
+
+# The DOT_FONTSIZE tag can be used to set the size (in points) of the font of
+# dot graphs.
+# Minimum value: 4, maximum value: 24, default value: 10.
+# This tag requires that the tag HAVE_DOT is set to YES.
+
+DOT_FONTSIZE = 10
+
+# By default doxygen will tell dot to use the default font as specified with
+# DOT_FONTNAME. If you specify a different font using DOT_FONTNAME you can set
+# the path where dot can find it using this tag.
+# This tag requires that the tag HAVE_DOT is set to YES.
+
+DOT_FONTPATH =
+
+# If the CLASS_GRAPH tag is set to YES then doxygen will generate a graph for
+# each documented class showing the direct and indirect inheritance relations.
+# Setting this tag to YES will force the CLASS_DIAGRAMS tag to NO.
+# The default value is: YES.
+# This tag requires that the tag HAVE_DOT is set to YES.
+
+CLASS_GRAPH = YES
+
+# If the COLLABORATION_GRAPH tag is set to YES then doxygen will generate a
+# graph for each documented class showing the direct and indirect implementation
+# dependencies (inheritance, containment, and class references variables) of the
+# class with other documented classes.
+# The default value is: YES.
+# This tag requires that the tag HAVE_DOT is set to YES.
+
+COLLABORATION_GRAPH = YES
+
+# If the GROUP_GRAPHS tag is set to YES then doxygen will generate a graph for
+# groups, showing the direct groups dependencies.
+# The default value is: YES.
+# This tag requires that the tag HAVE_DOT is set to YES.
+
+GROUP_GRAPHS = YES
+
+# If the UML_LOOK tag is set to YES, doxygen will generate inheritance and
+# collaboration diagrams in a style similar to the OMG's Unified Modeling
+# Language.
+# The default value is: NO.
+# This tag requires that the tag HAVE_DOT is set to YES.
+
+UML_LOOK = NO
+
+# If the UML_LOOK tag is enabled, the fields and methods are shown inside the
+# class node. If there are many fields or methods and many nodes the graph may
+# become too big to be useful. The UML_LIMIT_NUM_FIELDS threshold limits the
+# number of items for each type to make the size more manageable. Set this to 0
+# for no limit. Note that the threshold may be exceeded by 50% before the limit
+# is enforced. So when you set the threshold to 10, up to 15 fields may appear,
+# but if the number exceeds 15, the total amount of fields shown is limited to
+# 10.
+# Minimum value: 0, maximum value: 100, default value: 10.
+# This tag requires that the tag UML_LOOK is set to YES.
+
+UML_LIMIT_NUM_FIELDS = 10
+
+# If the DOT_UML_DETAILS tag is set to NO, doxygen will show attributes and
+# methods without types and arguments in the UML graphs. If the DOT_UML_DETAILS
+# tag is set to YES, doxygen will add type and arguments for attributes and
+# methods in the UML graphs. If the DOT_UML_DETAILS tag is set to NONE, doxygen
+# will not generate fields with class member information in the UML graphs. The
+# class diagrams will look similar to the default class diagrams but using UML
+# notation for the relationships.
+# Possible values are: NO, YES and NONE.
+# The default value is: NO.
+# This tag requires that the tag UML_LOOK is set to YES.
+
+DOT_UML_DETAILS = NO
+
+# The DOT_WRAP_THRESHOLD tag can be used to set the maximum number of characters
+# to display on a single line. If the actual line length exceeds this threshold
+# significantly it will wrapped across multiple lines. Some heuristics are apply
+# to avoid ugly line breaks.
+# Minimum value: 0, maximum value: 1000, default value: 17.
+# This tag requires that the tag HAVE_DOT is set to YES.
+
+DOT_WRAP_THRESHOLD = 17
+
+# If the TEMPLATE_RELATIONS tag is set to YES then the inheritance and
+# collaboration graphs will show the relations between templates and their
+# instances.
+# The default value is: NO.
+# This tag requires that the tag HAVE_DOT is set to YES.
+
+TEMPLATE_RELATIONS = NO
+
+# If the INCLUDE_GRAPH, ENABLE_PREPROCESSING and SEARCH_INCLUDES tags are set to
+# YES then doxygen will generate a graph for each documented file showing the
+# direct and indirect include dependencies of the file with other documented
+# files.
+# The default value is: YES.
+# This tag requires that the tag HAVE_DOT is set to YES.
+
+INCLUDE_GRAPH = YES
+
+# If the INCLUDED_BY_GRAPH, ENABLE_PREPROCESSING and SEARCH_INCLUDES tags are
+# set to YES then doxygen will generate a graph for each documented file showing
+# the direct and indirect include dependencies of the file with other documented
+# files.
+# The default value is: YES.
+# This tag requires that the tag HAVE_DOT is set to YES.
+
+INCLUDED_BY_GRAPH = YES
+
+# If the CALL_GRAPH tag is set to YES then doxygen will generate a call
+# dependency graph for every global function or class method.
+#
+# Note that enabling this option will significantly increase the time of a run.
+# So in most cases it will be better to enable call graphs for selected
+# functions only using the \callgraph command. Disabling a call graph can be
+# accomplished by means of the command \hidecallgraph.
+# The default value is: NO.
+# This tag requires that the tag HAVE_DOT is set to YES.
+
+CALL_GRAPH = NO
+
+# If the CALLER_GRAPH tag is set to YES then doxygen will generate a caller
+# dependency graph for every global function or class method.
+#
+# Note that enabling this option will significantly increase the time of a run.
+# So in most cases it will be better to enable caller graphs for selected
+# functions only using the \callergraph command. Disabling a caller graph can be
+# accomplished by means of the command \hidecallergraph.
+# The default value is: NO.
+# This tag requires that the tag HAVE_DOT is set to YES.
+
+CALLER_GRAPH = NO
+
+# If the GRAPHICAL_HIERARCHY tag is set to YES then doxygen will graphical
+# hierarchy of all classes instead of a textual one.
+# The default value is: YES.
+# This tag requires that the tag HAVE_DOT is set to YES.
+
+GRAPHICAL_HIERARCHY = YES
+
+# If the DIRECTORY_GRAPH tag is set to YES then doxygen will show the
+# dependencies a directory has on other directories in a graphical way. The
+# dependency relations are determined by the #include relations between the
+# files in the directories.
+# The default value is: YES.
+# This tag requires that the tag HAVE_DOT is set to YES.
+
+DIRECTORY_GRAPH = YES
+
+# The DOT_IMAGE_FORMAT tag can be used to set the image format of the images
+# generated by dot. For an explanation of the image formats see the section
+# output formats in the documentation of the dot tool (Graphviz (see:
+# http://www.graphviz.org/)).
+# Note: If you choose svg you need to set HTML_FILE_EXTENSION to xhtml in order
+# to make the SVG files visible in IE 9+ (other browsers do not have this
+# requirement).
+# Possible values are: png, jpg, gif, svg, png:gd, png:gd:gd, png:cairo,
+# png:cairo:gd, png:cairo:cairo, png:cairo:gdiplus, png:gdiplus and
+# png:gdiplus:gdiplus.
+# The default value is: png.
+# This tag requires that the tag HAVE_DOT is set to YES.
+
+DOT_IMAGE_FORMAT = png
+
+# If DOT_IMAGE_FORMAT is set to svg, then this option can be set to YES to
+# enable generation of interactive SVG images that allow zooming and panning.
+#
+# Note that this requires a modern browser other than Internet Explorer. Tested
+# and working are Firefox, Chrome, Safari, and Opera.
+# Note: For IE 9+ you need to set HTML_FILE_EXTENSION to xhtml in order to make
+# the SVG files visible. Older versions of IE do not have SVG support.
+# The default value is: NO.
+# This tag requires that the tag HAVE_DOT is set to YES.
+
+INTERACTIVE_SVG = NO
+
+# The DOT_PATH tag can be used to specify the path where the dot tool can be
+# found. If left blank, it is assumed the dot tool can be found in the path.
+# This tag requires that the tag HAVE_DOT is set to YES.
+
+DOT_PATH =
+
+# The DOTFILE_DIRS tag can be used to specify one or more directories that
+# contain dot files that are included in the documentation (see the \dotfile
+# command).
+# This tag requires that the tag HAVE_DOT is set to YES.
+
+DOTFILE_DIRS =
+
+# The MSCFILE_DIRS tag can be used to specify one or more directories that
+# contain msc files that are included in the documentation (see the \mscfile
+# command).
+
+MSCFILE_DIRS =
+
+# The DIAFILE_DIRS tag can be used to specify one or more directories that
+# contain dia files that are included in the documentation (see the \diafile
+# command).
+
+DIAFILE_DIRS =
+
+# When using plantuml, the PLANTUML_JAR_PATH tag should be used to specify the
+# path where java can find the plantuml.jar file. If left blank, it is assumed
+# PlantUML is not used or called during a preprocessing step. Doxygen will
+# generate a warning when it encounters a \startuml command in this case and
+# will not generate output for the diagram.
+
+PLANTUML_JAR_PATH =
+
+# When using plantuml, the PLANTUML_CFG_FILE tag can be used to specify a
+# configuration file for plantuml.
+
+PLANTUML_CFG_FILE =
+
+# When using plantuml, the specified paths are searched for files specified by
+# the !include statement in a plantuml block.
+
+PLANTUML_INCLUDE_PATH =
+
+# The DOT_GRAPH_MAX_NODES tag can be used to set the maximum number of nodes
+# that will be shown in the graph. If the number of nodes in a graph becomes
+# larger than this value, doxygen will truncate the graph, which is visualized
+# by representing a node as a red box. Note that doxygen if the number of direct
+# children of the root node in a graph is already larger than
+# DOT_GRAPH_MAX_NODES then the graph will not be shown at all. Also note that
+# the size of a graph can be further restricted by MAX_DOT_GRAPH_DEPTH.
+# Minimum value: 0, maximum value: 10000, default value: 50.
+# This tag requires that the tag HAVE_DOT is set to YES.
+
+DOT_GRAPH_MAX_NODES = 50
+
+# The MAX_DOT_GRAPH_DEPTH tag can be used to set the maximum depth of the graphs
+# generated by dot. A depth value of 3 means that only nodes reachable from the
+# root by following a path via at most 3 edges will be shown. Nodes that lay
+# further from the root node will be omitted. Note that setting this option to 1
+# or 2 may greatly reduce the computation time needed for large code bases. Also
+# note that the size of a graph can be further restricted by
+# DOT_GRAPH_MAX_NODES. Using a depth of 0 means no depth restriction.
+# Minimum value: 0, maximum value: 1000, default value: 0.
+# This tag requires that the tag HAVE_DOT is set to YES.
+
+MAX_DOT_GRAPH_DEPTH = 1000
+
+# Set the DOT_TRANSPARENT tag to YES to generate images with a transparent
+# background. This is disabled by default, because dot on Windows does not seem
+# to support this out of the box.
+#
+# Warning: Depending on the platform used, enabling this option may lead to
+# badly anti-aliased labels on the edges of a graph (i.e. they become hard to
+# read).
+# The default value is: NO.
+# This tag requires that the tag HAVE_DOT is set to YES.
+
+DOT_TRANSPARENT = NO
+
+# Set the DOT_MULTI_TARGETS tag to YES to allow dot to generate multiple output
+# files in one run (i.e. multiple -o and -T options on the command line). This
+# makes dot run faster, but since only newer versions of dot (>1.8.10) support
+# this, this feature is disabled by default.
+# The default value is: NO.
+# This tag requires that the tag HAVE_DOT is set to YES.
+
+DOT_MULTI_TARGETS = NO
+
+# If the GENERATE_LEGEND tag is set to YES doxygen will generate a legend page
+# explaining the meaning of the various boxes and arrows in the dot generated
+# graphs.
+# The default value is: YES.
+# This tag requires that the tag HAVE_DOT is set to YES.
+
+GENERATE_LEGEND = YES
+
+# If the DOT_CLEANUP tag is set to YES, doxygen will remove the intermediate
+# files that are used to generate the various graphs.
+#
+# Note: This setting is not only used for dot files but also for msc and
+# plantuml temporary files.
+# The default value is: YES.
+
+DOT_CLEANUP = YES
diff --git a/modules/base/doc/generic.rst b/modules/base/doc/generic.rst
index 2d71160dae7dd0640fa506bbea95976e2bea0d2d..c04b5f890ed0a9c7920160aff98ef94ee00d8606 100644
--- a/modules/base/doc/generic.rst
+++ b/modules/base/doc/generic.rst
@@ -15,7 +15,7 @@ examples are:
* fit of a fragment inside an electron density map
In OpenStructure this is supported by the use of generic properties. Most
-building blocks are derived from :class:`~ost.GenericPropertyContainer`, meaning
+building blocks are derived from :class:`~ost.GenericPropContainer`, meaning
that arbitrary key-value pairs can be stored in them. In essence, the following
classes support generic properties:
@@ -24,7 +24,7 @@ classes support generic properties:
* :class:`~ost.mol.ResidueHandle` and :class:`~ost.mol.ResidueView`
* :class:`~ost.mol.AtomHandle` and :class:`~ost.mol.AtomView`
* :class:`~ost.mol.BondHandle`
- * :class:`~ost.seq.SequenceHandle` and :class:`~ost.seq.AlignmentHandle`
+ * :class:`~ost.seq.SequenceHandle`
The view variants will reflect the generic properties of the handle variants.
@@ -35,7 +35,7 @@ values are available both in Python and C++.
Storing and Accessing Data
--------------------------------------------------------------------------------
-All OpenStructure building blocks that are :class:`~ost.GenericPropContainers`,
+All OpenStructure building blocks that are :class:`~ost.GenericPropContainer`\s,
have four different methods to store generic data, depending on the data type
(i.e. string, float, int or bool).
@@ -98,7 +98,7 @@ level respectively. For more details see :doc:`../mol/base/query`.
API documentation
--------------------------------------------------------------------------------
-.. class:: GenericPropertyContainer
+.. class:: GenericPropContainer
.. method:: HasProp(key)
diff --git a/modules/base/pymod/__init__.py.in b/modules/base/pymod/__init__.py.in
index 0dff2fd3797a697094017a346fef9661d84138ac..4237d6b95919535347a8258e80d4eb5e94715983 100644
--- a/modules/base/pymod/__init__.py.in
+++ b/modules/base/pymod/__init__.py.in
@@ -24,6 +24,8 @@ from ._ost_base import *
from .stutil import *
from ost import conop
+__version__ = _ost_base.VERSION
+
class StreamLogSink(LogSink):
def __init__(self, stream):
LogSink.__init__(self)
diff --git a/modules/bindings/pymod/export_tmalign.cc b/modules/bindings/pymod/export_tmalign.cc
index 060421d01230bb5a35e27f3a6b4ec3c09bd889b6..352e03e35dd66d482c282ea11a34469af7fa33be 100644
--- a/modules/bindings/pymod/export_tmalign.cc
+++ b/modules/bindings/pymod/export_tmalign.cc
@@ -40,9 +40,17 @@ ost::bindings::TMAlignResult WrapTMAlignView(const ost::mol::ChainView& chain1,
ost::bindings::MMAlignResult WrapMMAlignView(const ost::mol::EntityView& ent1,
const ost::mol::EntityView& ent2,
- bool fast) {
+ bool fast,
+ boost::python::dict& mapping) {
+ boost::python::list keys(mapping.keys());
+ boost::python::list values(mapping.values());
+ std::map<String, String> m_mapping;
+ for(uint i = 0; i < boost::python::len(keys); ++i) {
+ m_mapping[boost::python::extract<String>(keys[i])] =
+ boost::python::extract<String>(values[i]);
+ }
- return ost::bindings::WrappedMMAlign(ent1, ent2, fast);
+ return ost::bindings::WrappedMMAlign(ent1, ent2, fast, m_mapping);
}
void export_TMAlign() {
@@ -84,5 +92,6 @@ void export_TMAlign() {
arg("fast")=false));
def("WrappedMMAlign", &WrapMMAlignView, (arg("ent1"), arg("ent2"),
- arg("fast")=false));
+ arg("fast")=false,
+ arg("mapping")=boost::python::dict()));
}
diff --git a/modules/bindings/pymod/tmtools.py b/modules/bindings/pymod/tmtools.py
index 29dcb8c408522859f91c87b8f5c6c363675b36ee..c16b1acdf30c2e9e624c487352cc97509e6c1164 100644
--- a/modules/bindings/pymod/tmtools.py
+++ b/modules/bindings/pymod/tmtools.py
@@ -32,7 +32,7 @@ import subprocess, os, tempfile, platform
import ost
from ost import settings, io, geom, seq
-def _SetupFiles(models):
+def _SetupFiles(models, custom_chain_mapping = None):
# create temporary directory
tmp_dir_name=tempfile.mkdtemp()
dia = 'PDB'
@@ -46,6 +46,9 @@ def _SetupFiles(models):
dia = 'CHARMM'
break;
io.SavePDB(model, os.path.join(tmp_dir_name, 'model%02d.pdb' % (index+1)), dialect=dia)
+ if custom_chain_mapping is not None:
+ with open(os.path.join(tmp_dir_name, "custom_mapping.txt"), 'w') as fh:
+ fh.write('\n'.join([f"{mdl_ch}\t{ref_ch}" for ref_ch, mdl_ch in custom_chain_mapping.items()]))
return tmp_dir_name
def _CleanupFiles(dir_name):
@@ -183,6 +186,9 @@ def _RunUSAlign(usalign, tmp_dir):
mat_filename = os.path.join(tmp_dir, "mat.txt")
usalign_path=settings.Locate('USalign', explicit_file_name=usalign)
command = f"{usalign_path} {model1_filename} {model2_filename} -mm 1 -ter 0 -m {mat_filename}"
+ custom_mapping = os.path.join(tmp_dir, "custom_mapping.txt")
+ if os.path.exists(custom_mapping):
+ command += f" -chainmap {custom_mapping}"
ps=subprocess.Popen(command, shell=True, stdout=subprocess.PIPE)
stdout,_=ps.communicate()
lines=stdout.decode().splitlines()
@@ -319,7 +325,7 @@ def TMScore(model1, model2, tmscore=None):
return result
-def USAlign(model1, model2, usalign=None):
+def USAlign(model1, model2, usalign=None, custom_chain_mapping=None):
"""
Performs a sequence independent superposition of model1 onto model2, the
reference. Can deal with multimeric complexes and RNA.
@@ -334,13 +340,22 @@ def USAlign(model1, model2, usalign=None):
:type model2: :class:`~ost.mol.EntityView` or :class:`~ost.mol.EntityHandle`
:param usalign: If not None, the path to the USalign executable. Searches
for executable with name ``USalign`` in PATH if not given.
+ :param custom_chain_mapping: Custom chain mapping that is passed as -chainmap
+ to USalign executable. Raises an error is this
+ is not supported by the USalign executable you're
+ using (introduced in July 2023).
+ It's a dict with reference chain names as key
+ (model2) and model chain names as values
+ (model1).
+ :type custom_chain_mapping: :class:`dict`
:returns: The result of the superposition
:rtype: :class:`ost.bindings.MMAlignResult`
:raises: :class:`~ost.settings.FileNotFound` if executable could not be located.
:raises: :class:`RuntimeError` if the superposition failed
"""
- tmp_dir_name=_SetupFiles((model1, model2))
+ tmp_dir_name=_SetupFiles((model1, model2),
+ custom_chain_mapping=custom_chain_mapping)
result=_RunUSAlign(usalign, tmp_dir_name)
model1.handle.EditXCS().ApplyTransform(result.transform)
_CleanupFiles(tmp_dir_name)
diff --git a/modules/bindings/src/USalign/HwRMSD.cpp b/modules/bindings/src/USalign/HwRMSD.cpp
index 651d82456462f0e1ced7970fd2d27c77d7dd3981..df7473e7a343f8a4359fbb02b1642333666e2c19 100644
--- a/modules/bindings/src/USalign/HwRMSD.cpp
+++ b/modules/bindings/src/USalign/HwRMSD.cpp
@@ -306,6 +306,8 @@ int main(int argc, char *argv[])
else if (dir_opt.size() && (dir1_opt.size() || dir2_opt.size()))
PrintErrorAndQuit("-dir cannot be set with -dir1 or -dir2");
}
+
+ bool autojustify=(atom_opt=="auto" || atom_opt=="PC4'"); // auto re-pad atom name
if (atom_opt.size()!=4)
PrintErrorAndQuit("ERROR! Atom name must have 4 characters, including space.");
if (mol_opt!="auto" && mol_opt!="protein" && mol_opt!="RNA")
@@ -387,8 +389,8 @@ int main(int argc, char *argv[])
{
/* parse chain 1 */
xname=chain1_list[i];
- xchainnum=get_PDB_lines(xname, PDB_lines1, chainID_list1,
- mol_vec1, ter_opt, infmt1_opt, atom_opt, split_opt, het_opt);
+ xchainnum=get_PDB_lines(xname, PDB_lines1, chainID_list1, mol_vec1,
+ ter_opt, infmt1_opt, atom_opt, autojustify, split_opt, het_opt);
if (!xchainnum)
{
cerr<<"Warning! Cannot parse file: "<<xname
@@ -425,8 +427,8 @@ int main(int argc, char *argv[])
{
yname=chain2_list[j];
ychainnum=get_PDB_lines(yname, PDB_lines2, chainID_list2,
- mol_vec2, ter_opt, infmt2_opt, atom_opt, split_opt,
- het_opt);
+ mol_vec2, ter_opt, infmt2_opt, atom_opt, autojustify,
+ split_opt, het_opt);
if (!ychainnum)
{
cerr<<"Warning! Cannot parse file: "<<yname
diff --git a/modules/bindings/src/USalign/LICENSE b/modules/bindings/src/USalign/LICENSE
new file mode 100644
index 0000000000000000000000000000000000000000..023d1c5b0c1635384026d17b7dc2529a456b8aad
--- /dev/null
+++ b/modules/bindings/src/USalign/LICENSE
@@ -0,0 +1,15 @@
+ US-align: universal structure alignment of monomeric and complex proteins
+ and nucleic acids
+
+ References to cite:
+ (1) Chengxin Zhang, Morgan Shine, Anna Marie Pyle, Yang Zhang
+ (2022) Nat Methods. 19(9), 1109-1115.
+ (2) Chengxin Zhang, Anna Marie Pyle (2022) iScience. 25(10), 105218.
+
+ DISCLAIMER:
+ Permission to use, copy, modify, and distribute this program for
+ any purpose, with or without fee, is hereby granted, provided that
+ the notices on the head, the reference information, and this
+ copyright notice appear in all copies or substantial portions of
+ the Software. It is provided "as is" without express or implied
+ warranty.
diff --git a/modules/bindings/src/USalign/MMalign.cpp b/modules/bindings/src/USalign/MMalign.cpp
index 816798b248be6b67657bc046865b76e3f79cd814..886cb76000e3d0aa66f41b2ec7b70d0a92647790 100644
--- a/modules/bindings/src/USalign/MMalign.cpp
+++ b/modules/bindings/src/USalign/MMalign.cpp
@@ -346,11 +346,11 @@ int main(int argc, char *argv[])
/* parse complex */
parse_chain_list(chain1_list, xa_vec, seqx_vec, secx_vec, mol_vec1,
xlen_vec, chainID_list1, ter_opt, split_opt, mol_opt, infmt1_opt,
- atom_opt, mirror_opt, het_opt, xlen_aa, xlen_na, o_opt, resi_vec1);
+ atom_opt, false, mirror_opt, het_opt, xlen_aa, xlen_na, o_opt, resi_vec1);
if (xa_vec.size()==0) PrintErrorAndQuit("ERROR! 0 chain in complex 1");
parse_chain_list(chain2_list, ya_vec, seqy_vec, secy_vec, mol_vec2,
ylen_vec, chainID_list2, ter_opt, split_opt, mol_opt, infmt2_opt,
- atom_opt, 0, het_opt, ylen_aa, ylen_na, o_opt, resi_vec2);
+ atom_opt, false, 0, het_opt, ylen_aa, ylen_na, o_opt, resi_vec2);
if (ya_vec.size()==0) PrintErrorAndQuit("ERROR! 0 chain in complex 2");
int len_aa=getmin(xlen_aa,ylen_aa);
int len_na=getmin(xlen_na,ylen_na);
diff --git a/modules/bindings/src/USalign/MMalign.h b/modules/bindings/src/USalign/MMalign.h
index 4b480da62dd30b3c9d32a3b602d941166b7368df..d9b1fb19f9ffbaafdf303a5f334a9fc6ec7258a5 100644
--- a/modules/bindings/src/USalign/MMalign.h
+++ b/modules/bindings/src/USalign/MMalign.h
@@ -1041,8 +1041,8 @@ void parse_chain_list(const vector<string>&chain_list,
vector<vector<char> >&sec_vec, vector<int>&mol_vec, vector<int>&len_vec,
vector<string>&chainID_list, const int ter_opt, const int split_opt,
const string mol_opt, const int infmt_opt, const string atom_opt,
- const int mirror_opt, const int het_opt, int &len_aa, int &len_na,
- const int o_opt, vector<string>&resi_vec)
+ const bool autojustify, const int mirror_opt, const int het_opt,
+ int &len_aa, int &len_na, const int o_opt, vector<string>&resi_vec)
{
size_t i;
int chain_i,r;
@@ -1063,8 +1063,8 @@ void parse_chain_list(const vector<string>&chain_list,
for (i=0;i<chain_list.size();i++)
{
name=chain_list[i];
- chainnum=get_PDB_lines(name, PDB_lines, chainID_list,
- mol_vec, ter_opt, infmt_opt, atom_opt, split_opt, het_opt);
+ chainnum=get_PDB_lines(name, PDB_lines, chainID_list, mol_vec,
+ ter_opt, infmt_opt, atom_opt, autojustify, split_opt, het_opt);
if (!chainnum)
{
cerr<<"Warning! Cannot parse file: "<<name
diff --git a/modules/bindings/src/USalign/NWalign.cpp b/modules/bindings/src/USalign/NWalign.cpp
index 6b7b86c2db202c7338b3d7b576d49337e0e4ec4b..3e57ce035aa36f99913d9c68da1ba6ea9933bd63 100644
--- a/modules/bindings/src/USalign/NWalign.cpp
+++ b/modules/bindings/src/USalign/NWalign.cpp
@@ -197,6 +197,8 @@ int main(int argc, char *argv[])
PrintErrorAndQuit("-suffix is only valid if -dir, -dir1 or -dir2 is set");
if (dir_opt.size() && (dir1_opt.size() || dir2_opt.size()))
PrintErrorAndQuit("-dir cannot be set with -dir1 or -dir2");
+
+ bool autojustify=(atom_opt=="auto" || atom_opt=="PC4'"); // auto re-pad atom name
if (atom_opt.size()!=4)
PrintErrorAndQuit("ERROR! Atom name must have 4 characters, including space.");
if (mol_opt!="auto" && mol_opt!="protein" && mol_opt!="RNA")
@@ -247,8 +249,8 @@ int main(int argc, char *argv[])
xname=chain1_list[i];
if (infmt1_opt>=4) xchainnum=get_FASTA_lines(xname, PDB_lines1,
chainID_list1, mol_vec1, ter_opt, split_opt);
- else xchainnum=get_PDB_lines(xname, PDB_lines1, chainID_list1,
- mol_vec1, ter_opt, infmt1_opt, atom_opt, split_opt, het_opt);
+ else xchainnum=get_PDB_lines(xname, PDB_lines1, chainID_list1, mol_vec1,
+ ter_opt, infmt1_opt, atom_opt, autojustify, split_opt, het_opt);
if (!xchainnum)
{
cerr<<"Warning! Cannot parse file: "<<xname
@@ -284,7 +286,7 @@ int main(int argc, char *argv[])
chainID_list2, mol_vec2, ter_opt, split_opt);
else ychainnum=get_PDB_lines(yname, PDB_lines2,
chainID_list2, mol_vec2, ter_opt, infmt2_opt,
- atom_opt, split_opt, het_opt);
+ atom_opt, autojustify, split_opt, het_opt);
if (!ychainnum)
{
cerr<<"Warning! Cannot parse file: "<<yname
diff --git a/modules/bindings/src/USalign/NWalign.h b/modules/bindings/src/USalign/NWalign.h
index 7d6856b98db338b5aa24977baea7585df0006f8e..1ff8256acf8399cc4e6b6017208976774e33dd74 100644
--- a/modules/bindings/src/USalign/NWalign.h
+++ b/modules/bindings/src/USalign/NWalign.h
@@ -530,17 +530,17 @@ int extract_aln_from_resi(vector<string> &sequence, char *seqx, char *seqy,
int i2=0; // positions in resi_vec2
int xlen=resi_vec1.size();
int ylen=resi_vec2.size();
- if (byresi_opt==4 || byresi_opt==5) // global or glocal sequence alignment
+ if (byresi_opt==4 || byresi_opt==5 || byresi_opt==7) // global or glocal sequence alignment
{
int *invmap;
int glocal=0;
- if (byresi_opt==5) glocal=2;
+ if (byresi_opt==5 || byresi_opt==7) glocal=2;
int mol_type=0;
for (i1=0;i1<xlen;i1++)
if ('a'<seqx[i1] && seqx[i1]<'z') mol_type++;
else mol_type--;
for (i2=0;i2<ylen;i2++)
- if ('a'<seqx[i2] && seqx[i2]<'z') mol_type++;
+ if ('a'<seqy[i2] && seqy[i2]<'z') mol_type++;
else mol_type--;
NWalign_main(seqx, seqy, xlen, ylen, sequence[0],sequence[1],
mol_type, invmap, 0, glocal);
@@ -657,7 +657,7 @@ int extract_aln_from_resi(vector<string> &sequence, char *seqx, char *seqy,
int extract_aln_from_resi(vector<string> &sequence, char *seqx, char *seqy,
const vector<string> resi_vec1, const vector<string> resi_vec2,
const vector<int> xlen_vec, const vector<int> ylen_vec,
- const int chain_i, const int chain_j)
+ const int chain_i, const int chain_j, const int byresi_opt)
{
sequence.clear();
sequence.push_back("");
@@ -671,6 +671,24 @@ int extract_aln_from_resi(vector<string> &sequence, char *seqx, char *seqy,
for (i=0;i<chain_i;i++) i1+=xlen_vec[i];
for (j=0;j<chain_j;j++) i2+=ylen_vec[j];
+ if (byresi_opt==7)
+ {
+ int *invmap;
+ int glocal=2;
+ int mol_type=0;
+
+ for (i=0;i<xlen;i++)
+ if ('a'<seqx[i] && seqx[i]<'z') mol_type++;
+ else mol_type--;
+ for (i=0;i<ylen;i++)
+ if ('a'<seqy[i] && seqy[i]<'z') mol_type++;
+ else mol_type--;
+ NWalign_main(seqx, seqy, xlen, ylen, sequence[0],sequence[1],
+ mol_type, invmap, 0, glocal);
+ delete [] invmap;
+ return sequence[0].size();
+ }
+
i=j=0;
while(i<xlen && j<ylen)
{
diff --git a/modules/bindings/src/USalign/OST_INFO b/modules/bindings/src/USalign/OST_INFO
index 42124da831fd2d3412bc252f2f34eee5ad17027b..7c8299cdd700e97656d25a6aa9083e0945d15e8c 100644
--- a/modules/bindings/src/USalign/OST_INFO
+++ b/modules/bindings/src/USalign/OST_INFO
@@ -1,6 +1,6 @@
-Source code has been cloned May 4 2023 from:
+Source code has been cloned Nov 14 2023 from:
https://github.com/pylelab/USalign
last commit:
-8d968e0111ca275958f209d76b1cd10598864a34
+58b42af9d58436279c21b4f4074db87f072fcc21
diff --git a/modules/bindings/src/USalign/TMalign.cpp b/modules/bindings/src/USalign/TMalign.cpp
index c822d4c3094c0e345c321dfce11711724eb06e51..90682ae459456018412bc78d0e2d35e1e88735c9 100644
--- a/modules/bindings/src/USalign/TMalign.cpp
+++ b/modules/bindings/src/USalign/TMalign.cpp
@@ -450,8 +450,8 @@ int main(int argc, char *argv[])
{
/* parse chain 1 */
xname=chain1_list[i];
- xchainnum=get_PDB_lines(xname, PDB_lines1, chainID_list1,
- mol_vec1, ter_opt, infmt1_opt, atom_opt, split_opt, het_opt);
+ xchainnum=get_PDB_lines(xname, PDB_lines1, chainID_list1, mol_vec1,
+ ter_opt, infmt1_opt, atom_opt, false, split_opt, het_opt);
if (!xchainnum)
{
cerr<<"Warning! Cannot parse file: "<<xname
@@ -491,8 +491,8 @@ int main(int argc, char *argv[])
{
yname=chain2_list[j];
ychainnum=get_PDB_lines(yname, PDB_lines2, chainID_list2,
- mol_vec2, ter_opt, infmt2_opt, atom_opt, split_opt,
- het_opt);
+ mol_vec2, ter_opt, infmt2_opt, atom_opt, false,
+ split_opt, het_opt);
if (!ychainnum)
{
cerr<<"Warning! Cannot parse file: "<<yname
diff --git a/modules/bindings/src/USalign/TMalign.h b/modules/bindings/src/USalign/TMalign.h
index 81196a8071fcec442bba46867e246bb9450facf8..3d9097bc9e63a636322f460c630abad122b3c4d7 100644
--- a/modules/bindings/src/USalign/TMalign.h
+++ b/modules/bindings/src/USalign/TMalign.h
@@ -852,8 +852,8 @@ void make_sec(char *seq, double **x, int len, char *sec,const string atom_opt)
}
}
- // From 5' to 3': A0 C0 D0 B0: A0 paired to B0, C0 paired to D0
- vector<int> A0,B0,C0,D0;
+ // From 5' to 3': A0_var C0_var D0_var B0_var: A0_var paired to B0_var, C0_var paired to D0_var
+ vector<int> A0_var,B0_var,C0_var,D0_var;
for (i=0; i<len-2; i++)
{
for (j=i+3; j<len; j++)
@@ -867,32 +867,32 @@ void make_sec(char *seq, double **x, int len, char *sec,const string atom_opt)
ii=i;
jj=j;
}
- A0.push_back(i);
- B0.push_back(j);
- C0.push_back(ii);
- D0.push_back(jj);
+ A0_var.push_back(i);
+ B0_var.push_back(j);
+ C0_var.push_back(ii);
+ D0_var.push_back(jj);
}
}
//int sign;
- for (i=0;i<A0.size();i++)
+ for (i=0;i<A0_var.size();i++)
{
/*
sign=0;
- if(C0[i]-A0[i]<=1)
+ if(C0_var[i]-A0_var[i]<=1)
{
- for(j=0;j<A0.size();j++)
+ for(j=0;j<A0_var.size();j++)
{
if(i==j) continue;
- if((A0[j]>=A0[i]&&A0[j]<=C0[i])||
- (C0[j]>=A0[i]&&C0[j]<=C0[i])||
- (D0[j]>=A0[i]&&D0[j]<=C0[i])||
- (B0[j]>=A0[i]&&B0[j]<=C0[i])||
- (A0[j]>=D0[i]&&A0[j]<=B0[i])||
- (C0[j]>=D0[i]&&C0[j]<=B0[i])||
- (D0[j]>=D0[i]&&D0[j]<=B0[i])||
- (B0[j]>=D0[i]&&B0[j]<=B0[i]))
+ if((A0_var[j]>=A0_var[i]&&A0_var[j]<=C0_var[i])||
+ (C0_var[j]>=A0_var[i]&&C0_var[j]<=C0_var[i])||
+ (D0_var[j]>=A0_var[i]&&D0_var[j]<=C0_var[i])||
+ (B0_var[j]>=A0_var[i]&&B0_var[j]<=C0_var[i])||
+ (A0_var[j]>=D0_var[i]&&A0_var[j]<=B0_var[i])||
+ (C0_var[j]>=D0_var[i]&&C0_var[j]<=B0_var[i])||
+ (D0_var[j]>=D0_var[i]&&D0_var[j]<=B0_var[i])||
+ (B0_var[j]>=D0_var[i]&&B0_var[j]<=B0_var[i]))
{
sign=-1;
break;
@@ -904,18 +904,18 @@ void make_sec(char *seq, double **x, int len, char *sec,const string atom_opt)
for (j=0;;j++)
{
- if(A0[i]+j>C0[i]) break;
- sec[A0[i]+j]='<';
- sec[D0[i]+j]='>';
+ if(A0_var[i]+j>C0_var[i]) break;
+ sec[A0_var[i]+j]='<';
+ sec[D0_var[i]+j]='>';
}
}
sec[len]=0;
/* clean up */
- A0.clear();
- B0.clear();
- C0.clear();
- D0.clear();
+ A0_var.clear();
+ B0_var.clear();
+ C0_var.clear();
+ D0_var.clear();
bp.clear();
}
@@ -1687,7 +1687,7 @@ void output_pymol(const string xname, const string yname,
{
resi1_sele+=" or i. "+curr_resi1;
resi1_bond+="bond structure1 and i. "+prev_resi1+
- ", i. "+curr_resi1+"\n";
+ ", structure1 and i. "+curr_resi1+"\n";
}
if (resi2_sele.size()==0)
resi2_sele = "i. "+curr_resi2;
@@ -1695,7 +1695,7 @@ void output_pymol(const string xname, const string yname,
{
resi2_sele+=" or i. "+curr_resi2;
resi2_bond+="bond structure2 and i. "+prev_resi2+
- ", i. "+curr_resi2+"\n";
+ ", structure2 and i. "+curr_resi2+"\n";
}
prev_resi1=curr_resi1;
prev_resi2=curr_resi2;
diff --git a/modules/bindings/src/USalign/TMscore.cpp b/modules/bindings/src/USalign/TMscore.cpp
index c84d742c1f47c199bc179185e346dffcc2e987f5..0946fb2e33f196fea04226e104182f29b0e59381 100644
--- a/modules/bindings/src/USalign/TMscore.cpp
+++ b/modules/bindings/src/USalign/TMscore.cpp
@@ -304,6 +304,8 @@ int main(int argc, char *argv[])
else if (dir_opt.size() && (dir1_opt.size() || dir2_opt.size()))
PrintErrorAndQuit("-dir cannot be set with -dir1 or -dir2");
}
+
+ bool autojustify=(atom_opt=="auto" || atom_opt=="PC4'"); // auto re-pad atom name
if (atom_opt.size()!=4)
PrintErrorAndQuit("ERROR! Atom name must have 4 characters, including space.");
if (mol_opt!="auto" && mol_opt!="protein" && mol_opt!="RNA")
@@ -375,8 +377,8 @@ int main(int argc, char *argv[])
{
/* parse chain 1 */
xname=chain1_list[i];
- xchainnum=get_PDB_lines(xname, PDB_lines1, chainID_list1,
- mol_vec1, ter_opt, infmt1_opt, atom_opt, split_opt, het_opt);
+ xchainnum=get_PDB_lines(xname, PDB_lines1, chainID_list1, mol_vec1,
+ ter_opt, infmt1_opt, atom_opt, autojustify, split_opt, het_opt);
if (!xchainnum)
{
cerr<<"Warning! Cannot parse file: "<<xname
@@ -412,8 +414,8 @@ int main(int argc, char *argv[])
{
yname=chain2_list[j];
ychainnum=get_PDB_lines(yname, PDB_lines2, chainID_list2,
- mol_vec2, ter_opt, infmt2_opt, atom_opt, split_opt,
- het_opt);
+ mol_vec2, ter_opt, infmt2_opt, atom_opt, autojustify,
+ split_opt, het_opt);
if (!ychainnum)
{
cerr<<"Warning! Cannot parse file: "<<yname
diff --git a/modules/bindings/src/USalign/USalign.cpp b/modules/bindings/src/USalign/USalign.cpp
index fdd1d8b958446fbfcc5eeb331c2caba49b393212..151e3ca48dfabfc95768a058b6791d21e713a7ab 100644
--- a/modules/bindings/src/USalign/USalign.cpp
+++ b/modules/bindings/src/USalign/USalign.cpp
@@ -11,7 +11,7 @@ void print_version()
cout <<
"\n"
" ********************************************************************\n"
-" * US-align (Version 20220924) *\n"
+" * US-align (Version 20230609) *\n"
" * Universal Structure Alignment of Proteins and Nucleic Acids *\n"
" * Reference: C Zhang, M Shine, AM Pyle, Y Zhang. (2022) Nat Methods*\n"
" * Please email comments and suggestions to zhang@zhanggroup.org *\n"
@@ -31,12 +31,16 @@ void print_extra_help()
" -fast Fast but slightly inaccurate alignment\n"
"\n"
" -dir Perform all-against-all alignment among the list of PDB\n"
-" chains listed by 'chain_list' under 'chain_folder'. Note\n"
-" that the slash is necessary.\n"
+" chains listed by 'chain_list' under 'chain_folder'.\n"
" $ USalign -dir chain_folder/ chain_list\n"
"\n"
+//"-dirpair Perform batch alignment for each pair of chains listed by\n"
+//" 'chain_pair_list' under 'chain_folder'. Each line consist of\n"
+//" two chains, separated by tab or space.\n"
+//" $ USalign -dirpair chain_folder/ chain_pair_list\n"
+//"\n"
" -dir1 Use chain2 to search a list of PDB chains listed by 'chain1_list'\n"
-" under 'chain1_folder'. Note that the slash is necessary.\n"
+" under 'chain1_folder'.\n"
" $ USalign -dir1 chain1_folder/ chain1_list chain2\n"
"\n"
" -dir2 Use chain1 to search a list of PDB chains listed by 'chain2_list'\n"
@@ -92,7 +96,7 @@ void print_extra_help()
" -se Do not perform superposition. Useful for extracting alignment from\n"
" superposed structure pairs\n"
"\n"
-" -infmt1 Input format for structure_11\n"
+" -infmt1 Input format for structure_1\n"
" -infmt2 Input format for structure_2\n"
" -1: (default) automatically detect PDB or PDBx/mmCIF format\n"
" 0: PDB format\n"
@@ -100,6 +104,10 @@ void print_extra_help()
//" 2: xyz format\n"
" 3: PDBx/mmCIF format\n"
"\n"
+//"-chainmap (only useful for -mm 1) use the final chain mapping 'chainmap.txt'\n"
+//" specified by user. 'chainmap.txt' is a tab-seperated text with two\n"
+//" columns, one for each complex\n"
+//"\n"
"Advanced usage 1 (generate an image for a pair of superposed structures):\n"
" USalign 1cpc.pdb 1mba.pdb -o sup\n"
" pymol -c -d @sup_all_atm.pml -g sup_all_atm.png\n"
@@ -164,6 +172,10 @@ void print_help(bool h_opt=false)
" 6: superpose two complex structures by first deriving optimal\n"
" chain mapping, followed by TM-score superposition for residues\n"
" with the same residue ID\n"
+" 7: sequence dependent alignment of two complex structures:\n"
+" perform global sequence alignment of each chain pair, derive\n"
+" optimal chain mapping, and then superpose two complex\n"
+" structures by TM-score\n"
"\n"
" -I Use the final alignment specified by FASTA file 'align.txt'\n"
"\n"
@@ -219,10 +231,10 @@ int TMalign(string &xname, string &yname, const string &fname_super,
const int infmt1_opt, const int infmt2_opt, const int ter_opt,
const int split_opt, const int outfmt_opt, const bool fast_opt,
const int cp_opt, const int mirror_opt, const int het_opt,
- const string &atom_opt, const string &mol_opt, const string &dir_opt,
- const string &dir1_opt, const string &dir2_opt, const int byresi_opt,
- const vector<string> &chain1_list, const vector<string> &chain2_list,
- const bool se_opt)
+ const string &atom_opt, const bool autojustify, const string &mol_opt,
+ const string &dir_opt, const string &dirpair_opt, const string &dir1_opt,
+ const string &dir2_opt, const int byresi_opt, const vector<string> &chain1_list,
+ const vector<string> &chain2_list, const bool se_opt)
{
/* declare previously global variables */
vector<vector<string> >PDB_lines1; // text of chain1
@@ -252,8 +264,8 @@ int TMalign(string &xname, string &yname, const string &fname_super,
{
/* parse chain 1 */
xname=chain1_list[i];
- xchainnum=get_PDB_lines(xname, PDB_lines1, chainID_list1,
- mol_vec1, ter_opt, infmt1_opt, atom_opt, split_opt, het_opt);
+ xchainnum=get_PDB_lines(xname, PDB_lines1, chainID_list1, mol_vec1,
+ ter_opt, infmt1_opt, atom_opt, autojustify, split_opt, het_opt);
if (!xchainnum)
{
cerr<<"Warning! Cannot parse file: "<<xname
@@ -287,13 +299,14 @@ int TMalign(string &xname, string &yname, const string &fname_super,
for (j=(dir_opt.size()>0)*(i+1);j<chain2_list.size();j++)
{
+ if (dirpair_opt.size() && j!=i) continue;
/* parse chain 2 */
if (PDB_lines2.size()==0)
{
yname=chain2_list[j];
ychainnum=get_PDB_lines(yname, PDB_lines2, chainID_list2,
- mol_vec2, ter_opt, infmt2_opt, atom_opt, split_opt,
- het_opt);
+ mol_vec2, ter_opt, infmt2_opt, atom_opt, autojustify,
+ split_opt, het_opt);
if (!ychainnum)
{
cerr<<"Warning! Cannot parse file: "<<yname
@@ -409,8 +422,8 @@ int TMalign(string &xname, string &yname, const string &fname_super,
seqxA,seqyA,outfmt_opt,left_num,right_num,
left_aln_num,right_aln_num);
output_results(
- xname.substr(dir1_opt.size()+dir_opt.size()),
- yname.substr(dir2_opt.size()+dir_opt.size()),
+ xname.substr(dir1_opt.size()+dir_opt.size()+dirpair_opt.size()),
+ yname.substr(dir2_opt.size()+dir_opt.size()+dirpair_opt.size()),
chainID_list1[chain_i], chainID_list2[chain_j],
xlen, ylen, t0, u0, TM1, TM2, TM3, TM4, TM5,
rmsd0, d0_out, seqM.c_str(),
@@ -498,10 +511,10 @@ int MMalign(const string &xname, const string &yname,
const double TMcut, const int infmt1_opt, const int infmt2_opt,
const int ter_opt, const int split_opt, const int outfmt_opt,
bool fast_opt, const int mirror_opt, const int het_opt,
- const string &atom_opt, const string &mol_opt,
+ const string &atom_opt, const bool autojustify, const string &mol_opt,
const string &dir1_opt, const string &dir2_opt,
const vector<string> &chain1_list, const vector<string> &chain2_list,
- const int byresi_opt)
+ const int byresi_opt,const string&chainmapfile)
{
/* declare previously global variables */
vector<vector<vector<double> > > xa_vec; // structure of complex1
@@ -529,11 +542,12 @@ int MMalign(const string &xname, const string &yname,
/* parse complex */
parse_chain_list(chain1_list, xa_vec, seqx_vec, secx_vec, mol_vec1,
xlen_vec, chainID_list1, ter_opt, split_opt, mol_opt, infmt1_opt,
- atom_opt, mirror_opt, het_opt, xlen_aa, xlen_na, o_opt, resi_vec1);
+ atom_opt, autojustify, mirror_opt, het_opt, xlen_aa, xlen_na, o_opt,
+ resi_vec1);
if (xa_vec.size()==0) PrintErrorAndQuit("ERROR! 0 chain in complex 1");
parse_chain_list(chain2_list, ya_vec, seqy_vec, secy_vec, mol_vec2,
ylen_vec, chainID_list2, ter_opt, split_opt, mol_opt, infmt2_opt,
- atom_opt, 0, het_opt, ylen_aa, ylen_na, o_opt, resi_vec2);
+ atom_opt, autojustify, 0, het_opt, ylen_aa, ylen_na, o_opt, resi_vec2);
if (ya_vec.size()==0) PrintErrorAndQuit("ERROR! 0 chain in complex 2");
int len_aa=getmin(xlen_aa,ylen_aa);
int len_na=getmin(xlen_na,ylen_na);
@@ -545,6 +559,63 @@ int MMalign(const string &xname, const string &yname,
int i_opt=0;
if (byresi_opt) i_opt=3;
+ map<int,int> chainmap;
+ if (chainmapfile.size())
+ {
+ string line;
+ int chainidx1,chainidx2;
+ vector<string> line_vec;
+ ifstream fin;
+ bool fromStdin=(chainmapfile=="-");
+ if (!fromStdin) fin.open(chainmapfile.c_str());
+ while (fromStdin?cin.good():fin.good())
+ {
+ if (fromStdin) getline(cin,line);
+ else getline(fin,line);
+ if (line.size()==0 || line[0]=='#') continue;
+ split(line,line_vec,'\t');
+ if (line_vec.size()==2)
+ {
+ chainidx1=-1;
+ chainidx2=-1;
+
+ for (i=0;i<chainID_list1.size();i++)
+ {
+ if (line_vec[0]==chainID_list1[i] ||
+ ":"+line_vec[0]==chainID_list1[i] ||
+ ":1,"+line_vec[0]==chainID_list1[i])
+ {
+ chainidx1=i;
+ break;
+ }
+ }
+ for (i=0;i<chainID_list2.size();i++)
+ {
+ if (line_vec[1]==chainID_list2[i] ||
+ ":"+line_vec[1]==chainID_list2[i] ||
+ ":1,"+line_vec[1]==chainID_list2[i])
+ {
+ chainidx2=i;
+ break;
+ }
+ }
+ if (chainidx1>=0 && chainidx2>=0)
+ {
+ if (chainmap.count(chainidx1))
+ cerr<<"ERROR! "<<line_vec[0]<<" already mapped"<<endl;
+ chainmap[chainidx1]=chainidx2;
+ }
+ else cerr<<"ERROR! Cannot map "<<line<<endl;
+ }
+ else cerr<<"ERROR! Cannot map "<<line<<endl;
+ for (i=0;i<line_vec.size();i++) line_vec[i].clear(); line_vec.clear();
+ }
+ if (!fromStdin) fin.close();
+ if (chainmap.size()==0)
+ cerr<<"ERROR! cannot map any chain pair from "<<chainmapfile<<endl;
+ }
+
+
/* perform monomer alignment if there is only one chain */
if (xa_vec.size()==1 && ya_vec.size()==1)
{
@@ -671,6 +742,11 @@ int MMalign(const string &xname, const string &yname,
TMave_mat[i][j]=-1;
continue;
}
+ if (chainmap.size() && chainmap[i]!=j)
+ {
+ TMave_mat[i][j]=-1;
+ continue;
+ }
ylen=ylen_vec[j];
if (ylen<3)
@@ -704,8 +780,8 @@ int MMalign(const string &xname, const string &yname,
if (byresi_opt)
{
- int total_aln=extract_aln_from_resi(sequence,
- seqx,seqy,resi_vec1,resi_vec2,xlen_vec,ylen_vec, i, j);
+ int total_aln=extract_aln_from_resi(sequence, seqx,seqy,
+ resi_vec1,resi_vec2,xlen_vec,ylen_vec, i, j, byresi_opt);
seqxA_mat[i][j]=sequence[0];
seqyA_mat[i][j]=sequence[1];
if (total_aln>xlen+ylen-3)
@@ -776,7 +852,7 @@ int MMalign(const string &xname, const string &yname,
/* refine alignment for large oligomers */
int aln_chain_num=count_assign_pair(assign1_list,chain1_num);
bool is_oligomer=(aln_chain_num>=3);
- if (aln_chain_num==2) // dimer alignment
+ if (aln_chain_num==2 && chainmap.size()==0) // dimer alignment
{
int na_chain_num1,na_chain_num2,aa_chain_num1,aa_chain_num2;
count_na_aa_chain_num(na_chain_num1,aa_chain_num1,mol_vec1);
@@ -798,7 +874,7 @@ int MMalign(const string &xname, const string &yname,
else is_oligomer=true; /* align oligomers to dimer */
}
- if (aln_chain_num>=3 || is_oligomer) // oligomer alignment
+ if ((aln_chain_num>=3 || is_oligomer) && chainmap.size()==0) // oligomer alignment
{
/* extract centroid coordinates */
double **xcentroids;
@@ -941,6 +1017,7 @@ int MMalign(const string &xname, const string &yname,
ylen_vec.clear(); // length of complex2
vector<string> ().swap(resi_vec1); // residue index for chain1
vector<string> ().swap(resi_vec2); // residue index for chain2
+ map<int,int> ().swap(chainmap);
return 1;
}
@@ -953,7 +1030,7 @@ int MMdock(const string &xname, const string &yname, const string &fname_super,
const double TMcut, const int infmt1_opt, const int infmt2_opt,
const int ter_opt, const int split_opt, const int outfmt_opt,
bool fast_opt, const int mirror_opt, const int het_opt,
- const string &atom_opt, const string &mol_opt,
+ const string &atom_opt, const bool autojustify, const string &mol_opt,
const string &dir1_opt, const string &dir2_opt,
const vector<string> &chain1_list, const vector<string> &chain2_list)
{
@@ -983,11 +1060,12 @@ int MMdock(const string &xname, const string &yname, const string &fname_super,
/* parse complex */
parse_chain_list(chain1_list, xa_vec, seqx_vec, secx_vec, mol_vec1,
xlen_vec, chainID_list1, ter_opt, split_opt, mol_opt, infmt1_opt,
- atom_opt, mirror_opt, het_opt, xlen_aa, xlen_na, o_opt, resi_vec1);
+ atom_opt, autojustify, mirror_opt, het_opt, xlen_aa, xlen_na, o_opt,
+ resi_vec1);
if (xa_vec.size()==0) PrintErrorAndQuit("ERROR! 0 individual chain");
parse_chain_list(chain2_list, ya_vec, seqy_vec, secy_vec, mol_vec2,
ylen_vec, chainID_list2, ter_opt, split_opt, mol_opt, infmt2_opt,
- atom_opt, 0, het_opt, ylen_aa, ylen_na, o_opt, resi_vec2);
+ atom_opt, autojustify, 0, het_opt, ylen_aa, ylen_na, o_opt, resi_vec2);
if (xa_vec.size()>ya_vec.size()) PrintErrorAndQuit(
"ERROR! more individual chains to align than number of chains in complex template");
int len_aa=getmin(xlen_aa,ylen_aa);
@@ -1417,9 +1495,8 @@ int mTMalign(string &xname, string &yname, const string &fname_super,
bool u_opt, const bool d_opt, const bool full_opt, const double TMcut,
const int infmt_opt, const int ter_opt,
const int split_opt, const int outfmt_opt, bool fast_opt,
- const int het_opt,
- const string &atom_opt, const string &mol_opt, const string &dir_opt,
- const int byresi_opt,
+ const int het_opt, const string &atom_opt, const bool autojustify,
+ const string &mol_opt, const string &dir_opt, const int byresi_opt,
const vector<string> &chain_list)
{
/* declare previously global variables */
@@ -1441,7 +1518,7 @@ int mTMalign(string &xname, string &yname, const string &fname_super,
/* parse chain list */
parse_chain_list(chain_list, a_vec, seq_vec, sec_vec, mol_vec,
len_vec, chainID_list, ter_opt, split_opt, mol_opt, infmt_opt,
- atom_opt, false, het_opt, len_aa, len_na, o_opt, resi_vec);
+ atom_opt, autojustify, false, het_opt, len_aa, len_na, o_opt, resi_vec);
int chain_num=a_vec.size();
if (chain_num<=1) PrintErrorAndQuit("ERROR! <2 chains for multiple alignment");
if (m_opt||o_opt) for (i=0;i<chain_num;i++) ua_vec.push_back(a_vec[i]);
@@ -2128,10 +2205,11 @@ int SOIalign(string &xname, string &yname, const string &fname_super,
const int infmt1_opt, const int infmt2_opt, const int ter_opt,
const int split_opt, const int outfmt_opt, const bool fast_opt,
const int cp_opt, const int mirror_opt, const int het_opt,
- const string &atom_opt, const string &mol_opt, const string &dir_opt,
- const string &dir1_opt, const string &dir2_opt,
- const vector<string> &chain1_list, const vector<string> &chain2_list,
- const bool se_opt, const int closeK_opt, const int mm_opt)
+ const string &atom_opt, const bool autojustify, const string &mol_opt,
+ const string &dir_opt, const string &dirpair_opt, const string &dir1_opt,
+ const string &dir2_opt, const vector<string> &chain1_list,
+ const vector<string> &chain2_list, const bool se_opt,
+ const int closeK_opt, const int mm_opt)
{
/* declare previously global variables */
vector<vector<string> >PDB_lines1; // text of chain1
@@ -2164,8 +2242,8 @@ int SOIalign(string &xname, string &yname, const string &fname_super,
{
/* parse chain 1 */
xname=chain1_list[i];
- xchainnum=get_PDB_lines(xname, PDB_lines1, chainID_list1,
- mol_vec1, ter_opt, infmt1_opt, atom_opt, split_opt, het_opt);
+ xchainnum=get_PDB_lines(xname, PDB_lines1, chainID_list1, mol_vec1,
+ ter_opt, infmt1_opt, atom_opt, autojustify, split_opt, het_opt);
if (!xchainnum)
{
cerr<<"Warning! Cannot parse file: "<<xname
@@ -2206,13 +2284,14 @@ int SOIalign(string &xname, string &yname, const string &fname_super,
for (j=(dir_opt.size()>0)*(i+1);j<chain2_list.size();j++)
{
+ if (dirpair_opt.size() && i!=j) continue;
/* parse chain 2 */
if (PDB_lines2.size()==0)
{
yname=chain2_list[j];
ychainnum=get_PDB_lines(yname, PDB_lines2, chainID_list2,
- mol_vec2, ter_opt, infmt2_opt, atom_opt, split_opt,
- het_opt);
+ mol_vec2, ter_opt, infmt2_opt, atom_opt, autojustify,
+ split_opt, het_opt);
if (!ychainnum)
{
cerr<<"Warning! Cannot parse file: "<<yname
@@ -2315,8 +2394,8 @@ int SOIalign(string &xname, string &yname, const string &fname_super,
/* print result */
if (outfmt_opt==0) print_version();
output_results(
- xname.substr(dir1_opt.size()+dir_opt.size()),
- yname.substr(dir2_opt.size()+dir_opt.size()),
+ xname.substr(dir1_opt.size()+dir_opt.size()+dirpair_opt.size()),
+ yname.substr(dir2_opt.size()+dir_opt.size()+dirpair_opt.size()),
chainID_list1[chain_i], chainID_list2[chain_j],
xlen, ylen, t0, u0, TM1, TM2, TM3, TM4, TM5,
rmsd0, d0_out, seqM.c_str(),
@@ -2400,11 +2479,11 @@ int flexalign(string &xname, string &yname, const string &fname_super,
const bool u_opt, const bool d_opt, const double TMcut,
const int infmt1_opt, const int infmt2_opt, const int ter_opt,
const int split_opt, const int outfmt_opt, const bool fast_opt,
- const int mirror_opt, const int het_opt,
- const string &atom_opt, const string &mol_opt, const string &dir_opt,
- const string &dir1_opt, const string &dir2_opt, const int byresi_opt,
- const vector<string> &chain1_list, const vector<string> &chain2_list,
- const int hinge_opt)
+ const int mirror_opt, const int het_opt, const string &atom_opt,
+ const bool autojustify, const string &mol_opt, const string &dir_opt,
+ const string &dirpair_opt, const string &dir1_opt, const string &dir2_opt,
+ const int byresi_opt, const vector<string> &chain1_list,
+ const vector<string> &chain2_list, const int hinge_opt)
{
/* declare previously global variables */
vector<vector<string> >PDB_lines1; // text of chain1
@@ -2435,7 +2514,8 @@ int flexalign(string &xname, string &yname, const string &fname_super,
/* parse chain 1 */
xname=chain1_list[i];
xchainnum=get_PDB_lines(xname, PDB_lines1, chainID_list1,
- mol_vec1, ter_opt, infmt1_opt, atom_opt, split_opt, het_opt);
+ mol_vec1, ter_opt, infmt1_opt, atom_opt, autojustify,
+ split_opt, het_opt);
if (!xchainnum)
{
cerr<<"Warning! Cannot parse file: "<<xname
@@ -2469,13 +2549,14 @@ int flexalign(string &xname, string &yname, const string &fname_super,
for (j=(dir_opt.size()>0)*(i+1);j<chain2_list.size();j++)
{
+ if (dirpair_opt.size() && i!=j) continue;
/* parse chain 2 */
if (PDB_lines2.size()==0)
{
yname=chain2_list[j];
ychainnum=get_PDB_lines(yname, PDB_lines2, chainID_list2,
- mol_vec2, ter_opt, infmt2_opt, atom_opt, split_opt,
- het_opt);
+ mol_vec2, ter_opt, infmt2_opt, atom_opt, autojustify,
+ split_opt, het_opt);
if (!ychainnum)
{
cerr<<"Warning! Cannot parse file: "<<yname
@@ -2602,8 +2683,8 @@ int flexalign(string &xname, string &yname, const string &fname_super,
/* print result */
if (outfmt_opt==0) print_version();
output_flexalign_results(
- xname.substr(dir1_opt.size()+dir_opt.size()),
- yname.substr(dir2_opt.size()+dir_opt.size()),
+ xname.substr(dir1_opt.size()+dir_opt.size()+dirpair_opt.size()),
+ yname.substr(dir2_opt.size()+dir_opt.size()+dirpair_opt.size()),
chainID_list1[chain_i], chainID_list2[chain_j],
xlen, ylen, t0, u0, tu_vec, TM1, TM2, TM3, TM4, TM5,
rmsd0, d0_out, seqM.c_str(),
@@ -2708,11 +2789,14 @@ int main(int argc, char *argv[])
string mol_opt ="auto";// auto-detect the molecule type as protein/RNA
string suffix_opt=""; // set -suffix to empty
string dir_opt =""; // set -dir to empty
+ string dirpair_opt=""; // set -dirpair to empty
string dir1_opt =""; // set -dir1 to empty
string dir2_opt =""; // set -dir2 to empty
+ string chainmapfile=""; // chain mapping between two complexes
int byresi_opt=0; // set -byresi to 0
vector<string> chain1_list; // only when -dir1 is set
vector<string> chain2_list; // only when -dir2 is set
+ vector<pair<string,string> > chain_pair_list; // only when -dirpair is set
for(int i = 1; i < argc; i++)
{
@@ -2815,6 +2899,12 @@ int main(int argc, char *argv[])
PrintErrorAndQuit("ERROR! -I and -i cannot be used together");
fname_lign = argv[i + 1]; i_opt = 3; i++;
}
+ else if (!strcmp(argv[i], "-chainmap") )
+ {
+ if (i>=(argc-1))
+ PrintErrorAndQuit("ERROR! Missing value for -chainmap");
+ chainmapfile = argv[i + 1]; i++;
+ }
else if (!strcmp(argv[i], "-m") )
{
if (i>=(argc-1))
@@ -2862,10 +2952,6 @@ int main(int argc, char *argv[])
if (i>=(argc-1))
PrintErrorAndQuit("ERROR! Missing value for -atom");
atom_opt=argv[i + 1]; i++;
- if (atom_opt.size()!=4) PrintErrorAndQuit(
- "ERROR! Atom name must have 4 characters, including space.\n"
- "For example, C alpha, C3' and P atoms should be specified by\n"
- "-atom \" CA \", -atom \" P \" and -atom \" C3'\", respectively.");
}
else if ( !strcmp(argv[i],"-mol") )
{
@@ -2885,6 +2971,12 @@ int main(int argc, char *argv[])
PrintErrorAndQuit("ERROR! Missing value for -dir");
dir_opt=argv[i + 1]; i++;
}
+ else if ( !strcmp(argv[i],"-dirpair") )
+ {
+ if (i>=(argc-1))
+ PrintErrorAndQuit("ERROR! Missing value for -dirpair");
+ dirpair_opt=argv[i + 1]; i++;
+ }
else if ( !strcmp(argv[i],"-dir1") )
{
if (i>=(argc-1))
@@ -2956,8 +3048,9 @@ int main(int argc, char *argv[])
else PrintErrorAndQuit(string("ERROR! Undefined option ")+argv[i]);
}
- if(xname.size()==0 || (yname.size()==0 && dir_opt.size()==0) ||
- (yname.size() && dir_opt.size()))
+ if (xname.size()==0 || (yname.size() && dir_opt.size()) ||
+ (yname.size() && dirpair_opt.size()) ||
+ (yname.size()==0 && dir_opt.size()==0 && dirpair_opt.size()==0))
{
if (h_opt) print_help(h_opt);
if (v_opt)
@@ -2967,15 +3060,15 @@ int main(int argc, char *argv[])
}
if (xname.size()==0)
PrintErrorAndQuit("Please provide input structures");
- else if (yname.size()==0 && dir_opt.size()==0 && mm_opt!=4)
+ else if (yname.size()==0 && dir_opt.size()==0 && dirpair_opt.size()==0 && mm_opt!=4)
PrintErrorAndQuit("Please provide structure B");
- else if (yname.size() && dir_opt.size())
+ else if (yname.size() && dir_opt.size()+dirpair_opt.size())
PrintErrorAndQuit("Please provide only one file name if -dir is set");
}
- if (suffix_opt.size() && dir_opt.size()+dir1_opt.size()+dir2_opt.size()==0)
+ if (suffix_opt.size() && dir_opt.size()+dirpair_opt.size()+dir1_opt.size()+dir2_opt.size()==0)
PrintErrorAndQuit("-suffix is only valid if -dir, -dir1 or -dir2 is set");
- if ((dir_opt.size() || dir1_opt.size() || dir2_opt.size()))
+ if ((dir_opt.size() || dirpair_opt.size() || dir1_opt.size() || dir2_opt.size()))
{
if (mm_opt!=2 && mm_opt!=4)
{
@@ -2984,16 +3077,30 @@ int main(int argc, char *argv[])
if (m_opt && fname_matrix!="-")
PrintErrorAndQuit("-m can only be - or unset when using -dir, -dir1 or -dir2");
}
- else if (dir_opt.size() && (dir1_opt.size() || dir2_opt.size()))
+ else if ((dir_opt.size() || dirpair_opt.size() )&& (dir1_opt.size() || dir2_opt.size()))
PrintErrorAndQuit("-dir cannot be set with -dir1 or -dir2");
+ else if (dir_opt.size() && dirpair_opt.size())
+ PrintErrorAndQuit("-dir cannot be set with -dirpair");
}
if (o_opt && (infmt1_opt!=-1 && infmt1_opt!=0 && infmt1_opt!=3))
PrintErrorAndQuit("-o can only be used with -infmt1 -1, 0 or 3");
+ bool autojustify=(atom_opt=="auto" || atom_opt=="PC4'"); // auto re-pad atom name
if (mol_opt=="protein" && atom_opt=="auto")
atom_opt=" CA ";
else if (mol_opt=="RNA" && atom_opt=="auto")
atom_opt=" C3'";
+ if (atom_opt.size()!=4)
+ {
+ cerr<<"ERROR! Atom name must have 4 characters, including space.\n"
+ "For example, C alpha, C3' and P atoms should be specified by\n"
+ "-atom \" CA \", -atom \" P \" and -atom \" C3'\", respectively."<<endl;
+ if (atom_opt.size()>=5 || atom_opt.size()==0) return 1;
+ else if (atom_opt.size()==1) atom_opt=" "+atom_opt+" ";
+ else if (atom_opt.size()==2) atom_opt=" "+atom_opt+" ";
+ else if (atom_opt.size()==3) atom_opt=" "+atom_opt;
+ cerr<<"Change -atom to \""<<atom_opt<<"\""<<endl;
+ }
if (d_opt && d0_scale<=0)
PrintErrorAndQuit("Wrong value for option -d! It should be >0");
@@ -3003,8 +3110,8 @@ int main(int argc, char *argv[])
{
if (i_opt)
PrintErrorAndQuit("-byresi >=1 cannot be used with -i or -I");
- if (byresi_opt<0 || byresi_opt>6)
- PrintErrorAndQuit("-byresi can only be 0 to 6");
+ if (byresi_opt<0 || byresi_opt>7)
+ PrintErrorAndQuit("-byresi can only be 0 to 7");
if ((byresi_opt==2 || byresi_opt==3 || byresi_opt==6) && ter_opt>=2)
PrintErrorAndQuit("-byresi 2 and 6 must be used with -ter <=1");
}
@@ -3037,6 +3144,8 @@ int main(int argc, char *argv[])
if (ter_opt>=2 && (mm_opt==1 || mm_opt==2)) PrintErrorAndQuit("-mm 1 or 2 must be used with -ter 0 or -ter 1");
if (mm_opt==4 && (yname.size() || dir2_opt.size()))
cerr<<"WARNING! structure_2 is ignored for -mm 4"<<endl;
+ if (dirpair_opt.size() && (mm_opt==2 || mm_opt==4))
+ PrintErrorAndQuit("-mm 2 or 4 cannot be used with -dirpair");
}
else if (full_opt) PrintErrorAndQuit("-full can only be used with -mm");
@@ -3058,26 +3167,34 @@ int main(int argc, char *argv[])
if (mm_opt==7 && hinge_opt>=10)
PrintErrorAndQuit("ERROR! -hinge must be <10");
+ if (chainmapfile.size() && mm_opt!=1)
+ PrintErrorAndQuit("ERROR! -chainmap must be used with -mm 1");
+
/* read initial alignment file from 'align.txt' */
if (i_opt) read_user_alignment(sequence, fname_lign, i_opt);
- if (byresi_opt==6) mm_opt=1;
+ if (byresi_opt==6 || byresi_opt==7) mm_opt=1;
else if (byresi_opt) i_opt=3;
if (m_opt && fname_matrix == "") // Output rotation matrix: matrix.txt
PrintErrorAndQuit("ERROR! Please provide a file name for option -m!");
/* parse file list */
- if (dir1_opt.size()+dir_opt.size()==0) chain1_list.push_back(xname);
- else file2chainlist(chain1_list, xname, dir_opt+dir1_opt, suffix_opt);
-
int i;
- if (dir_opt.size())
- for (i=0;i<chain1_list.size();i++)
- chain2_list.push_back(chain1_list[i]);
- else if (dir2_opt.size()==0) chain2_list.push_back(yname);
- else file2chainlist(chain2_list, yname, dir2_opt, suffix_opt);
+ if (dirpair_opt.size())
+ file2chainpairlist(chain1_list,chain2_list, xname, dirpair_opt, suffix_opt);
+ else
+ {
+ if (dir1_opt.size()+dir_opt.size()==0) chain1_list.push_back(xname);
+ else file2chainlist(chain1_list, xname, dir_opt+dir1_opt, suffix_opt);
+
+ if (dir_opt.size())
+ for (i=0;i<chain1_list.size();i++)
+ chain2_list.push_back(chain1_list[i]);
+ else if (dir2_opt.size()==0) chain2_list.push_back(yname);
+ else file2chainlist(chain2_list, yname, dir2_opt, suffix_opt);
+ }
if (outfmt_opt==2)
{
@@ -3092,43 +3209,69 @@ int main(int argc, char *argv[])
sequence, Lnorm_ass, d0_scale, m_opt, i_opt, o_opt, a_opt,
u_opt, d_opt, TMcut, infmt1_opt, infmt2_opt, ter_opt,
split_opt, outfmt_opt, fast_opt, cp_opt, mirror_opt, het_opt,
- atom_opt, mol_opt, dir_opt, dir1_opt, dir2_opt, byresi_opt,
- chain1_list, chain2_list, se_opt);
- else if (mm_opt==1) MMalign(xname, yname, fname_super, fname_lign,
- fname_matrix, sequence, d0_scale, m_opt, o_opt,
- a_opt, d_opt, full_opt, TMcut, infmt1_opt, infmt2_opt,
- ter_opt, split_opt, outfmt_opt, fast_opt, mirror_opt, het_opt,
- atom_opt, mol_opt, dir1_opt, dir2_opt, chain1_list, chain2_list,
- byresi_opt);
+ atom_opt, autojustify, mol_opt, dir_opt, dirpair_opt, dir1_opt,
+ dir2_opt, byresi_opt, chain1_list, chain2_list, se_opt);
+ else if (mm_opt==1)
+ {
+ if (dirpair_opt.size()==0) MMalign(xname, yname, fname_super,
+ fname_lign, fname_matrix, sequence, d0_scale, m_opt, o_opt,
+ a_opt, d_opt, full_opt, TMcut, infmt1_opt, infmt2_opt,
+ ter_opt, split_opt, outfmt_opt, fast_opt, mirror_opt, het_opt,
+ atom_opt, autojustify, mol_opt, dir1_opt, dir2_opt, chain1_list,
+ chain2_list, byresi_opt,chainmapfile);
+ else
+ {
+ vector<string> tmp_vec1;
+ vector<string> tmp_vec2;
+ for (i=0;i<chain1_list.size();i++)
+ {
+ xname=chain1_list[i];
+ yname=chain2_list[i];
+ tmp_vec1.push_back(xname);
+ tmp_vec2.push_back(yname);
+ MMalign(xname, yname, fname_super, fname_lign, fname_matrix,
+ sequence, d0_scale, m_opt, o_opt, a_opt, d_opt, full_opt,
+ TMcut, infmt1_opt, infmt2_opt, ter_opt, split_opt,
+ outfmt_opt, fast_opt, mirror_opt, het_opt, atom_opt,
+ autojustify, mol_opt, dirpair_opt, dirpair_opt, tmp_vec1,
+ tmp_vec2, byresi_opt,chainmapfile);
+ tmp_vec1[0].clear(); tmp_vec1.clear();
+ tmp_vec2[0].clear(); tmp_vec2.clear();
+ }
+ }
+ chainmapfile.clear();
+ }
else if (mm_opt==2) MMdock(xname, yname, fname_super,
fname_matrix, sequence, Lnorm_ass, d0_scale, m_opt, o_opt, a_opt,
u_opt, d_opt, TMcut, infmt1_opt, infmt2_opt, ter_opt,
split_opt, outfmt_opt, fast_opt, mirror_opt, het_opt,
- atom_opt, mol_opt, dir1_opt, dir2_opt, chain1_list, chain2_list);
+ atom_opt, autojustify, mol_opt, dir1_opt, dir2_opt,
+ chain1_list, chain2_list);
else if (mm_opt==3) ; // should be changed to mm_opt=0, cp_opt=true
else if (mm_opt==4) mTMalign(xname, yname, fname_super, fname_matrix,
sequence, Lnorm_ass, d0_scale, m_opt, i_opt, o_opt, a_opt,
u_opt, d_opt, full_opt, TMcut, infmt1_opt, ter_opt,
split_opt, outfmt_opt, fast_opt, het_opt,
- atom_opt, mol_opt, dir_opt, byresi_opt, chain1_list);
+ atom_opt, autojustify, mol_opt, dir_opt, byresi_opt, chain1_list);
else if (mm_opt==5 || mm_opt==6) SOIalign(xname, yname, fname_super, fname_lign,
fname_matrix, sequence, Lnorm_ass, d0_scale, m_opt, i_opt, o_opt,
a_opt, u_opt, d_opt, TMcut, infmt1_opt, infmt2_opt, ter_opt,
split_opt, outfmt_opt, fast_opt, cp_opt, mirror_opt, het_opt,
- atom_opt, mol_opt, dir_opt, dir1_opt, dir2_opt,
- chain1_list, chain2_list, se_opt, closeK_opt, mm_opt);
+ atom_opt, autojustify, mol_opt, dir_opt, dirpair_opt, dir1_opt,
+ dir2_opt, chain1_list, chain2_list, se_opt, closeK_opt, mm_opt);
else if (mm_opt==7) flexalign(xname, yname, fname_super, fname_lign,
fname_matrix, sequence, Lnorm_ass, d0_scale, m_opt, i_opt, o_opt,
a_opt, u_opt, d_opt, TMcut, infmt1_opt, infmt2_opt, ter_opt,
split_opt, outfmt_opt, fast_opt, mirror_opt, het_opt,
- atom_opt, mol_opt, dir_opt, dir1_opt, dir2_opt, byresi_opt,
- chain1_list, chain2_list, hinge_opt);
+ atom_opt, autojustify, mol_opt, dir_opt, dirpair_opt, dir1_opt,
+ dir2_opt, byresi_opt, chain1_list, chain2_list, hinge_opt);
else cerr<<"WARNING! -mm "<<mm_opt<<" not implemented"<<endl;
/* clean up */
vector<string>().swap(chain1_list);
vector<string>().swap(chain2_list);
vector<string>().swap(sequence);
+ vector<pair<string,string> >().swap(chain_pair_list);
t2 = clock();
float diff = ((float)t2 - (float)t1)/CLOCKS_PER_SEC;
diff --git a/modules/bindings/src/USalign/addChainID.cpp b/modules/bindings/src/USalign/addChainID.cpp
new file mode 100644
index 0000000000000000000000000000000000000000..7fb7ab4ef2d824682b47d7a11f29971e8e56669a
--- /dev/null
+++ b/modules/bindings/src/USalign/addChainID.cpp
@@ -0,0 +1,129 @@
+#include <fstream>
+#include <map>
+#include <sstream>
+#include <iostream>
+#include <string>
+#include <vector>
+#include <cstdlib>
+#include "pstream.h"
+
+using namespace std;
+
+void print_help()
+{
+ cout <<
+"Add chain ID to PDB format file.\n"
+"\n"
+"Usage: addChainID input.pdb output.pdb chainID\n"
+ <<endl;
+ exit(EXIT_SUCCESS);
+}
+
+void splitlines(const string &line, vector<string> &lines,
+ const char delimiter='\n')
+{
+ bool within_word = false;
+ for (size_t pos=0;pos<line.size();pos++)
+ {
+ if (line[pos]==delimiter)
+ {
+ within_word = false;
+ continue;
+ }
+ if (!within_word)
+ {
+ within_word = true;
+ lines.push_back("");
+ }
+ lines.back()+=line[pos];
+ }
+}
+
+void addChainID(const string &infile,const string &outfile,
+ const string &chainID)
+{
+ stringstream buf;
+ if (infile=="-") buf<<cin.rdbuf();
+#if defined(REDI_PSTREAM_H_SEEN)
+ else if (infile.size()>3 && infile.substr(infile.size()-3)==".gz")
+ {
+ redi::ipstream fp_gz; // if file is compressed
+ fp_gz.open("gunzip -c "+infile);
+ buf<<fp_gz.rdbuf();
+ fp_gz.close();
+ }
+#endif
+ else
+ {
+ ifstream fp;
+ fp.open(infile.c_str(),ios::in); //ifstream fp(filename,ios::in);
+ buf<<fp.rdbuf();
+ fp.close();
+ }
+ vector<string> lines;
+ splitlines(buf.str(),lines);
+ buf.str(string());
+ size_t l;
+
+ for (l=0;l<lines.size();l++)
+ {
+ if (lines[l].substr(0,6)=="ATOM " ||
+ lines[l].substr(0,6)=="HETATM")
+ {
+ if (lines[l].size()<22)
+ {
+ cerr<<"incomplete:"<<lines[l]<<endl;
+ continue;
+ }
+ buf<<lines[l].substr(0,20)<<chainID<<lines[l].substr(22)<<endl;
+ }
+ else if (lines[l].size())
+ buf<<lines[l]<<endl;
+ lines[l].clear();
+ }
+
+ if (outfile=="-")
+ cout<<buf.str();
+ else
+ {
+ ofstream fout;
+ fout.open(outfile.c_str(),ios::out);
+ fout<<buf.str();
+ fout.close();
+ }
+ buf.str(string());
+ vector<string>().swap(lines);
+ return;
+}
+
+int main(int argc, char *argv[])
+{
+ if (argc < 2) print_help();
+
+ string infile ="";
+ string outfile="";
+ string chainID="";
+
+ for (int i=1; i<argc; i++)
+ {
+ if ( infile.size()==0) infile =argv[i];
+ else if (outfile.size()==0) outfile=argv[i];
+ else if (chainID.size()==0) chainID=argv[i];
+ else
+ {
+ cerr<<"ERROR! no such option "<<argv[i]<<endl;
+ exit(1);
+ }
+ }
+
+ if (outfile.size()==0) outfile="-";
+ if (chainID.size()==0) chainID=" ";
+ else if (chainID.size()==1) chainID=" "+chainID;
+ else if (chainID.size()>2) chainID=chainID.substr(chainID.size()-2,2);
+
+ addChainID(infile,outfile,chainID);
+
+ infile.clear();
+ outfile.clear();
+ return 0;
+}
diff --git a/modules/bindings/src/USalign/basic_fun.h b/modules/bindings/src/USalign/basic_fun.h
index 0fe0701199465f79f0fc340dc7c85a95f90f1205..624d27a35b141ce6293ed188f6b21d07591b0071 100644
--- a/modules/bindings/src/USalign/basic_fun.h
+++ b/modules/bindings/src/USalign/basic_fun.h
@@ -151,7 +151,8 @@ string Trim(const string &inputString)
size_t get_PDB_lines(const string filename,
vector<vector<string> >&PDB_lines, vector<string> &chainID_list,
vector<int> &mol_vec, const int ter_opt, const int infmt_opt,
- const string atom_opt, const int split_opt, const int het_opt)
+ const string atom_opt, const bool autojustify, const int split_opt,
+ const int het_opt)
{
size_t i=0; // resi i.e. atom index
string line;
@@ -188,14 +189,49 @@ size_t get_PDB_lines(const string filename,
if (infmt_opt==0||infmt_opt==-1) // PDB format
{
+ map<string,char> aa3to1;
+ aa3to1[" A"]=aa3to1[" DA"]='a';
+ aa3to1[" C"]=aa3to1[" DC"]='c';
+ aa3to1[" G"]=aa3to1[" DG"]='g';
+ aa3to1[" U"]=aa3to1["PSU"]='u';
+ aa3to1[" I"]=aa3to1[" DI"]='i';
+ aa3to1[" T"]='t';
+ aa3to1["ALA"]='A';
+ aa3to1["CYS"]='C';
+ aa3to1["ASP"]='D';
+ aa3to1["GLU"]='E';
+ aa3to1["PHE"]='F';
+ aa3to1["GLY"]='G';
+ aa3to1["HIS"]='H';
+ aa3to1["ILE"]='I';
+ aa3to1["LYS"]='K';
+ aa3to1["LEU"]='L';
+ aa3to1["MET"]=aa3to1["MSE"]='M';
+ aa3to1["ASN"]='N';
+ aa3to1["PRO"]='P';
+ aa3to1["GLN"]='Q';
+ aa3to1["ARG"]='R';
+ aa3to1["SER"]='S';
+ aa3to1["THR"]='T';
+ aa3to1["VAL"]='V';
+ aa3to1["TRP"]='W';
+ aa3to1["TYR"]='Y';
+ aa3to1["ASX"]='B';
+ aa3to1["GLX"]='Z';
+ aa3to1["SEC"]='U';
+ aa3to1["PYL"]='O';
+
+
+ string atom;
+ string resn;
while ((compress_type==-1)?cin.good():(compress_type?fin_gz.good():fin.good()))
{
if (compress_type==-1) getline(cin, line);
else if (compress_type) getline(fin_gz, line);
else getline(fin, line);
if (infmt_opt==-1 && line.compare(0,5,"loop_")==0) // PDBx/mmCIF
- return get_PDB_lines(filename,PDB_lines,chainID_list,
- mol_vec, ter_opt, 3, atom_opt, split_opt,het_opt);
+ return get_PDB_lines(filename,PDB_lines,chainID_list, mol_vec,
+ ter_opt, 3, atom_opt, autojustify, split_opt,het_opt);
if (i > 0)
{
if (ter_opt>=1 && line.compare(0,3,"END")==0) break;
@@ -208,20 +244,36 @@ size_t get_PDB_lines(const string filename,
(line.compare(0, 6, "HETATM")==0 && het_opt==2 &&
line.compare(17,3, "MSE")==0)))
{
+ atom=line.substr(12,4);
+ if (autojustify)
+ {
+ resn=line.substr(17,3);
+ if (aa3to1.count(resn))
+ {
+ atom=Trim(atom);
+ if (atom.size())
+ {
+ if (atom.size()>=2 && atom[atom.size()-1]=='*')
+ atom=atom.substr(0,atom.size()-1)+"'";
+ if (atom.size()==1) atom=" "+atom+" ";
+ else if (atom.size()==2) atom=" "+atom+" ";
+ else if (atom.size()==3) atom=" "+atom;
+ }
+ }
+ }
if (atom_opt=="auto")
{
if (line[17]==' ' && (line[18]=='D'||line[18]==' '))
- select_atom=(line.compare(12,4," C3'")==0);
- else select_atom=(line.compare(12,4," CA ")==0);
+ select_atom=(atom==" C3'");
+ else select_atom=(atom==" CA ");
}
else if (atom_opt=="PC4'")
{
if (line[17]==' ' && (line[18]=='D'||line[18]==' '))
- select_atom=(line.compare(12,4," P ")==0
- )||(line.compare(12,4," C4'")==0);
- else select_atom=(line.compare(12,4," CA ")==0);
+ select_atom=(atom==" P ")||(atom==" C4'");
+ else select_atom=(atom==" CA ");
}
- else select_atom=(line.compare(12,4,atom_opt)==0);
+ else select_atom=(atom==atom_opt);
if (select_atom)
{
if (!chainID)
@@ -284,6 +336,8 @@ size_t get_PDB_lines(const string filename,
}
}
}
+
+ map<string,char>().swap(aa3to1);
}
else if (infmt_opt==1) // SPICKER format
{
@@ -752,6 +806,17 @@ void read_user_alignment(vector<string>&sequence, const string &fname_lign,
return;
}
+
+inline bool isfile(const string& filename)
+{
+ if (FILE *fp = fopen(filename.c_str(), "r"))
+ {
+ fclose(fp);
+ return true;
+ }
+ else return false;
+}
+
/* read list of entries from 'name' to 'chain_list'.
* dir_opt is the folder name (prefix).
* suffix_opt is the file name extension (suffix_opt).
@@ -764,14 +829,168 @@ void file2chainlist(vector<string>&chain_list, const string &name,
if (! fp.is_open())
PrintErrorAndQuit(("Can not open file: "+name+'\n').c_str());
string line;
+ string filename;
+ int a,b;
+ string sep;
while (fp.good())
{
getline(fp, line);
if (! line.size()) continue;
- chain_list.push_back(dir_opt+Trim(line)+suffix_opt);
+ line=Trim(line);
+ for (a=0;a<=2;a++)
+ {
+ if (a==0) sep="";
+ else if (a==1) sep="/";
+ else if (a==2) sep="\\";
+
+ filename=dir_opt+sep+line+suffix_opt;
+ if (isfile(filename)) break;
+ if (suffix_opt.size())
+ {
+ filename=dir_opt+sep+line;
+ if (isfile(filename)) break;
+ }
+ else
+ {
+ filename=dir_opt+sep+line+".pdb";
+ if (isfile(filename)) break;
+ filename=dir_opt+sep+line+".cif";
+ if (isfile(filename)) break;
+ }
+ filename.clear();
+ }
+
+ if (filename.size()==0)
+ {
+ filename=dir_opt+line+suffix_opt;
+ cerr<<"WARNING! "<<filename<<" does not exist"<<endl;
+ }
+ else chain_list.push_back(filename);
+ line.clear();
+ filename.clear();
+ }
+ fp.close();
+}
+
+void file2chainpairlist(vector<string>&chain1_list, vector<string>&chain2_list,
+ const string &name, const string &dirpair_opt, const string &suffix_opt)
+{
+ ifstream fp(name.c_str());
+ if (! fp.is_open())
+ PrintErrorAndQuit(("Can not open file: "+name+'\n').c_str());
+ string line;
+ string filename;
+ int a,b;
+ size_t i;
+ string sep,filename1,filename2;
+ vector<string> line_vec;
+ while (fp.good())
+ {
+ getline(fp, line);
+ if (! line.size()) continue;
+ line=Trim(line);
+ split(line, line_vec, '\t');
+ if (line_vec.size()==2)
+ {
+ filename1=line_vec[0];
+ filename2=line_vec[1];
+ for (i=0;i<2;i++) line_vec[i].clear(); line_vec.clear();
+ }
+ else
+ {
+ for (i=0;i<line_vec.size();i++) line_vec[i].clear(); line_vec.clear();
+ split(line, line_vec, ' ');
+ if (line_vec.size()==2)
+ {
+ filename1=line_vec[0];
+ filename2=line_vec[1];
+ for (i=0;i<2;i++) line_vec[i].clear(); line_vec.clear();
+ }
+ else
+ {
+ cerr<<"WARNING! not a chain pair: "<<line<<endl;
+ for (i=0;i<line_vec.size();i++) line_vec[i].clear(); line_vec.clear();
+ continue;
+ }
+ }
+
+ filename.clear();
+ for (a=0;a<=2;a++)
+ {
+ if (a==0) sep="";
+ else if (a==1) sep="/";
+ else if (a==2) sep="\\";
+
+ filename=dirpair_opt+sep+filename1+suffix_opt;
+ if (isfile(filename)) break;
+ if (suffix_opt.size())
+ {
+ filename=dirpair_opt+sep+line;
+ if (isfile(filename)) break;
+ }
+ else
+ {
+ filename=dirpair_opt+sep+line+".pdb";
+ if (isfile(filename)) break;
+ filename=dirpair_opt+sep+line+".cif";
+ if (isfile(filename)) break;
+ }
+ filename.clear();
+ }
+
+ if (filename.size()==0)
+ {
+ filename=dirpair_opt+filename1+suffix_opt;
+ cerr<<"WARNING! "<<filename<<" does not exist"<<endl;
+ continue;
+ }
+ else
+ {
+ filename1=filename;
+ filename.clear();
+ }
+
+ for (a=0;a<=2;a++)
+ {
+ if (a==0) sep="";
+ else if (a==1) sep="/";
+ else if (a==2) sep="\\";
+
+ filename=dirpair_opt+sep+filename2+suffix_opt;
+ if (isfile(filename)) break;
+ if (suffix_opt.size())
+ {
+ filename=dirpair_opt+sep+line;
+ if (isfile(filename)) break;
+ }
+ else
+ {
+ filename=dirpair_opt+sep+line+".pdb";
+ if (isfile(filename)) break;
+ filename=dirpair_opt+sep+line+".cif";
+ if (isfile(filename)) break;
+ }
+ filename.clear();
+ }
+
+ if (filename.size()==0)
+ {
+ filename=dirpair_opt+filename2+suffix_opt;
+ cerr<<"WARNING! "<<filename<<" does not exist"<<endl;
+ continue;
+ }
+ else
+ {
+ filename2=filename;
+ filename.clear();
+ }
+
+ chain1_list.push_back(filename1);
+ chain2_list.push_back(filename2);
+ line.clear();
+ filename.clear();
}
fp.close();
- line.clear();
}
#endif
diff --git a/modules/bindings/src/USalign/pdb2fasta.cpp b/modules/bindings/src/USalign/pdb2fasta.cpp
index e0fc71206d788719907bb275d776baf2f81e2a83..767b1dfe47dab8281c0746f33862bee39e362009 100644
--- a/modules/bindings/src/USalign/pdb2fasta.cpp
+++ b/modules/bindings/src/USalign/pdb2fasta.cpp
@@ -126,6 +126,8 @@ int main(int argc, char *argv[])
PrintErrorAndQuit("ERROR! Molecule type must be one of the"
"following:\nauto, prot (the same as 'protein'), and "
"RNA (the same as 'DNA').");
+
+ bool autojustify=(atom_opt=="auto" || atom_opt=="PC4'"); // auto re-pad atom name
if (mol_opt=="protein" && atom_opt=="auto")
atom_opt=" CA ";
else if (mol_opt=="RNA" && atom_opt=="auto")
@@ -170,8 +172,8 @@ int main(int argc, char *argv[])
for (i=0;i<chain_list.size();i++)
{
xname=chain_list[i];
- xchainnum=get_PDB_lines(xname, PDB_lines, chainID_list,
- mol_vec, ter_opt, infmt_opt, atom_opt, split_opt, het_opt);
+ xchainnum=get_PDB_lines(xname, PDB_lines, chainID_list, mol_vec,
+ ter_opt, infmt_opt, atom_opt, autojustify, split_opt, het_opt);
if (!xchainnum)
{
cerr<<"Warning! Cannot parse file: "<<xname
diff --git a/modules/bindings/src/USalign/pdb2ss.cpp b/modules/bindings/src/USalign/pdb2ss.cpp
index d0732803d16652eb312ea337812998a761bd092a..501023a978f669d1844f33b9173871af1012b1fe 100644
--- a/modules/bindings/src/USalign/pdb2ss.cpp
+++ b/modules/bindings/src/USalign/pdb2ss.cpp
@@ -114,6 +114,8 @@ int main(int argc, char *argv[])
if (suffix_opt.size() && dir_opt.size()==0)
PrintErrorAndQuit("-suffix is only valid if -dir is set");
+
+ bool autojustify=(atom_opt=="auto" || atom_opt=="PC4'"); // auto re-pad atom name
if (atom_opt.size()!=4)
PrintErrorAndQuit("ERROR! Atom name must have 4 characters, including space.");
if (mol_opt!="auto" && mol_opt!="protein" && mol_opt!="RNA")
@@ -170,8 +172,8 @@ int main(int argc, char *argv[])
for (i=0;i<chain_list.size();i++)
{
xname=chain_list[i];
- xchainnum=get_PDB_lines(xname, PDB_lines, chainID_list,
- mol_vec, ter_opt, infmt_opt, atom_opt, split_opt, het_opt);
+ xchainnum=get_PDB_lines(xname, PDB_lines, chainID_list, mol_vec,
+ ter_opt, infmt_opt, atom_opt, autojustify, split_opt, het_opt);
if (!xchainnum)
{
cerr<<"Warning! Cannot parse file: "<<xname
diff --git a/modules/bindings/src/USalign/pdb2xyz.cpp b/modules/bindings/src/USalign/pdb2xyz.cpp
index d151f1e741b1a419482618d6dc08ac01197be2db..988dc9ae7443aa933d578329f405cf0fd9a37c63 100644
--- a/modules/bindings/src/USalign/pdb2xyz.cpp
+++ b/modules/bindings/src/USalign/pdb2xyz.cpp
@@ -98,6 +98,8 @@ int main(int argc, char *argv[])
if (suffix_opt.size() && dir_opt.size()==0)
PrintErrorAndQuit("-suffix is only valid if -dir is set");
+
+ bool autojustify=(atom_opt=="auto" || atom_opt=="PC4'"); // auto re-pad atom name
if (atom_opt.size()!=4)
PrintErrorAndQuit("ERROR! Atom name must have 4 characters, including space.");
if (split_opt==1 && ter_opt!=0)
@@ -143,8 +145,8 @@ int main(int argc, char *argv[])
for (i=0;i<chain_list.size();i++)
{
xname=chain_list[i];
- xchainnum=get_PDB_lines(xname, PDB_lines, chainID_list,
- mol_vec, ter_opt, infmt_opt, atom_opt, split_opt, het_opt);
+ xchainnum=get_PDB_lines(xname, PDB_lines, chainID_list, mol_vec,
+ ter_opt, infmt_opt, atom_opt, autojustify, split_opt, het_opt);
if (!xchainnum)
{
cerr<<"Warning! Cannot parse file: "<<xname
diff --git a/modules/bindings/src/USalign/pdbAtomName.cpp b/modules/bindings/src/USalign/pdbAtomName.cpp
index d65c576d2f375343b7d1e95f2e75c926182022a8..2d67eb799dbe228a65a8ab878c5929b48948563d 100644
--- a/modules/bindings/src/USalign/pdbAtomName.cpp
+++ b/modules/bindings/src/USalign/pdbAtomName.cpp
@@ -4,6 +4,7 @@
#include <iostream>
#include <string>
#include <vector>
+#include <cstdlib>
#include "pstream.h"
using namespace std;
diff --git a/modules/bindings/src/USalign/qTMclust.cpp b/modules/bindings/src/USalign/qTMclust.cpp
index 08fc64b68d12fc701cf3eff12f3c83885420fb1c..1cb9ba263763e6b4233be3012d4edbd361d095b4 100644
--- a/modules/bindings/src/USalign/qTMclust.cpp
+++ b/modules/bindings/src/USalign/qTMclust.cpp
@@ -80,6 +80,8 @@ void print_help(bool h_opt=false)
" 1: treat each MODEL as a separate chain (-ter should be 0)\n"
" 2: treat each chain as a seperate chain (-ter should be <=1)\n"
"\n"
+" -init tentative clustering\n"
+"\n"
" -h Print the full help message, including additional options.\n"
"\n"
<<endl;
@@ -110,6 +112,32 @@ void filter_lower_bound(double &lb_HwRMSD, double &lb_TMfast,
return;
}
+void read_init_cluster(const string&filename,
+ map<string, map<string,bool> > &init_cluster)
+{
+ ifstream fin;
+ string line;
+ vector<string> line_vec;
+ map<string, bool> tmp_map;
+ size_t i,j;
+ fin.open(filename.c_str());
+ while (fin.good())
+ {
+ getline(fin,line);
+ split(line,line_vec,'\t');
+ for (i=0;i<line_vec.size();i++)
+ {
+ for (j=0;j<line_vec.size();j++)
+ if (i!=j) tmp_map[line_vec[j]]=1;
+ init_cluster[line_vec[i]]=tmp_map;
+ map<string, bool> ().swap(tmp_map);
+ }
+ for (i=0;i<line_vec.size();i++) line_vec[i].clear(); line_vec.clear();
+ }
+ fin.close();
+ vector<string>().swap(line_vec);
+}
+
int main(int argc, char *argv[])
{
if (argc < 2) print_help();
@@ -124,6 +152,7 @@ int main(int argc, char *argv[])
string xname = "";
double TMcut = 0.5;
string fname_clust = ""; // file name for output cluster result
+ string fname_init = "";
string fname_lign = ""; // file name for user alignment
vector<string> sequence; // get value from alignment file
double Lnorm_ass, d0_scale;
@@ -146,6 +175,7 @@ int main(int argc, char *argv[])
string dir_opt =""; // set -dir to empty
int byresi_opt=0; // set -byresi to 0
vector<string> chain_list;
+ map<string, map<string,bool> > init_cluster;
for(int i = 1; i < argc; i++)
{
@@ -228,6 +258,10 @@ int main(int argc, char *argv[])
{
het_opt=atoi(argv[i + 1]); i++;
}
+ else if ( !strcmp(argv[i],"-init") && i < (argc-1) )
+ {
+ read_init_cluster(argv[i+1],init_cluster); i++;
+ }
else if (xname.size() == 0) xname=argv[i];
else PrintErrorAndQuit(string("ERROR! Undefined option ")+argv[i]);
}
@@ -317,7 +351,7 @@ int main(int argc, char *argv[])
{
xname=chain_list[i];
newchainnum=get_PDB_lines(xname, PDB_lines, chainID_list,
- mol_vec, ter_opt, infmt_opt, atom_opt, split_opt, het_opt);
+ mol_vec, ter_opt, infmt_opt, atom_opt, false, split_opt, het_opt);
if (!newchainnum)
{
cerr<<"Warning! Cannot parse file: "<<xname
@@ -439,6 +473,7 @@ int main(int argc, char *argv[])
}
sizePROT=index_vec.size();
+ string key=chainID_list[chain_i];
cout<<'>'<<chainID_list[chain_i]<<'\t'<<xlen<<'\t'
<<setiosflags(ios::fixed)<<setprecision(2)
<<100.*i/Nstruct<<"%(#"<<i<<")\t"
@@ -447,9 +482,14 @@ int main(int argc, char *argv[])
#ifdef TMalign_HwRMSD_h
vector<pair<double,size_t> > HwRMSDscore_list;
double TM;
+ size_t init_count=0;
for (j=0;j<sizePROT;j++)
{
chain_j=index_vec[j];
+ string value=chainID_list[chain_j];
+ if (init_cluster.count(key) && init_count>=2 &&
+ HwRMSDscore_list.size()>=init_cluster[key].size() && !init_cluster[key].count(value))
+ continue;
ylen=xyz_vec[chain_j].size();
if (mol_vec[chain_i]*mol_vec[chain_j]<0) continue;
else if (s_opt==2 && xlen<TMcut*ylen) continue;
@@ -461,6 +501,8 @@ int main(int argc, char *argv[])
if (s_opt<=1) filter_lower_bound(lb_HwRMSD, lb_TMfast,
TMcut, s_opt, mol_vec[chain_i]+mol_vec[chain_j]);
+ //cout<<chainID_list[chain_i]<<" => "<<chainID_list[chain_j]<<endl;
+
NewArray(&ya, ylen, 3);
for (r=0;r<ylen;r++)
{
@@ -509,7 +551,16 @@ int main(int argc, char *argv[])
Lave=sqrt(xlen*ylen); // geometry average because O(L1*L2)
if (TM>=lb_HwRMSD || Lave<=fast_lb)
- HwRMSDscore_list.push_back(make_pair(TM,index_vec[j]));
+ {
+ if (init_cluster.count(key) && init_cluster[key].count(value))
+ {
+ HwRMSDscore_list.push_back(make_pair(TM+1,index_vec[j]));
+ init_count++;
+ if (init_count==init_cluster[key].size()) break;
+ }
+ else
+ HwRMSDscore_list.push_back(make_pair(TM,index_vec[j]));
+ }
/* clean up after each HwRMSD */
seqM.clear();
@@ -529,6 +580,7 @@ int main(int argc, char *argv[])
if (xlen<=fast_lb) cur_repr_num_cutoff=max_repr_num;
else if (xlen>fast_lb && xlen<fast_ub) cur_repr_num_cutoff+=
(fast_ub-xlen)/(fast_ub-fast_lb)*(max_repr_num-min_repr_num);
+ //if (init_count>=2) cur_repr_num_cutoff=init_count;
index_vec.clear();
for (j=0;j<HwRMSDscore_list.size();j++)
@@ -715,6 +767,7 @@ int main(int argc, char *argv[])
clust_mem_vec.clear();
chainID_list.clear();
clust_repr_map.clear();
+ map<string, map<string,bool> >().swap(init_cluster);
t2 = clock();
float diff = ((float)t2 - (float)t1)/CLOCKS_PER_SEC;
diff --git a/modules/bindings/src/USalign/readme.txt b/modules/bindings/src/USalign/readme.txt
index 2a03302527c578b4e646739b2a2e5331b53091c7..79ae2068bdcf64161398e3bb09e038383895bf92 100644
--- a/modules/bindings/src/USalign/readme.txt
+++ b/modules/bindings/src/USalign/readme.txt
@@ -4,8 +4,8 @@
References to cite:
(1) Chengxin Zhang, Morgan Shine, Anna Marie Pyle, Yang Zhang
- (2022) Nat Methods
- (2) Chengxin Zhang, Anna Marie Pyle (2022) iScience
+ (2022) Nat Methods. 19(9), 1109-1115.
+ (2) Chengxin Zhang, Anna Marie Pyle (2022) iScience. 25(10), 105218.
DISCLAIMER:
Permission to use, copy, modify, and distribute this program for
@@ -72,6 +72,8 @@
2022/06/23: Fix -m for Windows. Add pymol plugin.
2022/06/26: Add -full option for -mm 2 and 4
2022/09/24: Support -TMscore for complex when the chain order is different
+ 2023/06/09: Correct atom name justification in PDB file for standard amino
+ acids and nucleotides
===============================================================================
=========================
diff --git a/modules/bindings/src/USalign/se.cpp b/modules/bindings/src/USalign/se.cpp
index af24ae78cafc6b5a930522e938cac871409db55d..06492ffa7189b0f7400ad928676398d18c324910 100644
--- a/modules/bindings/src/USalign/se.cpp
+++ b/modules/bindings/src/USalign/se.cpp
@@ -318,8 +318,8 @@ int main(int argc, char *argv[])
{
/* parse chain 1 */
xname=chain1_list[i];
- xchainnum=get_PDB_lines(xname, PDB_lines1, chainID_list1,
- mol_vec1, ter_opt, infmt1_opt, atom_opt, split_opt, het_opt);
+ xchainnum=get_PDB_lines(xname, PDB_lines1, chainID_list1, mol_vec1,
+ ter_opt, infmt1_opt, atom_opt, false, split_opt, het_opt);
if (!xchainnum)
{
cerr<<"Warning! Cannot parse file: "<<xname
@@ -349,8 +349,8 @@ int main(int argc, char *argv[])
{
yname=chain2_list[j];
ychainnum=get_PDB_lines(yname, PDB_lines2, chainID_list2,
- mol_vec2, ter_opt, infmt2_opt, atom_opt, split_opt,
- het_opt);
+ mol_vec2, ter_opt, infmt2_opt, atom_opt, false,
+ split_opt, het_opt);
if (!ychainnum)
{
cerr<<"Warning! Cannot parse file: "<<yname
diff --git a/modules/bindings/src/wrap_tmalign.cc b/modules/bindings/src/wrap_tmalign.cc
index 49da68d00061044d2cb4832f09b5907ce1121be4..91544c06ce2973d026ea15a3eba932a1d3e556f9 100644
--- a/modules/bindings/src/wrap_tmalign.cc
+++ b/modules/bindings/src/wrap_tmalign.cc
@@ -428,7 +428,10 @@ MMAlignResult WrappedMMAlign(const std::vector<geom::Vec3List>& pos_one,
const ost::seq::SequenceList& seq2,
const std::vector<bool>& rna1,
const std::vector<bool>& rna2,
- bool fast) {
+ bool fast,
+ const std::map<int, int>& mapping) {
+
+ std::map<int, int> chainmap(mapping);
// input checks
if(pos_one.empty() || pos_two.empty()) {
@@ -722,6 +725,11 @@ MMAlignResult WrappedMMAlign(const std::vector<geom::Vec3List>& pos_one,
TMave_mat[i][j]=-1;
continue;
}
+ if (chainmap.size() && chainmap[i]!=j)
+ {
+ TMave_mat[i][j]=-1;
+ continue;
+ }
ylen=ylen_vec[j];
if (ylen<3)
@@ -755,8 +763,8 @@ MMAlignResult WrappedMMAlign(const std::vector<geom::Vec3List>& pos_one,
if (byresi_opt)
{
- int total_aln=extract_aln_from_resi(sequence,
- seqx,seqy,resi_vec1,resi_vec2,xlen_vec,ylen_vec, i, j);
+ int total_aln=extract_aln_from_resi(sequence, seqx,seqy,
+ resi_vec1,resi_vec2,xlen_vec,ylen_vec, i, j, byresi_opt);
seqxA_mat[i][j]=sequence[0];
seqyA_mat[i][j]=sequence[1];
if (total_aln>xlen+ylen-3)
@@ -827,7 +835,7 @@ MMAlignResult WrappedMMAlign(const std::vector<geom::Vec3List>& pos_one,
/* refine alignment for large oligomers */
int aln_chain_num=count_assign_pair(assign1_list,chain1_num);
bool is_oligomer=(aln_chain_num>=3);
- if (aln_chain_num==2) // dimer alignment
+ if (aln_chain_num==2 && chainmap.size()==0) // dimer alignment
{
int na_chain_num1,na_chain_num2,aa_chain_num1,aa_chain_num2;
count_na_aa_chain_num(na_chain_num1,aa_chain_num1,mol_vec1);
@@ -849,7 +857,7 @@ MMAlignResult WrappedMMAlign(const std::vector<geom::Vec3List>& pos_one,
else is_oligomer=true; /* align oligomers to dimer */
}
- if (aln_chain_num>=3 || is_oligomer) // oligomer alignment
+ if ((aln_chain_num>=3 || is_oligomer) && chainmap.size()==0) // oligomer alignment
{
/* extract centroid coordinates */
double **xcentroids;
@@ -997,8 +1005,7 @@ MMAlignResult WrappedMMAlign(const std::vector<geom::Vec3List>& pos_one,
ylen_vec.clear(); // length of complex2
vector<string> ().swap(resi_vec1); // residue index for chain1
vector<string> ().swap(resi_vec2); // residue index for chain2
-
-
+ map<int,int> ().swap(chainmap);
return res;
}
@@ -1075,7 +1082,8 @@ TMAlignResult WrappedTMAlign(const ost::mol::ChainView& chain1,
MMAlignResult WrappedMMAlign(const ost::mol::EntityView& ent1,
const ost::mol::EntityView& ent2,
- bool fast) {
+ bool fast,
+ const std::map<String, String>& mapping) {
ost::mol::ChainViewList chains1 = ent1.GetChainList();
int n1 = chains1.size();
std::vector<geom::Vec3List> pos1(n1);
@@ -1102,7 +1110,70 @@ MMAlignResult WrappedMMAlign(const ost::mol::EntityView& ent1,
s2.AddSequence(s);
}
- return WrappedMMAlign(pos1, pos2, s1, s2, rna1, rna2, fast);
+ std::map<int,int> int_mapping;
+ if(!mapping.empty()) {
+ // OpenStructure mapping is a dict with target chains as key and
+ // model chains as values. Target is ent2 and model is ent1.
+ // USalign needs the mapping the other way around,
+ // i.e. the chain idx of ent1 as key and chain idx of ent2 as value
+ std::set<int> mapped_trg_chains;
+ std::set<int> mapped_mdl_chains;
+ for(auto it = mapping.begin(); it != mapping.end(); ++it) {
+ String trg_cname = it->first;
+ String mdl_cname = it->second;
+ int trg_idx = -1;
+ int mdl_idx = -1;
+
+ for(int i = 0; i < n1; ++i) {
+ if(s1[i].GetName() == mdl_cname) {
+ mdl_idx = i;
+ break;
+ }
+ }
+
+ for(int i = 0; i < n2; ++i) {
+ if(s2[i].GetName() == trg_cname) {
+ trg_idx = i;
+ break;
+ }
+ }
+
+ if(mdl_idx == -1) {
+ std::stringstream ss;
+ ss << "Specified \""<<mdl_cname<<"\" as mdl chain name in custom ";
+ ss << "mapping. Mdl has no mappable chain with this name.";
+ throw ost::Error(ss.str());
+ }
+
+ if(mapped_mdl_chains.find(mdl_idx) != mapped_mdl_chains.end()) {
+ std::stringstream ss;
+ ss << "\""<<mdl_cname<<"\" appears more than once as mdl chain in ";
+ ss << "custom mapping";
+ throw ost::Error(ss.str());
+ }
+
+ if(trg_idx == -1) {
+ std::stringstream ss;
+ ss << "Specified \""<<trg_cname<<"\" as trg chain name in custom ";
+ ss << "mapping. Trg has no mappable chain with this name.";
+ throw ost::Error(ss.str());
+ }
+
+ if(mapped_trg_chains.find(trg_idx) != mapped_trg_chains.end()) {
+ std::stringstream ss;
+ ss << "\""<<trg_cname<<"\" appears more than once as trg chain in ";
+ ss << "custom mapping";
+ throw ost::Error(ss.str());
+ }
+
+ int_mapping[mdl_idx] = trg_idx;
+ mapped_trg_chains.insert(trg_idx);
+ mapped_mdl_chains.insert(mdl_idx);
+ }
+ }
+
+ return WrappedMMAlign(pos1, pos2, s1, s2, rna1, rna2, fast,
+ int_mapping);
}
}} //ns
diff --git a/modules/bindings/src/wrap_tmalign.hh b/modules/bindings/src/wrap_tmalign.hh
index 282209ca57597bef4e5d5a3f15fbbaafb3e2dd0a..bb96ff28c9a8498a84daf07408ce7ecc352ef19b 100644
--- a/modules/bindings/src/wrap_tmalign.hh
+++ b/modules/bindings/src/wrap_tmalign.hh
@@ -104,7 +104,9 @@ MMAlignResult WrappedMMAlign(const std::vector<geom::Vec3List>& pos_one,
const ost::seq::SequenceList& seq2,
const std::vector<bool>& rna1,
const std::vector<bool>& rna2,
- bool fast = false);
+ bool fast = false,
+ const std::map<int, int>& mapping =
+ std::map<int,int>());
TMAlignResult WrappedTMAlign(const ost::mol::ChainView& ent1,
const ost::mol::ChainView& ent2,
@@ -112,7 +114,9 @@ TMAlignResult WrappedTMAlign(const ost::mol::ChainView& ent1,
MMAlignResult WrappedMMAlign(const ost::mol::EntityView& ent1,
const ost::mol::EntityView& ent2,
- bool fast = false);
+ bool fast = false,
+ const std::map<String, String>& mapping =
+ std::map<String, String>());
}} //ns
#endif
diff --git a/modules/bindings/tests/test_cadscore.py b/modules/bindings/tests/test_cadscore.py
index be3bab50d0bc59943d760bb5dcc86054f479bc3c..397d58ff31bbe5641d1300d7fba80aa4047593ee 100644
--- a/modules/bindings/tests/test_cadscore.py
+++ b/modules/bindings/tests/test_cadscore.py
@@ -18,11 +18,10 @@ class TestCADBindings(unittest.TestCase):
cad_read_g_path = settings.Locate('CADscore_read_global_scores.bash')
cad_read_l_path = settings.Locate('CADscore_read_local_scores.bash')
executable_path = settings.Locate('voroprot2')
- except:
- print("Could not find CAD score classic executables: ignoring unit tests")
- return
+ except settings.FileNotFound:
+ self.skipTest("Could not find CAD score classic executables: ignoring unit tests")
- cad_result = cadscore.CADScore(self.protein, self.protein,
+ cad_result = cadscore.CADScore(self.protein, self.protein, mode="classic",
label="cad_classic")
# model and reference are the same, we expect a global CAD score of 1
@@ -47,9 +46,8 @@ class TestCADBindings(unittest.TestCase):
# all of the following need to be present
voronota_cadscore_path = settings.Locate("voronota-cadscore")
executable_path = settings.Locate("voronota")
- except:
- print("Could not find CAD score voronota executables: ignoring unit tests")
- return
+ except settings.FileNotFound:
+ self.skipTest("Could not find CAD score voronota executables: ignoring unit tests")
cad_result = cadscore.CADScore(self.protein, self.protein, mode="voronota",
label="cad_voronota")
diff --git a/modules/conop/doc/compoundlib.rst b/modules/conop/doc/compoundlib.rst
index fed70b6379713ceee56ca9273dc3a1541455947c..a83e5900445d7843a069d9c3da71db7249157385 100644
--- a/modules/conop/doc/compoundlib.rst
+++ b/modules/conop/doc/compoundlib.rst
@@ -11,13 +11,13 @@ information for the :class:`rule-based processor <RuleBasedBuilder>`.
The compound definitions for standard PDB files are taken from the
components.cif dictionary provided by the PDB. The dictionary is updated with
every PDB release and augmented with the compound definitions of newly
-crystallized compounds.
-
-If you downloaded the bundle, a recent version of the compound library is
-already included. If you are compiling from source or want to incorporate the
-latest compound definitions, follow :ref:`these instructions <mmcif-convert>` to
-build the compound library manually.
+crystallized compounds. Follow :ref:`these instructions <mmcif-convert>` to
+build the compound library.
+In general, compound libraries built with older versions of OST are compatible
+with newer version of OST, so it may not be necessary to rebuild a new one.
+However, some functionality may not be available. Currently, compound libraries
+built with OST 1.5.0 or later can be loaded.
.. function:: GetDefaultLib()
@@ -58,16 +58,42 @@ build the compound library manually.
Create a new compound library
- .. method:: FindCompound(tlc, dialect='PDB')
-
- Lookup compound by its three-letter-code, e.g ALA. If no compound with that
- name exists, the function returns None. Compounds are cached after they have
- been loaded with FindCompound. To delete the compound cache, use
+ .. method:: FindCompound(id, dialect='PDB')
+
+ Lookup compound by its three-letter-code, e.g ALA. If no compound with that
+ name exists, the function returns None. Compounds are cached after they
+ have been loaded with FindCompound. To delete the compound cache, use
:meth:`ClearCache`.
:returns: The found compound
:rtype: :class:`Compound`
-
+
+ .. method:: FindCompounds(query, by, dialect='PDB')
+
+ Lookup one or more compound by SMILES string, InChI code, InChI key or
+ formula.
+
+ The compound library is queried for exact string matches. Many SMILES
+ strings can represent the same compound, so this function is only useful
+ for SMILES strings coming from the PDB (or canonical SMILES from the
+ OpenEye Toolkits). This is also the case for InChI codes, although to a
+ lesser extent.
+
+ Obsolete compounds will be sorted at the back of the list. However, there
+ is no guarantee that the first compound is active.
+
+ :param query: the string to lookup.
+ :type query: :class:`string`
+ :param by: the key into which to lookup for the query. One of: "smiles",
+ "inchi_code", "inchi_key" or "formula".
+ :type by: :class:`string`
+ :param dialect: the dialect to select for (typically "PDB", or "CHARMM" if
+ your compound library was built with charmm support).
+ :type dialect: :class:`string`
+ :returns: A list of found compounds, or an empty list if no compound was
+ found.
+ :rtype: :class:`list` or :class:`Compound`
+
.. method:: Copy(dst_filename)
Copy database to dst_filename. The new library will be an exact copy of the
@@ -156,17 +182,43 @@ build the compound library manually.
.. attribute:: inchi
- The InChI code of this compound, without the 'InChI=' part, e.g
- '1S/H2O/h1H2' for water. Read-only.
+ The InChI code of this compound, e.g '1S/H2O/h1H2' for water, or an empty
+ string if missing.
+ Read-only.
:type: :class:`str`
.. attribute:: inchi_key
- The InChIKey of this compound without the 'InChIKey=' part, e.g.
- 'XLYOFNOQVPJJNP-UHFFFAOYSA-N' for water. Read-only.
+ The InChIKey of this compound, e.g.
+ 'XLYOFNOQVPJJNP-UHFFFAOYSA-N' for water, or an empty string if missing.
+ Read-only.
:type: :class:`str`
+
+ .. attribute:: smiles
+
+ The SMILES string of this compound, e.g 'O' for water, or an empty string
+ if missing. Read-only.
+
+ The string is read from the canonical SMILES produced by the
+ OpenEye OEToolkits.
+
+ :type: :class:`str`
+
+ .. attribute:: obsolete
+
+ Whether the component has been obsoleted by the PDB.
+
+ :type: :class:`bool`
+
+ .. attribute:: replaced_by
+
+ If the component has been obsoleted by the PDB, this is the three-letter
+ code of the compound that replaces it. This is not set for all obsolete
+ compounds.
+
+ :type: :class:`str`
.. class:: AtomSpec
@@ -192,6 +244,10 @@ build the compound library manually.
of a leaving atom is the *OXT* atom of amino acids that gets lost when a
peptide bond is formed.
+ .. attribute:: charge
+
+ The charge of the atom.
+
.. class:: BondSpec
Definition of a bond
diff --git a/modules/conop/pymod/export_compound.cc b/modules/conop/pymod/export_compound.cc
index 400fad7738b0d3acad1df591aeb380e91146a2f8..d193801bb75d847786e9f9bf6a5ce7ac300005bf 100644
--- a/modules/conop/pymod/export_compound.cc
+++ b/modules/conop/pymod/export_compound.cc
@@ -70,9 +70,25 @@ char get_chemtype(CompoundPtr compound)
}
CompoundPtr find_compound(CompoundLibPtr comp_lib,
- const String& tlc, const String& dialect)
+ const String& id, const String& dialect)
{
- return comp_lib->FindCompound(tlc, tr_dialect(dialect));
+ return comp_lib->FindCompound(id, tr_dialect(dialect));
+}
+
+boost::python::list find_compounds(CompoundLibPtr comp_lib,
+ const String& query,
+ const String& by,
+ const String& dialect)
+{
+ CompoundPtrList ptr_list = comp_lib->FindCompounds(query, by, tr_dialect(dialect));
+ // We can't return ptr_list directly - the list was full of non working
+ // compounds for no obvious reason. So we convert it to a boost python list
+ // of Compounds.
+ boost::python::list l;
+ for(auto it = ptr_list.begin(); it != ptr_list.end(); ++it) {
+ l.append(*it);
+ }
+ return l;
}
bool is_residue_complete(CompoundLibPtr comp_lib,
@@ -126,6 +142,13 @@ void export_Compound() {
.add_property("inchi_key",
make_function(&Compound::GetInchiKey,
return_value_policy<copy_const_reference>()))
+ .add_property("smiles",
+ make_function(&Compound::GetSMILES,
+ return_value_policy<copy_const_reference>()))
+ .add_property("obsolete", &Compound::GetObsolete)
+ .add_property("replaced_by",
+ make_function(&Compound::GetReplacedBy,
+ return_value_policy<copy_const_reference>()))
;
class_<AtomSpec>("AtomSpec", no_init)
@@ -135,6 +158,7 @@ void export_Compound() {
.def_readonly("is_leaving", &AtomSpec::is_leaving)
.def_readonly("is_aromatic", &AtomSpec::is_aromatic)
.def_readonly("ordinal", &AtomSpec::ordinal)
+ .def_readonly("charge", &AtomSpec::charge)
;
class_<BondSpec>("BondSpec", no_init)
@@ -147,7 +171,9 @@ void export_Compound() {
class_<CompoundLib>("CompoundLib", no_init)
.def("Load", &CompoundLib::Load, arg("readonly")=true).staticmethod("Load")
.def("FindCompound", &find_compound,
- (arg("tlc"), arg("dialect")="PDB"))
+ (arg("id"), arg("dialect")="PDB"))
+ .def("FindCompounds", &find_compounds,
+ (arg("query"), arg("by"), arg("dialect")="PDB"))
.def("IsResidueComplete", &is_residue_complete, (arg("residue"),
arg("check_hydrogens")=false,
arg("dialect")="PDB"))
diff --git a/modules/conop/src/chemdict_tool.cc b/modules/conop/src/chemdict_tool.cc
index 0286e525ff3eb4a1cf257624533385370ad2e3db..404f50b8aa12dbd00b248a3b28dc574389787a40 100644
--- a/modules/conop/src/chemdict_tool.cc
+++ b/modules/conop/src/chemdict_tool.cc
@@ -66,6 +66,11 @@ int main(int argc, char const *argv[])
}
boost::iostreams::filtering_stream<boost::iostreams::input> filtered_istream;
std::ifstream istream(argv[2]);
+ if (! istream.is_open()) {
+ std::cout << "Cannot open " << argv[2] << ": [Errno " << errno << "] "
+ << strerror(errno) << std::endl;
+ return 1;
+ }
if (boost::iequals(".gz", boost::filesystem::extension(argv[2]))) {
filtered_istream.push(boost::iostreams::gzip_decompressor());
}
@@ -92,6 +97,11 @@ int main(int argc, char const *argv[])
cdp.SetCompoundLib(in_mem_lib);
cdp.Parse();
in_mem_lib->SetChemLibInfo();
- in_mem_lib->Copy(argv[3]);
+ conop::CompoundLibPtr copy = in_mem_lib->Copy(argv[3]);
+ if (! copy) {
+ std::cout << "Cannot save " << argv[3] << ": [Errno " << errno << "] "
+ << strerror(errno) << std::endl;
+ return 1;
+ }
return 0;
}
diff --git a/modules/conop/src/compound.hh b/modules/conop/src/compound.hh
index 948cecee588ed3a594ea8775c4524f1d5ff87c4e..1b0eb1cd5e54f80e7d0bcab44a7b88ca0c36c6d2 100644
--- a/modules/conop/src/compound.hh
+++ b/modules/conop/src/compound.hh
@@ -76,17 +76,19 @@ struct DLLEXPORT_OST_CONOP AtomSpec {
alt_name(),
element(),
is_leaving(false),
- is_aromatic()
+ is_aromatic(),
+ charge(0)
{
}
AtomSpec(int o, const String& n, const String& a, const String& e,
- bool l, bool r):
+ bool l, bool r, int c=0):
ordinal(o),
name(n),
alt_name(a),
element(e),
is_leaving(l),
- is_aromatic(r)
+ is_aromatic(r),
+ charge(c)
{}
int ordinal;
String name;
@@ -94,6 +96,7 @@ struct DLLEXPORT_OST_CONOP AtomSpec {
String element;
bool is_leaving;
bool is_aromatic;
+ int charge;
bool operator==(const AtomSpec& rhs) const {
return ordinal==rhs.ordinal && name==rhs.name && alt_name==rhs.alt_name &&
element==rhs.element && is_leaving==rhs.is_leaving &&
@@ -149,6 +152,9 @@ public:
name_(),
inchi_(),
inchi_key_(),
+ smiles_(),
+ replaced_by_(),
+ obsolete_(),
atom_specs_(),
bond_specs_(),
chem_class_(),
@@ -202,6 +208,22 @@ public:
return chem_class_;
}
+ void SetObsolete(bool obsolete) {
+ obsolete_=obsolete;
+ }
+
+ bool GetObsolete() const {
+ return obsolete_;
+ }
+
+ void SetReplacedBy(const String& replaced_by) {
+ replaced_by_=replaced_by;
+ }
+
+ const String& GetReplacedBy() const {
+ return replaced_by_;
+ }
+
void SetChemType(mol::ChemType chem_type) {
chem_type_=chem_type;
}
@@ -252,6 +274,10 @@ public:
const String& GetInchiKey() { return inchi_key_; }
+ void SetSMILES(const String& smiles) { smiles_=smiles; }
+
+ const String& GetSMILES() { return smiles_; }
+
const BondSpecList& GetBondSpecs() const {
return bond_specs_;
}
@@ -281,6 +307,9 @@ private:
String name_;
String inchi_;
String inchi_key_;
+ String smiles_;
+ String replaced_by_;
+ bool obsolete_;
AtomSpecList atom_specs_;
BondSpecList bond_specs_;
mol::ChemClass chem_class_;
diff --git a/modules/conop/src/compound_lib.cc b/modules/conop/src/compound_lib.cc
index 3c434b86b306c807770a4179186574002f64cf48..befb94b4a73bf618d1cd75ec25504cbad2ea6a1a 100644
--- a/modules/conop/src/compound_lib.cc
+++ b/modules/conop/src/compound_lib.cc
@@ -36,6 +36,11 @@ namespace ost { namespace conop {
namespace {
+/*
+This is the oldest version (GetCreationDate) of compound libraries we support.
+*/
+const String COMPAT_VERSION = "1.5.0";
+
/*
COMMENT ON CREATE_CMD
@@ -62,10 +67,19 @@ const char* CREATE_CMD[]={
" pdb_modified TIMESTAMP, "
" name VARCHAR(256), "
" inchi_code TEXT, "
-" inchi_key TEXT "
+" inchi_key TEXT, "
+" smiles TEXT, "
+" obsolete BOOL, "
+" replaced_by VARCHAR(5) "
");",
-" CREATE UNIQUE INDEX IF NOT EXISTS commpound_tlc_index ON chem_compounds "
+" CREATE UNIQUE INDEX IF NOT EXISTS compound_tlc_index ON chem_compounds "
" (tlc, dialect)",
+" CREATE INDEX IF NOT EXISTS compound_smiles_index ON chem_compounds "
+" (smiles, dialect)",
+" CREATE INDEX IF NOT EXISTS compound_inchi_code_index ON chem_compounds "
+" (inchi_code, dialect)",
+" CREATE INDEX IF NOT EXISTS compound_inchi_key_index ON chem_compounds "
+" (inchi_key, dialect)",
"CREATE TABLE IF NOT EXISTS atoms ( "
" id INTEGER PRIMARY KEY AUTOINCREMENT, "
" compound_id INTEGER REFERENCES chem_compounds (id) ON DELETE CASCADE, "
@@ -73,9 +87,9 @@ const char* CREATE_CMD[]={
" alt_name VARCHAR(4) NOT NULL, "
" element VARCHAR(2) NOT NULL, "
" is_aromatic VARCHAR(1) NOT NULL, "
-" stereo_conf VARCHAR(1) NOT NULL, "
" is_leaving VARCHAR(1) NOT NULL, "
-" ordinal INT "
+" ordinal INT, "
+" charge INT "
");",
" CREATE INDEX IF NOT EXISTS atom_name_index ON atoms "
" (compound_id, name, alt_name)",
@@ -84,8 +98,7 @@ const char* CREATE_CMD[]={
" compound_id INTEGER REFERENCES chem_compounds (id) ON DELETE CASCADE, "
" atom_one INTEGER REFERENCES atoms (id) ON DELETE CASCADE, "
" atom_two INTEGER REFERENCES atoms (id) ON DELETE CASCADE, "
-" bond_order INT, "
-" stereo_conf VARCHAR(1) NOT NULL "
+" bond_order INT "
" );",
" CREATE INDEX IF NOT EXISTS bond_index ON bonds (compound_id)",
" CREATE TRIGGER delete_related_objects "
@@ -98,17 +111,19 @@ const char* CREATE_CMD[]={
const char* INSERT_COMPOUND_STATEMENT="INSERT INTO chem_compounds "
-" (tlc, olc, dialect, chem_class, chem_type, formula, pdb_initial, pdb_modified, name, inchi_code, inchi_key) "
-" VALUES (?, ?, ?, ?, ?, ?, DATE(?), DATE(?), ?, ?, ?)";
+" (tlc, olc, dialect, chem_class, chem_type, formula, pdb_initial, "
+" pdb_modified, name, inchi_code, inchi_key, smiles, obsolete, "
+" replaced_by) "
+" VALUES (?, ?, ?, ?, ?, ?, DATE(?), DATE(?), ?, ?, ?, ?, ?, ?)";
const char* INSERT_ATOM_STATEMENT="INSERT INTO atoms "
-" (compound_id, name, alt_name, element, is_aromatic, stereo_conf, "
-" is_leaving, ordinal) "
+" (compound_id, name, alt_name, element, is_aromatic, "
+" is_leaving, ordinal, charge) "
" VALUES (?, ?, ?, ?, ?, ?, ?, ?)";
const char* INSERT_BOND_STATEMENT="insert into bonds "
-" (compound_id, atom_one, atom_two, bond_order, stereo_conf) "
-" VALUES (?, ?, ?, ?, ?)";
+" (compound_id, atom_one, atom_two, bond_order) "
+" VALUES (?, ?, ?, ?)";
const char* INSERT_CHEMLIB_INFO_STATEMENT="insert into chemlib_info "
" (creation_date, ost_version_used) "
@@ -262,6 +277,13 @@ void CompoundLib::AddCompound(const CompoundPtr& compound)
compound->GetInchi().length(), NULL);
sqlite3_bind_text(stmt, 11, compound->GetInchiKey().c_str(),
compound->GetInchiKey().length(), NULL);
+ sqlite3_bind_text(stmt, 12, compound->GetSMILES().c_str(),
+ compound->GetSMILES().length(), NULL);
+ sqlite3_bind_int(stmt, 13, compound->GetObsolete());
+ if (compound->GetReplacedBy() != "") {
+ sqlite3_bind_text(stmt, 14, compound->GetReplacedBy().c_str(),
+ compound->GetReplacedBy().length(), NULL);
+ }
} else {
LOG_ERROR(sqlite3_errmsg(db_->ptr));
sqlite3_finalize(stmt);
@@ -292,11 +314,13 @@ void CompoundLib::AddCompound(const CompoundPtr& compound)
a.alt_name.length(), NULL);
sqlite3_bind_text(stmt, 4, a.element.c_str(), a.element.length(), NULL);
sqlite3_bind_int(stmt, 5, a.is_aromatic);
- sqlite3_bind_int(stmt, 6, 0);
- sqlite3_bind_int(stmt, 7, a.is_leaving);
- sqlite3_bind_int(stmt, 8, a.ordinal);
+ sqlite3_bind_int(stmt, 6, a.is_leaving);
+ sqlite3_bind_int(stmt, 7, a.ordinal);
+ sqlite3_bind_int(stmt, 8, a.charge);
retval=sqlite3_step(stmt);
- assert(retval==SQLITE_DONE);
+ if (retval != SQLITE_DONE) {
+ LOG_ERROR(sqlite3_errmsg(db_->ptr));
+ }
atom_ids[a.ordinal]=sqlite3_last_insert_rowid(db_->ptr);
} else {
LOG_ERROR(sqlite3_errmsg(db_->ptr));
@@ -313,9 +337,10 @@ void CompoundLib::AddCompound(const CompoundPtr& compound)
sqlite3_bind_int64(stmt, 2, atom_ids[b.atom_one]);
sqlite3_bind_int64(stmt, 3, atom_ids[b.atom_two]);
sqlite3_bind_int(stmt, 4, b.order);
- sqlite3_bind_int(stmt, 5, 0);
retval=sqlite3_step(stmt);
- assert(retval==SQLITE_DONE);
+ if (retval != SQLITE_DONE) {
+ LOG_ERROR(sqlite3_errmsg(db_->ptr));
+ };
} else {
LOG_ERROR(sqlite3_errmsg(db_->ptr));
}
@@ -384,37 +409,69 @@ CompoundLibPtr CompoundLib::Load(const String& database, bool readonly)
LOG_ERROR(sqlite3_errmsg(lib->db_->ptr));
return CompoundLibPtr();
}
- // check if column chem_type exists in database
- String aq="SELECT chem_type FROM chem_compounds LIMIT 1";
+ String aq;
sqlite3_stmt* stmt;
+ // check if SMILES are available
+ aq="SELECT smiles FROM chem_compounds LIMIT 1";
retval=sqlite3_prepare_v2(lib->db_->ptr, aq.c_str(),
static_cast<int>(aq.length()),
&stmt, NULL);
- lib->chem_type_available_ = retval==SQLITE_OK;
+ lib->smiles_available_ = retval==SQLITE_OK;
sqlite3_finalize(stmt);
- aq="SELECT name FROM chem_compounds LIMIT 1";
+
+ // check if obsolete info are available
+ aq="SELECT obsolete, replaced_by FROM chem_compounds LIMIT 1";
retval=sqlite3_prepare_v2(lib->db_->ptr, aq.c_str(),
static_cast<int>(aq.length()),
&stmt, NULL);
- lib->name_available_ = retval==SQLITE_OK;
+ lib->obsolete_available_ = retval==SQLITE_OK;
sqlite3_finalize(stmt);
- // check if InChIs are available
- aq="SELECT inchi_code FROM chem_compounds LIMIT 1";
+
+ // check if charges are available
+ aq="SELECT charge FROM atoms LIMIT 1";
retval=sqlite3_prepare_v2(lib->db_->ptr, aq.c_str(),
static_cast<int>(aq.length()),
&stmt, NULL);
- lib->inchi_available_ = retval==SQLITE_OK;
+ lib->charges_available_ = retval==SQLITE_OK;
sqlite3_finalize(stmt);
lib->creation_date_ = lib->GetCreationDate();
lib->ost_version_used_ = lib->GetOSTVersionUsed();
+
+ // Report compatibility issues
+ if (lib->ost_version_used_.compare(COMPAT_VERSION) < 0) {
+ std::stringstream ss;
+ ss << "Compound lib was created with an unsupported version of OST: "
+ << lib->ost_version_used_
+ << ". Please update your compound library.";
+ throw ost::Error(ss.str());
+ }
+ if (!lib->smiles_available_) {
+ LOG_WARNING("SMILES not available in compound library v."
+ << lib->ost_version_used_
+ << ". Only empty strings will be returned.");
+ }
+ if (!lib->obsolete_available_) {
+ LOG_WARNING("Obsolete information not available in compound library v."
+ << lib->ost_version_used_
+ << ". No compound will be marked as obsolete.");
+ }
+ if (!lib->charges_available_) {
+ LOG_WARNING("Charges not available in compound library v."
+ << lib->ost_version_used_
+ << ". All charges will be 0.");
+ }
return lib;
}
void CompoundLib::LoadAtomsFromDB(CompoundPtr comp, int pk) const {
- String aq=str(format("SELECT name, alt_name, element, ordinal, is_leaving "
- "FROM atoms WHERE compound_id=%d "
- "ORDER BY ordinal ASC") % pk);
+ String aq="SELECT name, alt_name, element, ordinal, is_leaving";
+ if (charges_available_) {
+ aq+=", charge";
+ }
+ aq = str(format(aq +
+ " FROM atoms WHERE compound_id=%d"
+ " ORDER BY ordinal ASC") % pk);
sqlite3_stmt* stmt;
int retval=sqlite3_prepare_v2(db_->ptr, aq.c_str(),
static_cast<int>(aq.length()),
@@ -428,6 +485,9 @@ void CompoundLib::LoadAtomsFromDB(CompoundPtr comp, int pk) const {
atom_sp.element=String(reinterpret_cast<const char*>(sqlite3_column_text(stmt, 2)));
atom_sp.ordinal=sqlite3_column_int(stmt, 3);
atom_sp.is_leaving=bool(sqlite3_column_int(stmt, 4)!=0);
+ if (charges_available_) {
+ atom_sp.charge=sqlite3_column_int(stmt, 5);
+ }
comp->AddAtom(atom_sp);
}
} else {
@@ -464,32 +524,144 @@ void CompoundLib::LoadBondsFromDB(CompoundPtr comp, int pk) const {
sqlite3_finalize(stmt);
}
+String CompoundLib::BuildFindCompoundQuery(const String& id,
+ Compound::Dialect dialect,
+ const String& by) const {
+
+ // Build the query
+ String query="SELECT id, tlc, olc, chem_class, dialect, formula, chem_type, name, inchi_code, inchi_key";
+ if(smiles_available_) {
+ query+=", smiles";
+ }
+ if(obsolete_available_) {
+ query+=", obsolete, replaced_by";
+ }
+ query+=" FROM chem_compounds"
+ " WHERE " + by + "=? AND dialect='"+String(1, char(dialect))+"'";
+
+ return query;
+}
+
+CompoundPtr CompoundLib::LoadCompoundFromDB(sqlite3_stmt* stmt) const {
+ int pk=sqlite3_column_int(stmt, 0);
+ const char* id=reinterpret_cast<const char*>(sqlite3_column_text(stmt, 1));
+ CompoundPtr compound(new Compound(id));
+ compound->SetOneLetterCode((sqlite3_column_text(stmt, 2))[0]);
+ compound->SetChemClass(mol::ChemClass(sqlite3_column_text(stmt, 3)[0]));
+ compound->SetDialect(Compound::Dialect(sqlite3_column_text(stmt, 4)[0]));
+ const char* f=reinterpret_cast<const char*>(sqlite3_column_text(stmt, 5));
+ compound->SetFormula(f);
+ compound->SetChemType(mol::ChemType(sqlite3_column_text(stmt, 6)[0]));
+ const char* name=reinterpret_cast<const char*>(sqlite3_column_text(stmt, 7));
+ compound->SetName(name);
+ const char* inchi_code=reinterpret_cast<const char*>(sqlite3_column_text(stmt, 8));
+ if (inchi_code) {
+ compound->SetInchi(inchi_code);
+ }
+ const char* inchi_key=reinterpret_cast<const char*>(sqlite3_column_text(stmt, 9));
+ if (inchi_key) {
+ compound->SetInchiKey(inchi_key);
+ }
+ int next_column = 10;
+ if (smiles_available_) {
+ const char* smiles=reinterpret_cast<const char*>(sqlite3_column_text(stmt, next_column));
+ next_column++;
+ if (smiles) {
+ compound->SetSMILES(smiles);
+ }
+ }
+ if (obsolete_available_) {
+ bool obsolete=sqlite3_column_int(stmt, next_column);
+ compound->SetObsolete(obsolete);
+ next_column++;
+ const char* replaced_by=reinterpret_cast<const char*>(sqlite3_column_text(stmt, next_column));
+ next_column++;
+ if (replaced_by) {
+ compound->SetReplacedBy(replaced_by);
+ }
+ }
+
+ // Load atoms and bonds
+ this->LoadAtomsFromDB(compound, pk);
+ this->LoadBondsFromDB(compound, pk);
+
+ return compound;
+}
+
+
+CompoundPtrList CompoundLib::FindCompounds(const String& query,
+ const String& by,
+ Compound::Dialect dialect) const {
+ CompoundPtrList compounds_vec;
+
+ // Validate "by" argument
+ std::set<std::string> allowed_keys{"inchi_code", "inchi_key", "formula"};
+ if(smiles_available_) {
+ allowed_keys.insert("smiles");
+ }
+ if (allowed_keys.find(by) == allowed_keys.end()) {
+ std::stringstream msg;
+ msg << "Invalid 'by' key: " << by;
+ throw ost::Error(msg.str());
+ }
+
+ String sql_query = BuildFindCompoundQuery(query, dialect, by);
+
+ if(obsolete_available_) {
+ // Prefer active compounds, then the ones with a replacement
+ sql_query += " ORDER BY obsolete, replaced_by IS NULL";
+ }
+
+ // Run the query
+ sqlite3_stmt* stmt;
+ int retval=sqlite3_prepare_v2(db_->ptr, sql_query.c_str(),
+ static_cast<int>(sql_query.length()),
+ &stmt, NULL);
+ sqlite3_bind_text(stmt, 1, query.c_str(),
+ strlen(query.c_str()), NULL);
+
+ if (SQLITE_OK==retval) {
+ int ret=sqlite3_step(stmt);
+ if (SQLITE_DONE==ret) {
+ sqlite3_finalize(stmt);
+ return compounds_vec; // Empty
+ }
+ while (SQLITE_ROW==ret) {
+ CompoundPtr compound = LoadCompoundFromDB(stmt);
+ compounds_vec.push_back(compound);
+ // next row
+ ret=sqlite3_step(stmt);
+ }
+ assert(SQLITE_DONE==ret);
+ } else {
+ LOG_ERROR("ERROR: " << sqlite3_errmsg(db_->ptr));
+ sqlite3_finalize(stmt);
+ return compounds_vec; // empty
+ }
+ sqlite3_finalize(stmt);
+ return compounds_vec;
+}
+
CompoundPtr CompoundLib::FindCompound(const String& id,
Compound::Dialect dialect) const {
- CompoundMap::const_iterator i=compound_cache_.find(id);
+ // Check cache
+ String cache_key = id;
+ CompoundMap::const_iterator i=compound_cache_.find(cache_key);
if (i!=compound_cache_.end()) {
+ LOG_DEBUG("Retrieved compound " << cache_key << " from cache");
return i->second;
}
- String query="SELECT id, tlc, olc, chem_class, dialect, formula";
- int col_offset = 0;
- if(chem_type_available_) {
- query+=", chem_type";
- col_offset+=1;
- if(name_available_) {
- query+=", name";
- col_offset+=1;
- }
- }
- if(inchi_available_) {
- query+=", inchi_code, inchi_key";
- }
- query+=" FROM chem_compounds"
- " WHERE tlc='"+id+"' AND dialect='"+String(1, char(dialect))+"'";
+ String query = BuildFindCompoundQuery(id, dialect, "tlc");
+
+ // Run the query
sqlite3_stmt* stmt;
int retval=sqlite3_prepare_v2(db_->ptr, query.c_str(),
static_cast<int>(query.length()),
&stmt, NULL);
+ sqlite3_bind_text(stmt, 1, id.c_str(),
+ strlen(id.c_str()), NULL);
+
if (SQLITE_OK==retval) {
int ret=sqlite3_step(stmt);
if (SQLITE_DONE==ret) {
@@ -497,37 +669,8 @@ CompoundPtr CompoundLib::FindCompound(const String& id,
return CompoundPtr();
}
if (SQLITE_ROW==ret) {
- int pk=sqlite3_column_int(stmt, 0);
- const char* id=reinterpret_cast<const char*>(sqlite3_column_text(stmt, 1));
- CompoundPtr compound(new Compound(id));
- compound->SetOneLetterCode((sqlite3_column_text(stmt, 2))[0]);
- compound->SetChemClass(mol::ChemClass(sqlite3_column_text(stmt, 3)[0]));
- compound->SetDialect(Compound::Dialect(sqlite3_column_text(stmt, 4)[0]));
- const char* f=reinterpret_cast<const char*>(sqlite3_column_text(stmt, 5));
- compound->SetFormula(f);
- if(chem_type_available_) {
- compound->SetChemType(mol::ChemType(sqlite3_column_text(stmt, 6)[0]));
- }
- if (name_available_) {
- const char* name=reinterpret_cast<const char*>(sqlite3_column_text(stmt, 7));
- if (name) {
- compound->SetName(name);
- }
- }
- if (inchi_available_) {
- const char* inchi_code=reinterpret_cast<const char*>(sqlite3_column_text(stmt, 6+col_offset));
- if (inchi_code) {
- compound->SetInchi(inchi_code);
- }
- const char* inchi_key=reinterpret_cast<const char*>(sqlite3_column_text(stmt, 6+col_offset+1));
- if (inchi_key) {
- compound->SetInchiKey(inchi_key);
- }
- }
- // Load atoms and bonds
- this->LoadAtomsFromDB(compound, pk);
- this->LoadBondsFromDB(compound, pk);
- compound_cache_.insert(std::make_pair(compound->GetID(), compound));
+ CompoundPtr compound = LoadCompoundFromDB(stmt);
+ compound_cache_.insert(std::make_pair(cache_key, compound));
sqlite3_finalize(stmt);
return compound;
}
@@ -545,9 +688,9 @@ CompoundLib::CompoundLib():
CompoundLibBase(),
db_(new Database),
compound_cache_(),
- chem_type_available_(false),
- name_available_(),
- inchi_available_(),
+ smiles_available_(),
+ obsolete_available_(),
+ charges_available_(),
creation_date_(),
ost_version_used_() { }
diff --git a/modules/conop/src/compound_lib.hh b/modules/conop/src/compound_lib.hh
index 2199c1c60511fb46eb6b8ed6c086332751fc7fae..3b7d50b674fee7319b483de131c86b9bc7e5657c 100644
--- a/modules/conop/src/compound_lib.hh
+++ b/modules/conop/src/compound_lib.hh
@@ -21,6 +21,7 @@
#include <map>
#include <boost/shared_ptr.hpp>
+#include <sqlite3.h>
#include "module_config.hh"
#include "compound.hh"
@@ -31,6 +32,7 @@ namespace ost { namespace conop {
class CompoundLib;
typedef boost::shared_ptr<CompoundLib> CompoundLibPtr;
+typedef std::vector<CompoundPtr> CompoundPtrList;
class DLLEXPORT_OST_CONOP CompoundLib : public CompoundLibBase {
public:
@@ -40,6 +42,9 @@ public:
virtual CompoundPtr FindCompound(const String& id,
Compound::Dialect dialect) const;
+ virtual CompoundPtrList FindCompounds(const String& query,
+ const String& by,
+ Compound::Dialect dialect) const;
void AddCompound(const CompoundPtr& compound);
CompoundLibPtr Copy(const String& filename) const;
void ClearCache();
@@ -50,14 +55,18 @@ private:
CompoundLib();
void LoadAtomsFromDB(CompoundPtr comp, int pk) const;
- void LoadBondsFromDB(CompoundPtr comp, int pk) const;
+ void LoadBondsFromDB(CompoundPtr comp, int pk) const;
+ String BuildFindCompoundQuery(const String& id,
+ Compound::Dialect dialect,
+ const String& by) const;
+ CompoundPtr LoadCompoundFromDB(sqlite3_stmt* stmt) const;
private:
struct Database;
Database* db_;
mutable CompoundMap compound_cache_;
- bool chem_type_available_; // wether pdbx_type is available in db
- bool name_available_; // wether name is available in db
- bool inchi_available_; //whether inchi is available in db
+ bool smiles_available_; //whether smiles are available in db - introduced in 2.6.0
+ bool obsolete_available_; //whether obsolete info is available in db - introduced in 2.6.0
+ bool charges_available_; //whether atom charges are available in db - introduced in 2.6.0
Date creation_date_;
String ost_version_used_;
};
diff --git a/modules/conop/src/processor.cc b/modules/conop/src/processor.cc
index 840c8b4a798e031e92e2bc94e2574e23aded46d4..e3206b0b478cc0e56f4194bf8ef2799876f7f876 100644
--- a/modules/conop/src/processor.cc
+++ b/modules/conop/src/processor.cc
@@ -327,10 +327,10 @@ void Processor::ReorderAtoms(mol::ResidueHandle residue,
mol::impl::AtomImplList::iterator i=impl->GetAtomList().begin();
for (; i!=impl->GetAtomList().end(); ++i) {
mol::impl::AtomImplPtr atom=*i;
- atom->SetState(std::numeric_limits<unsigned int>::max());
+ atom->SetState(std::numeric_limits<int>::max());
int index=compound->GetAtomSpecIndex(atom->GetName());
if (index==-1) {
- atom->SetState(std::numeric_limits<unsigned int>::max());
+ atom->SetState(std::numeric_limits<int>::max());
continue;
}
atom->SetState((compound->GetAtomSpecs())[index].ordinal);
@@ -350,7 +350,7 @@ bool Processor::HasUnknownAtoms(mol::ResidueHandle res,
mol::AtomHandleList atoms=res.GetAtomList();
for (mol::AtomHandleList::iterator
i=atoms.begin(), e=atoms.end(); i!=e; ++i) {
- if ((*i).Impl()->GetState()==std::numeric_limits<unsigned int>::max()) {
+ if ((*i).Impl()->GetState()==std::numeric_limits<int>::max()) {
if (((*i).GetElement()=="H" || (*i).GetElement()=="D") &&
!strict_hydrogens) {
continue;
diff --git a/modules/conop/tests/CMakeLists.txt b/modules/conop/tests/CMakeLists.txt
index d8c617147a03bb777a72b0aaf2969c5198d3b02c..e8a1fc4ce12cb26cbf2acdc61a1889746947c6d5 100644
--- a/modules/conop/tests/CMakeLists.txt
+++ b/modules/conop/tests/CMakeLists.txt
@@ -5,12 +5,12 @@ set(OST_CONOP_UNIT_TESTS
test_rule_based_conop.cc
helper.cc
test_processor.py
+ test_complib.py
)
if (COMPOUND_LIB)
list(APPEND OST_CONOP_UNIT_TESTS test_compound.py
- test_cleanup.py
- test_complib.py)
+ test_cleanup.py)
endif()
ost_unittest(MODULE conop
diff --git a/modules/conop/tests/test_complib.py b/modules/conop/tests/test_complib.py
index 2c3e3f8121c2ea6d678a1edf67b9e0fbf1469dbf..9de009afd945b9e3e89a9674f872d2b5ce0bba53 100644
--- a/modules/conop/tests/test_complib.py
+++ b/modules/conop/tests/test_complib.py
@@ -3,23 +3,30 @@ import ost
from ost import conop
import subprocess
import tempfile
+import warnings
class TestCompLib(unittest.TestCase):
- def test_three_vs_five_letter_code(self):
-
+ @classmethod
+ def setUpClass(cls):
prefix_path = ost.GetPrefixPath()
chemdict_tool_path = os.path.join(prefix_path, "bin", "chemdict_tool")
if not os.path.exists(chemdict_tool_path):
raise RuntimeError("Expect chemdict_tool:", chemdict_tool_path)
- tmp_dir = tempfile.TemporaryDirectory()
+ cls.tmp_dir = tempfile.TemporaryDirectory()
compounds_path = os.path.join("testfiles", "test_compounds.cif")
- complib_path = os.path.join(tmp_dir.name, "test_complib.dat")
+ complib_path = os.path.join(cls.tmp_dir.name, "test_complib.dat")
cmd = [chemdict_tool_path, "create", compounds_path, complib_path]
subprocess.run(cmd)
+ cls.complib = conop.CompoundLib.Load(complib_path)
+
+ @classmethod
+ def tearDownClass(cls):
+ cls.tmp_dir.cleanup()
- complib = conop.CompoundLib.Load(complib_path)
+ def test_three_vs_five_letter_code(self):
+ complib = self.complib
comp_001 = complib.FindCompound("001")
comp_hello = complib.FindCompound("hello")
@@ -29,9 +36,39 @@ class TestCompLib(unittest.TestCase):
self.assertFalse(comp_hello is None)
self.assertTrue(comp_yolo is None)
+ def test_smiles(self):
+ complib = self.complib
+ comp_001 = complib.FindCompound("001")
+ self.assertTrue(comp_001.smiles == "COc1cc(cc(c1OC)OC)C(C(=O)N2CCCC[C@H]2C(=O)O[C@@H](CCCc3ccccc3)CCCc4cccnc4)(F)F")
+
+ def test_charges(self):
+ complib = self.complib
+ comp_nh4 = complib.FindCompound("NH4")
+ self.assertTrue(comp_nh4.atom_specs[0].charge == 1)
+ self.assertTrue(comp_nh4.atom_specs[1].charge == 0)
+
+ def test_obsolete(self):
+ complib = self.complib
+ comp_ox = complib.FindCompound("OX")
+ # First test that we do get data
+ self.assertTrue(comp_ox.smiles == "O")
+ # Now the obsolete part
+ self.assertTrue(comp_ox.obsolete)
+ self.assertTrue(comp_ox.replaced_by == "O")
+ # Ensure not everything is obsolete
+ comp_001 = complib.FindCompound("001")
+ self.assertFalse(comp_001.obsolete)
+
+ def test_default_lib_version(self):
+ compound_lib = conop.GetDefaultLib()
+ if compound_lib is None:
+ warnings.warn("Compound library not available. Some functionality may not work as expected.")
+ else:
+ lib_version = compound_lib.GetOSTVersionUsed()
+ if lib_version < ost.__version__:
+ warnings.warn("Using old version of the compound library: %s" % lib_version)
+
+
if __name__ == "__main__":
from ost import testutils
- if testutils.DefaultCompoundLibIsSet():
- testutils.RunTests()
- else:
- print('No compound lib available. Ignoring test_complib tests.')
\ No newline at end of file
+ testutils.RunTests()
diff --git a/modules/conop/tests/test_compound.py b/modules/conop/tests/test_compound.py
index a6c704d408d1c3926a786e3e4f0988b6ddfbfcf2..2158774ce42a12477e7a7ec5a9fbbddcea52a853 100644
--- a/modules/conop/tests/test_compound.py
+++ b/modules/conop/tests/test_compound.py
@@ -1,4 +1,5 @@
import unittest
+
from ost import mol, conop
@@ -19,8 +20,58 @@ class TestCompound(unittest.TestCase):
self.assertEqual(compound.formula, 'C3 H7 N O2')
self.assertEqual(compound.chem_class, mol.L_PEPTIDE_LINKING)
self.assertEqual(compound.inchi,
- "1S/C3H7NO2/c1-2(4)3(5)6/h2H,4H2,1H3,(H,5,6)/t2-/m0/s1")
+ "InChI=1S/C3H7NO2/c1-2(4)3(5)6/h2H,4H2,1H3,(H,5,6)/t2-/m0/s1")
self.assertEqual(compound.inchi_key, "QNAYBMKLOCPYGJ-REOHCLBHSA-N")
+ self.assertEqual(compound.smiles, "C[C@@H](C(=O)O)N" )
+
+ def testFindCompoundsBySMILES(self):
+ """ Test FindCompound by="smiles"."""
+ compounds = self.compound_lib.FindCompounds('O', by="smiles")
+ # Make sure all the compounds have the right smiles
+ for compound in compounds:
+ self.assertNotEqual(compound, None)
+ self.assertEqual(compound.smiles, 'O')
+
+ # Now we should prefer a non-obsolete compound first.
+ # Default ordering has DIS as first pick but FindCompound should sort
+ # active compounds first.
+ # This assumes there are non-obsolete O/HOH compounds in the compound
+ # lib, which should always be the case.
+ self.assertFalse(compounds[0].obsolete)
+
+ def testFindCompoundsByInChI(self):
+ """ Test FindCompound by="inchi_code|key"."""
+ inchi_code = "InChI=1/H2O/h1H2"
+ inchi_key = "XLYOFNOQVPJJNP-UHFFFAOYAF"
+ compounds = self.compound_lib.FindCompounds(inchi_code, by="inchi_code")
+ # Make sure all the compounds have the right inchis
+ for compound in compounds:
+ self.assertNotEqual(compound, None)
+ self.assertEqual(compound.inchi, inchi_code)
+ self.assertEqual(compound.inchi_key, inchi_key)
+
+ compounds = self.compound_lib.FindCompounds(inchi_key, by="inchi_key")
+ # Make sure all the compounds have the right inchis
+ for compound in compounds:
+ self.assertNotEqual(compound, None)
+ self.assertEqual(compound.inchi, inchi_code)
+ self.assertEqual(compound.inchi_key, inchi_key)
+
+ def testFindCompoundsNoResults(self):
+ """Check that FindCompounds returns an empty list if no result is
+ found. """
+ # Searching an InChI code by SMILES can never succeed and
+ # should return an empty list
+ compounds = self.compound_lib.FindCompounds("InChI=1/H2O/h1H2", by="smiles")
+ self.assertEqual(len(compounds), 0)
+
+ def testFindCompoundsInvalidKey(self):
+ """Ensure we don't search by invalid keys"""
+ with self.assertRaises(Exception, msg="smile"):
+ compounds = self.compound_lib.FindCompounds("O", by="smile")
+ # We also don't accept tlc - although this would technically be valid
+ with self.assertRaises(Exception, msg="tlc"):
+ compounds = self.compound_lib.FindCompounds("ALA", by="tlc")
if __name__=='__main__':
diff --git a/modules/conop/tests/testfiles/test_compounds.cif b/modules/conop/tests/testfiles/test_compounds.cif
index 045010ac8a232fc7cc7589f2cd585533076923af..d07ebaf9700c36bfffa0bc68b1b9c48e679f7df6 100644
--- a/modules/conop/tests/testfiles/test_compounds.cif
+++ b/modules/conop/tests/testfiles/test_compounds.cif
@@ -601,4 +601,178 @@ _pdbx_chem_comp_audit.date
_pdbx_chem_comp_audit.processing_site
hello "Create component" 2006-02-02 RCSB
hello "Modify descriptor" 2011-06-04 RCSB
-#
+#
+
+data_NH4
+#
+_chem_comp.id NH4
+_chem_comp.name "AMMONIUM ION"
+_chem_comp.type NON-POLYMER
+_chem_comp.pdbx_type HETAI
+_chem_comp.formula "H4 N"
+_chem_comp.mon_nstd_parent_comp_id ?
+_chem_comp.pdbx_synonyms ?
+_chem_comp.pdbx_formal_charge 1
+_chem_comp.pdbx_initial_date 1999-07-08
+_chem_comp.pdbx_modified_date 2011-06-04
+_chem_comp.pdbx_ambiguous_flag N
+_chem_comp.pdbx_release_status REL
+_chem_comp.pdbx_replaced_by ?
+_chem_comp.pdbx_replaces ?
+_chem_comp.formula_weight 18.038
+_chem_comp.one_letter_code ?
+_chem_comp.three_letter_code NH4
+_chem_comp.pdbx_model_coordinates_details ?
+_chem_comp.pdbx_model_coordinates_missing_flag N
+_chem_comp.pdbx_ideal_coordinates_details ?
+_chem_comp.pdbx_ideal_coordinates_missing_flag N
+_chem_comp.pdbx_model_coordinates_db_code 1SY2
+_chem_comp.pdbx_subcomponent_list ?
+_chem_comp.pdbx_processing_site RCSB
+#
+loop_
+_chem_comp_atom.comp_id
+_chem_comp_atom.atom_id
+_chem_comp_atom.alt_atom_id
+_chem_comp_atom.type_symbol
+_chem_comp_atom.charge
+_chem_comp_atom.pdbx_align
+_chem_comp_atom.pdbx_aromatic_flag
+_chem_comp_atom.pdbx_leaving_atom_flag
+_chem_comp_atom.pdbx_stereo_config
+_chem_comp_atom.model_Cartn_x
+_chem_comp_atom.model_Cartn_y
+_chem_comp_atom.model_Cartn_z
+_chem_comp_atom.pdbx_model_Cartn_x_ideal
+_chem_comp_atom.pdbx_model_Cartn_y_ideal
+_chem_comp_atom.pdbx_model_Cartn_z_ideal
+_chem_comp_atom.pdbx_component_atom_id
+_chem_comp_atom.pdbx_component_comp_id
+_chem_comp_atom.pdbx_ordinal
+NH4 N N N 1 1 N N N 11.106 19.171 34.702 0.000 0.000 0.000 N NH4 1
+NH4 HN1 1HN H 0 1 N N N 12.106 19.171 34.702 -0.385 -0.545 -0.771 HN1 NH4 2
+NH4 HN2 2HN H 0 1 N N N 10.772 19.171 35.645 1.020 0.000 0.000 HN2 NH4 3
+NH4 HN3 3HN H 0 1 N N N 10.773 19.988 34.231 -0.340 0.962 0.000 HN3 NH4 4
+NH4 HN4 4HN H 0 1 N N N 10.773 18.354 34.231 -0.385 -0.545 0.771 HN4 NH4 5
+#
+loop_
+_chem_comp_bond.comp_id
+_chem_comp_bond.atom_id_1
+_chem_comp_bond.atom_id_2
+_chem_comp_bond.value_order
+_chem_comp_bond.pdbx_aromatic_flag
+_chem_comp_bond.pdbx_stereo_config
+_chem_comp_bond.pdbx_ordinal
+NH4 N HN1 SING N N 1
+NH4 N HN2 SING N N 2
+NH4 N HN3 SING N N 3
+NH4 N HN4 SING N N 4
+#
+loop_
+_pdbx_chem_comp_descriptor.comp_id
+_pdbx_chem_comp_descriptor.type
+_pdbx_chem_comp_descriptor.program
+_pdbx_chem_comp_descriptor.program_version
+_pdbx_chem_comp_descriptor.descriptor
+NH4 SMILES ACDLabs 10.04 "[NH4+]"
+NH4 SMILES_CANONICAL CACTVS 3.341 "[NH4+]"
+NH4 SMILES CACTVS 3.341 "[NH4+]"
+NH4 SMILES_CANONICAL "OpenEye OEToolkits" 1.5.0 "[NH4+]"
+NH4 SMILES "OpenEye OEToolkits" 1.5.0 "[NH4+]"
+NH4 InChI InChI 1.03 InChI=1S/H3N/h1H3/p+1
+NH4 InChIKey InChI 1.03 QGZKDVFQNNGYKY-UHFFFAOYSA-O
+#
+loop_
+_pdbx_chem_comp_identifier.comp_id
+_pdbx_chem_comp_identifier.type
+_pdbx_chem_comp_identifier.program
+_pdbx_chem_comp_identifier.program_version
+_pdbx_chem_comp_identifier.identifier
+NH4 "SYSTEMATIC NAME" ACDLabs 10.04 ammonium
+NH4 "SYSTEMATIC NAME" "OpenEye OEToolkits" 1.5.0 azanium
+#
+loop_
+_pdbx_chem_comp_audit.comp_id
+_pdbx_chem_comp_audit.action_type
+_pdbx_chem_comp_audit.date
+_pdbx_chem_comp_audit.processing_site
+NH4 "Create component" 1999-07-08 RCSB
+NH4 "Modify descriptor" 2011-06-04 RCSB
+#
+
+data_OX
+#
+_chem_comp.id OX
+_chem_comp.name "BOUND OXYGEN"
+_chem_comp.type NON-POLYMER
+_chem_comp.pdbx_type HETAIN
+_chem_comp.formula O
+_chem_comp.mon_nstd_parent_comp_id ?
+_chem_comp.pdbx_synonyms ?
+_chem_comp.pdbx_formal_charge 0
+_chem_comp.pdbx_initial_date 1999-07-08
+_chem_comp.pdbx_modified_date 2008-10-14
+_chem_comp.pdbx_ambiguous_flag N
+_chem_comp.pdbx_release_status OBS
+_chem_comp.pdbx_replaced_by O
+_chem_comp.pdbx_replaces ?
+_chem_comp.formula_weight 15.999
+_chem_comp.one_letter_code ?
+_chem_comp.three_letter_code OX
+_chem_comp.pdbx_model_coordinates_details ?
+_chem_comp.pdbx_model_coordinates_missing_flag N
+_chem_comp.pdbx_ideal_coordinates_details ?
+_chem_comp.pdbx_ideal_coordinates_missing_flag N
+_chem_comp.pdbx_model_coordinates_db_code ?
+_chem_comp.pdbx_subcomponent_list ?
+_chem_comp.pdbx_processing_site RCSB
+#
+_chem_comp_atom.comp_id OX
+_chem_comp_atom.atom_id O
+_chem_comp_atom.alt_atom_id O
+_chem_comp_atom.type_symbol O
+_chem_comp_atom.charge 0
+_chem_comp_atom.pdbx_align 1
+_chem_comp_atom.pdbx_aromatic_flag N
+_chem_comp_atom.pdbx_leaving_atom_flag N
+_chem_comp_atom.pdbx_stereo_config N
+_chem_comp_atom.model_Cartn_x 0.000
+_chem_comp_atom.model_Cartn_y 0.000
+_chem_comp_atom.model_Cartn_z 0.000
+_chem_comp_atom.pdbx_model_Cartn_x_ideal -0.064
+_chem_comp_atom.pdbx_model_Cartn_y_ideal 0.000
+_chem_comp_atom.pdbx_model_Cartn_z_ideal 0.000
+_chem_comp_atom.pdbx_component_atom_id O
+_chem_comp_atom.pdbx_component_comp_id OX
+_chem_comp_atom.pdbx_ordinal 1
+#
+loop_
+_pdbx_chem_comp_descriptor.comp_id
+_pdbx_chem_comp_descriptor.type
+_pdbx_chem_comp_descriptor.program
+_pdbx_chem_comp_descriptor.program_version
+_pdbx_chem_comp_descriptor.descriptor
+OX SMILES ACDLabs 10.04 O
+OX InChI InChI 1.02b InChI=1/H2O/h1H2
+OX InChIKey InChI 1.02b XLYOFNOQVPJJNP-UHFFFAOYAF
+OX SMILES_CANONICAL CACTVS 3.341 "[O]"
+OX SMILES CACTVS 3.341 "[O]"
+OX SMILES_CANONICAL "OpenEye OEToolkits" 1.5.0 O
+OX SMILES "OpenEye OEToolkits" 1.5.0 O
+#
+loop_
+_pdbx_chem_comp_identifier.comp_id
+_pdbx_chem_comp_identifier.type
+_pdbx_chem_comp_identifier.program
+_pdbx_chem_comp_identifier.program_version
+_pdbx_chem_comp_identifier.identifier
+OX "SYSTEMATIC NAME" ACDLabs 10.04 water
+OX "SYSTEMATIC NAME" "OpenEye OEToolkits" 1.5.0 oxidane
+#
+loop_
+_pdbx_chem_comp_audit.comp_id
+_pdbx_chem_comp_audit.action_type
+_pdbx_chem_comp_audit.date
+_pdbx_chem_comp_audit.processing_site
+OX "Create component" 1999-07-08 RCSB
+#
diff --git a/modules/doc/actions.rst b/modules/doc/actions.rst
index 8fd2dbab5d4be5f12cc6ae9c0443818fa20e8e44..eee1181a1275a8615c6893dded821d314114bc68 100644
--- a/modules/doc/actions.rst
+++ b/modules/doc/actions.rst
@@ -41,16 +41,17 @@ Details on the usage (output of ``ost compare-structures --help``):
[--cad-score] [--local-cad-score]
[--cad-exec CAD_EXEC]
[--usalign-exec USALIGN_EXEC] [--qs-score]
- [--rigid-scores] [--interface-scores]
+ [--dockq] [--contact-scores] [--rigid-scores]
[--patch-scores] [--tm-score]
[--lddt-no-stereochecks]
-
+ [--n-max-naive N_MAX_NAIVE]
+
Evaluate model against reference
-
+
Example: ost compare-structures -m model.pdb -r reference.cif
-
+
Loads the structures and performs basic cleanup:
-
+
* Assign elements according to the PDB Chemical Component Dictionary
* Map nonstandard residues to their parent residues as defined by the PDB
Chemical Component Dictionary, e.g. phospho-serine => serine
@@ -59,12 +60,12 @@ Details on the usage (output of ``ost compare-structures --help``):
* Remove unknown atoms, i.e. atoms that are not expected according to the PDB
Chemical Component Dictionary
* Select for peptide/nucleotide residues
-
+
The cleaned structures are optionally dumped using -d/--dump-structures
-
+
Output is written in JSON format (default: out.json). In case of no additional
options, this is a dictionary with 8 keys describing model/reference comparison:
-
+
* "reference_chains": Chain names of reference
* "model_chains": Chain names of model
* "chem_groups": Groups of polypeptides/polynucleotides from reference that
@@ -89,10 +90,10 @@ Details on the usage (output of ``ost compare-structures --help``):
* "status": SUCCESS if everything ran through. In case of failure, the only
content of the JSON output will be "status" set to FAILURE and an
additional key: "traceback".
-
+
The following additional keys store relevant input parameters to reproduce
results:
-
+
* "model"
* "reference"
* "fault_tolerant"
@@ -103,22 +104,22 @@ Details on the usage (output of ``ost compare-structures --help``):
* "cad_exec"
* "usalign_exec"
* "lddt_no_stereochecks"
-
+
The pairwise sequence alignments are computed with Needleman-Wunsch using
BLOSUM62 (NUC44 for nucleotides). Many benchmarking scenarios preprocess the
structures to ensure matching residue numbers (CASP/CAMEO). In these cases,
enabling -rna/--residue-number-alignment is recommended.
-
+
Each score is opt-in and can be enabled with optional arguments.
-
+
Example to compute global and per-residue lDDT values as well as QS-score:
-
+
ost compare-structures -m model.pdb -r reference.cif --lddt --local-lddt --qs-score
-
+
Example to inject custom chain mapping
-
+
ost compare-structures -m model.pdb -r reference.cif -c A:B B:A
-
+
optional arguments:
-h, --help show this help message and exit
-m MODEL, --model MODEL
@@ -218,7 +219,88 @@ Details on the usage (output of ``ost compare-structures --help``):
given, an OpenStructure internal copy of USalign code
is used.
--qs-score Compute QS-score, stored as key "qs_global", and the
- QS-best variant, stored as key "qs_best".
+ QS-best variant, stored as key "qs_best". Interfaces
+ in the reference with non-zero contribution to QS-
+ score are available as key "qs_reference_interfaces",
+ the ones from the model as key "qs_model_interfaces".
+ "qs_interfaces" is a subset of
+ "qs_reference_interfaces" that contains interfaces
+ that can be mapped to the model. They are stored as
+ lists in format [ref_ch1, ref_ch2, mdl_ch1, mdl_ch2].
+ The respective per-interface scores for
+ "qs_interfaces" are available as keys
+ "per_interface_qs_global" and "per_interface_qs_best"
+ --dockq Compute DockQ scores and its components. Relevant
+ interfaces with at least one contact (any atom within
+ 5A) of the reference structure are available as key
+ "dockq_reference_interfaces". Only interfaces between
+ peptide chains are considered here! Key
+ "dockq_interfaces" is a subset of
+ "dockq_reference_interfaces" that contains interfaces
+ that can be mapped to the model. They are stored as
+ lists in format [ref_ch1, ref_ch2, mdl_ch1, mdl_ch2].
+ The respective DockQ scores for "dockq_interfaces" are
+ available as key "dockq". It's components are
+ available as keys: "fnat" (fraction of reference
+ contacts which are also there in model) "irmsd"
+ (interface RMSD), "lrmsd" (ligand RMSD). The DockQ
+ score is strictly designed to score each interface
+ individually. We also provide two averaged versions to
+ get one full model score: "dockq_ave", "dockq_wave".
+ The first is simply the average of "dockq_scores", the
+ latter is a weighted average with weights derived from
+ number of contacts in the reference interfaces. These
+ two scores only consider interfaces that are present
+ in both, the model and the reference. "dockq_ave_full"
+ and "dockq_wave_full" add zeros in the average
+ computation for each interface that is only present in
+ the reference but not in the model.
+ --ics Computes interface contact similarity (ICS) related
+ scores. A contact between two residues of different
+ chains is defined as having at least one heavy atom
+ within 5A. Contacts in reference structure are
+ available as key "reference_contacts". Each contact
+ specifies the interacting residues in format
+ "<cname>.<rnum>.<ins_code>". Model contacts are
+ available as key "model_contacts". The precision which
+ is available as key "ics_precision" reports the
+ fraction of model contacts that are also present in
+ the reference. The recall which is available as key
+ "ics_recall" reports the fraction of reference
+ contacts that are correctly reproduced in the model.
+ The ICS score (Interface Contact Similarity) available
+ as key "ics" combines precision and recall using the
+ F1-measure. All these measures are also available on a
+ per-interface basis for each interface in the
+ reference structure that are defined as chain pairs
+ with at least one contact (available as key
+ "contact_reference_interfaces"). The respective
+ metrics are available as keys
+ "per_interface_ics_precision",
+ "per_interface_ics_recall" and "per_interface_ics".
+ --ips Computes interface patch similarity (IPS) related
+ scores. They focus on interface residues. They are
+ defined as having at least one contact to a residue
+ from any other chain. In short: if they show up in the
+ contact lists used to compute ICS. If ips is enabled,
+ these contacts get reported too and are available as
+ keys "reference_contacts" and "model_contacts".The
+ precision which is available as key "ips_precision"
+ reports the fraction of model interface residues, that
+ are also interface residues in the reference. The
+ recall which is available as key "ips_recall" reports
+ the fraction of reference interface residues that are
+ also interface residues in the model. The IPS score
+ (Interface Patch Similarity) available as key "ips" is
+ the Jaccard coefficient between interface residues in
+ reference and model. All these measures are also
+ available on a per-interface basis for each interface
+ in the reference structure that are defined as chain
+ pairs with at least one contact (available as key
+ "contact_reference_interfaces"). The respective
+ metrics are available as keys
+ "per_interface_ips_precision",
+ "per_interface_ips_recall" and "per_interface_ips".
--rigid-scores Computes rigid superposition based scores. They're
based on a Kabsch superposition of all mapped CA
positions (C3' for nucleotides). Makes the following
@@ -229,33 +311,6 @@ Details on the usage (output of ``ost compare-structures --help``):
these positions and transformation, "transform": the
used 4x4 transformation matrix that superposes model
onto reference.
- --interface-scores Per interface scores for each interface that has at
- least one contact in the reference, i.e. at least one
- pair of heavy atoms within 5A. The respective
- interfaces are available from key "interfaces" which
- is a list of tuples in form (ref_ch1, ref_ch2,
- mdl_ch1, mdl_ch2). Per-interface scores are available
- as lists referring to these interfaces and have the
- following keys: "nnat" (number of contacts in
- reference), "nmdl" (number of contacts in model),
- "fnat" (fraction of reference contacts which are also
- there in model), "fnonnat" (fraction of model contacts
- which are not there in target), "irmsd" (interface
- RMSD), "lrmsd" (ligand RMSD), "dockq_scores" (per-
- interface score computed from "fnat", "irmsd" and
- "lrmsd"), "interface_qs_global" and
- "interface_qs_best" (per-interface versions of the two
- QS-score variants). The DockQ score is strictly
- designed to score each interface individually. We also
- provide two averaged versions to get one full model
- score: "dockq_ave", "dockq_wave". The first is simply
- the average of "dockq_scores", the latter is a
- weighted average with weights derived from "nnat".
- These two scores only consider interfaces that are
- present in both, the model and the reference.
- "dockq_ave_full" and "dockq_wave_full" add zeros in
- the average computation for each interface that is
- only present in the reference but not in the model.
--patch-scores Local interface quality score used in CASP15. Scores
each model residue that is considered in the interface
(CB pos within 8A of any CB pos from another chain (CA
@@ -277,7 +332,25 @@ Details on the usage (output of ``ost compare-structures --help``):
"usalign_mapping"
--lddt-no-stereochecks
Disable stereochecks for lDDT computation
-
+ --n-max-naive N_MAX_NAIVE
+ Parameter for chain mapping. If the number of possible
+ mappings is <= *n_max_naive*, the full mapping
+ solution space is enumerated to find the the mapping
+ with optimal QS-score. A heuristic is used otherwise.
+ The default of 40320 corresponds to an octamer (8! =
+ 40320). A structure with stoichiometry A6B2 would be
+ 6!*2! = 1440 etc.
+ --dump-aligned-residues
+ Dump additional info on aligned model and reference
+ residues.
+ --dump-pepnuc-alns Dump alignments of mapped chains but with sequences
+ that did not undergo Molck preprocessing in the
+ scorer. Sequences are extracted from model/target
+ after undergoing selection for peptide and nucleotide
+ residues.
+ --dump-pepnuc-aligned-residues
+ Dump additional info on model and reference residues
+ that occur in pepnuc alignments.
.. _ost compare ligand structures:
@@ -295,15 +368,14 @@ Details on the usage (output of ``ost compare-ligand-structures --help``):
.. code-block:: console
usage: ost compare-ligand-structures [-h] -m MODEL [-ml [MODEL_LIGANDS ...]]
- -r REFERENCE
- [-rl [REFERENCE_LIGANDS ...]]
- [-o OUTPUT] [-mf {pdb,mmcif,cif}]
- [-rf {pdb,mmcif,cif}] [-ft] [-rna] [-ec]
- [-sm] [--lddt-pli] [--rmsd]
- [--radius RADIUS]
- [--lddt-pli-radius LDDT_PLI_RADIUS]
- [--lddt-bs-radius LDDT_BS_RADIUS]
- [-v VERBOSITY]
+ -r REFERENCE [-rl [REFERENCE_LIGANDS ...]]
+ [-o OUTPUT] [-mf {pdb,mmcif,cif}]
+ [-rf {pdb,mmcif,cif}] [-ft] [-rna] [-ec] [-sm]
+ [-gcm] [-c CHAIN_MAPPING [CHAIN_MAPPING ...]]
+ [-ra] [--lddt-pli] [--rmsd] [--radius RADIUS]
+ [--lddt-pli-radius LDDT_PLI_RADIUS]
+ [--lddt-lp-radius LDDT_LP_RADIUS]
+ [-v VERBOSITY] [--n-max-naive N_MAX_NAIVE]
Evaluate model with non-polymer/small molecule ligands against reference.
@@ -342,19 +414,20 @@ Details on the usage (output of ``ost compare-ligand-structures --help``):
* "model_ligands": A list of ligands in the model. If ligands were provided
explicitly with --model-ligands, elements of the list will be the paths to
- the ligand SDF file(s). Otherwise, they will be the chain name and residue
- number of the ligand, separated by a dot.
+ the ligand SDF file(s). Otherwise, they will be the chain name, residue
+ number and insertion code of the ligand, separated by a dot.
* "reference_ligands": A list of ligands in the reference. If ligands were
provided explicitly with --reference-ligands, elements of the list will be
- the paths to the ligand SDF file(s). Otherwise, they will be the chain name
- and residue number of the ligand, separated by a dot.
+ the paths to the ligand SDF file(s). Otherwise, they will be the chain name,
+ residue number and insertion code of the ligand, separated by a dot.
* "status": SUCCESS if everything ran through. In case of failure, the only
content of the JSON output will be "status" set to FAILURE and an
additional key: "traceback".
Each score is opt-in and, be enabled with optional arguments and is added
to the output. Keys correspond to the values in "model_ligands" above.
- Only assigned mapped ligands are reported.
+ Unassigned ligands are reported with a message in
+ "unassigned_model_ligands" and "unassigned_reference_ligands".
options:
-h, --help show this help message and exit
@@ -396,17 +469,37 @@ Details on the usage (output of ``ost compare-ligand-structures --help``):
the selected mapping are reported.
-sm, --substructure-match
Allow incomplete target ligands.
+ -gcm, --global-chain-mapping
+ Use a global chain mapping.
+ -c CHAIN_MAPPING [CHAIN_MAPPING ...],
+ --chain-mapping CHAIN_MAPPING [CHAIN_MAPPING ...]
+ Custom mapping of chains between the reference and
+ the model. Each separate mapping consist of key:value
+ pairs where key is the chain name in reference and
+ value is the chain name in model. Only has an effect
+ if global-chain-mapping flag is set.
+ -ra, --rmsd-assignment
+ Use RMSD for ligand assignment.
+ -u, --unassigned Report unassigned model ligands in the output
+ together with assigned ligands, with a null score,
+ and reason for not being assigned.
+
--lddt-pli Compute lDDT-PLI score and store as key "lddt-pli".
--rmsd Compute RMSD score and store as key "rmsd".
--radius RADIUS Inclusion radius for the binding site. Any residue
- with atoms within this distance of the ligand will be
- included in the binding site.
+ with atoms within this distance of the ligand will
+ be included in the binding site.
--lddt-pli-radius LDDT_PLI_RADIUS
lDDT inclusion radius for lDDT-PLI.
- --lddt-bs-radius LDDT_BS_RADIUS
- lDDT inclusion radius for lDDT-BS.
+ --lddt-lp-radius LDDT_LP_RADIUS
+ lDDT inclusion radius for lDDT-LP.
-v VERBOSITY, --verbosity VERBOSITY
Set verbosity level. Defaults to 3 (INFO).
+ --n-max-naive N_MAX_NAIVE
+ If number of chains in model and reference are
+ below or equal that number, the global chain
+ mapping will naively enumerate all possible
+ mappings. A heuristic is used otherwise.
Additional information about the scores and output values is available in
diff --git a/modules/doc/intro-01.rst b/modules/doc/intro-01.rst
index 98c3427e7a445adab8f4e5ad020996ad0e18d50b..aec5d8d3bb7f0e8414131c0ec3b3b46647cba53d 100644
--- a/modules/doc/intro-01.rst
+++ b/modules/doc/intro-01.rst
@@ -230,4 +230,32 @@ select the backbone atoms and then save it:
That's it for the mol module. Continue with :doc:`part two<intro-02>` of the
tutorial.
+.. _memory_management:
+
+Memory management
+--------------------------------------------------------------------------------
+
+Because the data is managed by OST's underlying C++ layer, some behaviors can
+be somewhat surprising to Python developers. One such behavior is that
+:class:`entities <ost.mol.EntityHandle>` store all the data about chains,
+residues and atoms.
+
+Once an entity is deleted, all :class:`chains <ost.mol.ChainHandle>`,
+:class:`residues <ost.mol.ResidueHandle>` and
+:class:`atoms <ost.mol.AtomHandle>` that refer to it become invalid, so the
+following code is invalid and raises an exception:
+
+.. code-block:: python
+
+ ent = io.LoadPDB('1crn', remote=True)
+ my_residue = ent.FindResidue("A", 1)
+ print(my_residue.qualified_name)
+ # A.THR1
+ ent = None
+ print(my_residue.qualified_name)
+ # Exception: Can not access invalid handle or view
+
+This can frequently be an issue when you return data from a function.
+Make sure the entity is always defined outside of the function.
+
.. LocalWords: attr
diff --git a/modules/geom/doc/vec.rst b/modules/geom/doc/vec.rst
index c55dcbb658b82859514addc548884e7fcd6edc6d..4e66afa1579576f4282bbc0135e351f06fba7934 100644
--- a/modules/geom/doc/vec.rst
+++ b/modules/geom/doc/vec.rst
@@ -39,7 +39,7 @@ The standard vector operations are implemented as :ref:`free standing functions
Vector Classes
--------------------------------------------------------------------------------
-.. class:: Vec2([x=0.0, y=0.0, z=0.0])
+.. class:: Vec2(x=0.0, y=0.0, z=0.0)
Vec2(vec)
Real-valued vector in 2 dimensions.
@@ -65,7 +65,7 @@ Vector Classes
.. attribute:: y
The y-coordinate of the vector.
-.. class:: Vec3([x=0.0, y=0.0, z=0.0])
+.. class:: Vec3(x=0.0, y=0.0, z=0.0)
Vec3(vec)
Real-valued vector in 3 dimensions.
@@ -99,7 +99,7 @@ Vector Classes
:type: float or int
-.. class:: Vec4([x=0.0, y=0.0, z=0.0, w=1.0])
+.. class:: Vec4(x=0.0, y=0.0, z=0.0, w=1.0)
Vec4(vec)
Real-valued vector in 4 dimensions.
diff --git a/modules/gui/pymod/scene/uniform_color_widget.py b/modules/gui/pymod/scene/uniform_color_widget.py
index 4f4f8ccc0b7400b84db71b93c688dbe54c417924..d6021e0afd3c66c6d8bbdb764ae6aa82b1d0e086 100644
--- a/modules/gui/pymod/scene/uniform_color_widget.py
+++ b/modules/gui/pymod/scene/uniform_color_widget.py
@@ -104,7 +104,7 @@ class UniformColorWidget(QtWidgets.QWidget):
entity.Apply(ufco)
def resizeEvent(self, event):
- self.color_select_widget_.SetSize(self.width()/2,self.height()/2)
+ self.color_select_widget_.SetSize(int(self.width()/2),int(self.height()/2))
def GetText(self):
return self.text_
diff --git a/modules/io/doc/io.rst b/modules/io/doc/io.rst
index 57677f7a5df111fefe328e35c1e2e64ba1fcfb4f..9e6a01f43678a34e705cf1f1ac4260959e619fe7 100644
--- a/modules/io/doc/io.rst
+++ b/modules/io/doc/io.rst
@@ -106,42 +106,36 @@ behaviour.
.. class:: ost.io.OMF
Experimental data format capable of storing minimally required information
- of a :class:`ost.mol.EntityHandle` in a heavily compressed manner
+ of a :class:`ost.mol.EntityHandle` in a compressed manner
(OMF - OpenStructure Minimal Format). Shares lots of ideas with the mmtf or
- binaryCIF formats but comes with no dependencies attached.
+ binaryCIF formats but comes with no dependencies attached. User can provide
+ an upper error bound of atom coordinates in A which has an effect on
+ compression ratio.
- .. staticmethod:: FromEntity(ent)
+ .. staticmethod:: FromEntity(ent, max_error = 0.0, options=0)
Generates :class:`ost.io.OMF` object starting from an
- :class:`ost.mol.EntityHandle`. *ent* is is assigned as assymetric unit,
- no biounits are defined (i.e. :func:`GetBU` raises an error in any case`).
+ :class:`ost.mol.EntityHandle`.
- :param ent: Structural data
+ :param ent: Structure data
:type ent: :class:`ost.mol.EntityHandle`
+ :param max_error: Maximum error in A of stored atom coordinates - affects
+ compression ratio
+ :type max_error: :class:`float`
+ :param options: Control file compression
+ :type options: :class:`ost.io.OMFOption`
:returns: The created :class:`ost.io.OMF` object
.. staticmethod:: FromFile(filepath)
Generates :class:`ost.io.OMF` object from a file stored with
- :func:`ToFile`.
+ :func:`ToFile` or a byte string created from :func:`ToBytes`
+ that has been dumped to disk.
:param filepath: The file
:type filepath: :class:`str`
:returns: The created :class:`ost.io.OMF` object
- .. staticmethod:: FromMMCIF(ent, info)
-
- Generates :class:`ost.io.OMF` object starting from an
- :class:`ost.mol.EntityHandle` with an associated :class:`MMCifInfo`
- (you get this stuff with :func:`ost.io.LoadMMCIF`). *ent* is assigned
- as assymetric unit and the biounits are fetched from *info*.
-
- :param ent: Structural data
- :type ent: :class:`ost.mol.EntityHandle`
- :param info: Biounits are fetched from here
- :type info: :class:`MMCifInfo`
- :returns: The created :class:`ost.io.OMF` object
-
.. staticmethod:: FromBytes(bytes_string)
Generates :class:`ost.io.OMF` object from a :class:`bytes` object created
@@ -163,12 +157,22 @@ behaviour.
:returns: The :class:`bytes` string
+ .. method:: GetMaxError()
+
+ Get maximum error parameter
+
+ :returns: The max error in A of the stored coordinates
+
.. method:: GetAU()
Getter for assymetric unit
:returns: The assymetric unit as :class:`ost.mol.EntityHandle`
+ .. method:: GetEntity()
+
+ Same as :func:`GetAU`
+
.. method:: GetAUChain(chain_name)
Getter for single chain in the assymetric unit
@@ -178,15 +182,45 @@ behaviour.
:returns: :class:`ost.mol.EntityHandle` of the AU only containing the
specified chain
- .. method:: GetBU(bu_idx)
+ .. method:: GetEntityChain(chain_name)
+
+ Same as :func:`GetAUChain`
+
+ .. method:: GetName()
+
+ :returns: The entity name, accessible as
+ :class:`ost.mol.EntityHandle.GetName` from the entity that has
+ been used to create :class:`OMF` object
- Getter for Biounit
+ .. method:: GetChainNames()
- :param bu_idx: The index from the biounit as it has been read from *info* in
- :func:`FromMMCIF`.
- :type bu_idx: :class:`int`
- :returns: The Biounit as :class:`ost.mol.EntityHandle`
- :raises: :class:`RuntimeError` if *bu_idx* doesn't exist
+ :returns: :class:`list` with chain names of the stored structure
+
+
+.. class:: ost.io.OMFOption
+
+ OMF options control file compression. They can be combined with bitwise or:
+
+ .. code-block:: python
+
+ omf_opts = io.OMFOption.DEFAULT_PEPLIB | io.OMFOption.AVG_BFACTORS
+
+ * DEFAULT_PEPLIB: Compound information (connectivity, chem type etc.) for each
+ unique residue in a structure is stored in a library. This option defines a
+ default library of such compounds with proteinogenic amino acids. This
+ reduces the size of the library that needs to be written for each OMF file.
+ IMPORTANT: This option has an impact on compression ratio as internal
+ coordinate parameters are only available through the default peptide library
+ * AVG_BFACTORS: Protein models often have the same bfactor for all atoms of
+ a residue. One example is AFDB. Enabling this option results in only one
+ bfactor being stored per residue, thus reducing file size.
+ * ROUND_BFACTORS: Round bfactor to integer. This gives sufficient accuracy
+ for bfactors in AFDB that are in range [0.0, 100.0].
+ * SKIP_SS: Dont save secondary structure to save some memory
+ * INFER_PEP_BONDS: Connectivity of compounds is stored in an internal library.
+ However, inter-residue connectivity needs to be stored separately. If this
+ option is enabled, stereochemically reasonable peptide bonds are inferred
+ at loading and there is no need to save them.
Loading Molecular Structures From Remote Repositories
@@ -549,13 +583,7 @@ Loading Density Maps
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
.. function:: LoadImage(filename)
-
- Load density map from disk with the extension being guessed by the function.
-
- :param filename: The filename
- :type filename: string
-
-.. function:: LoadImage(filename, format)
+ LoadImage(filename, format)
Load density map from disk. If no format is given, the function guesses the
filetype based on the extension of the file. If the extension is unknown or not present the
@@ -589,12 +617,8 @@ Loading Density Maps
Saving Density Maps
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
-.. function:: SaveImage(image,filename)
-
- Save density map to disk with the function guessing the
- filetype based on the file extension.
-
-.. function:: SaveImage(image,filename, format)
+.. function:: SaveImage(image, filename)
+ SaveImage(image, filename, format)
Save density map to disk. If no format is set, the function guesses the
filetype based on the file extension.
diff --git a/modules/io/doc/mmcif.rst b/modules/io/doc/mmcif.rst
index 20a816d2dd4e1fb19c8f28901ef75e00c44784e0..6fd6997721b30d45909c353be39c9cbde1aa5274 100644
--- a/modules/io/doc/mmcif.rst
+++ b/modules/io/doc/mmcif.rst
@@ -73,7 +73,8 @@ Notes:
:class:`MMCifInfo` as :meth:`~MMCifInfo.GetMMCifEntityIdTr`.
* For more complex mappings, such as ligands which may be in a same "old" chain
as the protein chain but are represented in a separate "new" chain in mmCIF,
- we also store string properties on a per-residue level.
+ we also store :class:`string properties<ost.GenericPropContainer>` on a
+ per-residue level.
For mmCIF files from the PDB, there is a unique mapping between
("label_asym_id", "label_seq_id") and ("auth_asym_id", "auth_seq_id",
"pdbx_PDB_ins_code").
@@ -846,7 +847,8 @@ of the annotation available.
Since this function is at the moment mainly used to create biounits from
mmCIF files to be saved as PDBs, the function assumes that the
- :class:`~ost.mol.ChainType` properties are set correctly.
+ :class:`~ost.mol.ChainType` properties are set correctly. For a more
+ mmCIF-style of doing things read this: :ref:`Biounits <Biounits>`
:param asu: Asymmetric unit to work on. Should be created from a mmCIF
file.
@@ -1332,6 +1334,20 @@ of the annotation available.
See :attr:`bond_order`
+Biounits
+^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
+
+.. _Biounits:
+
+Biological assemblies, i.e. biounits, are an integral part of mmCIF files and
+their construction is fully defined in :class:`MMCifInfoBioUnit`.
+:func:`MMCifInfoBioUnit.PDBize` provides one possibility to construct such biounits
+with compatibility with the PDB format in mind. That is single character chain
+names, dumping all ligands in one chain etc. For a more mmCIF-style way of
+constructing biounits, check out :func:`ost.mol.alg.CreateBU` in the
+*ost.mol.alg* module.
+
+
.. |exptl.method| replace:: ``exptl.method``
.. _exptl.method: https://mmcif.wwpdb.org/dictionaries/mmcif_pdbx_v50.dic/Items/_exptl.method.html
diff --git a/modules/io/doc/structure_formats.rst b/modules/io/doc/structure_formats.rst
index 42aca88269d1c5ed6c5d6f2ba940aa43c3c597bb..1ed16923ca17cf853b724424775df561a173a73d 100644
--- a/modules/io/doc/structure_formats.rst
+++ b/modules/io/doc/structure_formats.rst
@@ -51,7 +51,19 @@ radii.
SDF - Structured Data File
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
-Chemical-data file format.
+Chemical table (Ctab) file format (V2000; read-only V3000 experimental support),
+aka MDL Molfile.
+The SDF format does not support residues, chains or atom names natively.
+The SDF importer supports loading gzipped files, which are auto-detected by the
+.gz file extension.
+
+The reader assigns 1-based atom indices as atom names.
+SDF files containing several molecules are loaded into distinct chains,
+named after the molecule name in the MOLfile header with a numerical prefix.
+Residues are named after the name in the MOLfile header as well.
+
+Chains are written as separate molecules. If a chain contains more than one
+residue, they will be merged into a single molecule.
*Recognized File Extensions*
.sdf, .sdf.gz
diff --git a/modules/io/pymod/export_omf_io.cc b/modules/io/pymod/export_omf_io.cc
index 43355a4a908f97ae3f567daba57f5f0e739c34c5..2a19fce3f4951cfda10033e05a2f09231737dc56 100644
--- a/modules/io/pymod/export_omf_io.cc
+++ b/modules/io/pymod/export_omf_io.cc
@@ -56,7 +56,6 @@ void export_omf_io() {
enum_<OMF::OMFOption>("OMFOption")
.value("DEFAULT_PEPLIB", OMF::DEFAULT_PEPLIB)
- .value("LOSSY", OMF::LOSSY)
.value("AVG_BFACTORS", OMF::AVG_BFACTORS)
.value("ROUND_BFACTORS", OMF::ROUND_BFACTORS)
.value("SKIP_SS", OMF::SKIP_SS)
@@ -64,15 +63,16 @@ void export_omf_io() {
;
class_<OMF, OMFPtr>("OMF",no_init)
- .def("FromEntity", &OMF::FromEntity, (arg("ent"), arg("options")=0)).staticmethod("FromEntity")
- .def("FromMMCIF", &OMF::FromMMCIF, (arg("ent"), arg("mmcif_info"), arg("options")=0)).staticmethod("FromMMCIF")
+ .def("FromEntity", &OMF::FromEntity, (arg("ent"), arg("max_error")=0.0, arg("options")=0)).staticmethod("FromEntity")
.def("FromFile", &OMF::FromFile).staticmethod("FromFile")
.def("FromBytes", &wrap_from_bytes).staticmethod("FromBytes")
.def("ToFile", &OMF::ToFile)
.def("ToBytes", &wrap_to_bytes)
+ .def("GetMaxError", &OMF::GetMaxError)
.def("GetAU", &OMF::GetAU)
+ .def("GetEntity", &OMF::GetEntity)
.def("GetAUChain", &OMF::GetAUChain)
- .def("GetBU", &OMF::GetBU)
+ .def("GetEntityChain", &OMF::GetEntityChain)
.def("GetName", &OMF::GetName)
.def("GetChainNames", &wrap_get_chain_names)
.def("GetPositions", &OMF::GetPositions, return_value_policy<reference_existing_object>(),(arg("cname")))
diff --git a/modules/io/src/mol/chemdict_parser.cc b/modules/io/src/mol/chemdict_parser.cc
index d392692c7fbc0cca9114d8051519d0ce51ace003..a6e6b71db5bac39d257dd6e0170a8f2f2ab6c64f 100644
--- a/modules/io/src/mol/chemdict_parser.cc
+++ b/modules/io/src/mol/chemdict_parser.cc
@@ -30,7 +30,8 @@ bool ChemdictParser::OnBeginLoop(const StarLoopDesc& header)
indices_[ELE]=header.GetIndex("type_symbol");
indices_[IS_LEAVING]=header.GetIndex("pdbx_leaving_atom_flag");
indices_[IS_AROMATIC]=header.GetIndex("pdbx_aromatic_flag");
- indices_[ORDINAL]=header.GetIndex("pdbx_ordinal");
+ indices_[ORDINAL]=header.GetIndex("pdbx_ordinal");
+ indices_[CHARGE]=header.GetIndex("charge");
return true;
} else if (header.GetCategory()=="chem_comp_bond") {
loop_type_=BOND_SPEC;
@@ -42,6 +43,7 @@ bool ChemdictParser::OnBeginLoop(const StarLoopDesc& header)
loop_type_=DESC_SPEC;
indices_[DESC_TYPE]=header.GetIndex("type");
indices_[DESC]=header.GetIndex("descriptor");
+ indices_[PROGRAM]=header.GetIndex("program");
return true;
}
loop_type_=DONT_KNOW;
@@ -59,6 +61,7 @@ void ChemdictParser::OnDataRow(const StarLoopDesc& header,
atom.ordinal=columns[indices_[ORDINAL]].to_int().second-1;
atom.element=columns[indices_[ELE]].str();
atom.is_aromatic=columns[indices_[IS_AROMATIC]][0]=='Y';
+ atom.charge=columns[indices_[CHARGE]].to_int().second;
compound_->AddAtom(atom);
atom_map_[atom.name]=atom.ordinal;
} else if (loop_type_==BOND_SPEC) {
@@ -82,9 +85,12 @@ void ChemdictParser::OnDataRow(const StarLoopDesc& header,
"'InChI=' prefix." << std::endl;
return;
}
- compound_->SetInchi(columns[indices_[DESC]].substr(6).str());
+ compound_->SetInchi(columns[indices_[DESC]].str());
} else if (columns[indices_[DESC_TYPE]] == StringRef("InChIKey", 8)) {
compound_->SetInchiKey(columns[indices_[DESC]].str());
+ } else if (columns[indices_[DESC_TYPE]] == StringRef("SMILES_CANONICAL", 16) &&
+ columns[indices_[PROGRAM]] == StringRef("OpenEye OEToolkits", 18)) {
+ compound_->SetSMILES(columns[indices_[DESC]].str());
}
}
}
@@ -135,7 +141,17 @@ void ChemdictParser::OnDataItem(const StarDataItem& item)
compound_->SetChemClass(mol::ChemClass(mol::ChemClass::WATER));
compound_->SetOneLetterCode('.');
}
- } else if (item.GetName()==StringRef("one_letter_code", 15)) {
+ } else if (item.GetName()==StringRef("pdbx_release_status", 19)) {
+ String release_status = item.GetValue().str();
+ if (release_status == "OBS") {
+ compound_->SetObsolete(true);
+ }
+ } else if (item.GetName()==StringRef("pdbx_replaced_by", 16)) {
+ String replaced_by = item.GetValue().str();
+ if (replaced_by != "?") {
+ compound_->SetReplacedBy(replaced_by);
+ }
+ } else if (item.GetName()==StringRef("one_letter_code", 15)) {
if (item.GetValue().length()==1) {
compound_->SetOneLetterCode(item.GetValue()[0]);
}
diff --git a/modules/io/src/mol/chemdict_parser.hh b/modules/io/src/mol/chemdict_parser.hh
index d42fe9a223f39b4805991e017ff1e7df34e7809e..f33ee72fb69623aa41921cb15d6b9d7378c87ae4 100644
--- a/modules/io/src/mol/chemdict_parser.hh
+++ b/modules/io/src/mol/chemdict_parser.hh
@@ -75,12 +75,13 @@ private:
ORDINAL=3,
IS_LEAVING=4,
ELE=5,
- STEREO_CONF=6,
+ CHARGE=6,
ATOM_ID1=0,
ATOM_ID2=1,
BOND_ORDER=2,
DESC_TYPE=0,
- DESC=1
+ DESC=1,
+ PROGRAM=2,
} PropIndex;
char last_;
int indices_[10];
diff --git a/modules/io/src/mol/mmcif_info.hh b/modules/io/src/mol/mmcif_info.hh
index 351f27bc0dd60858b3a773c8953d59ba52ab9a6a..389d7d1cd433eaf646634426c33f8bb10b5729a4 100644
--- a/modules/io/src/mol/mmcif_info.hh
+++ b/modules/io/src/mol/mmcif_info.hh
@@ -27,6 +27,7 @@
#include <ost/string_ref.hh>
#include <ost/io/module_config.hh>
#include <ost/mol/mol.hh>
+#include <ost/io/io_exception.hh>
namespace ost { namespace io {
diff --git a/modules/io/src/mol/omf.cc b/modules/io/src/mol/omf.cc
index 91fdca413267c42bf41582e4422a37149bdbb59c..3b687d5cd26bbd08328caf5d31d469d29ffbecaf 100644
--- a/modules/io/src/mol/omf.cc
+++ b/modules/io/src/mol/omf.cc
@@ -1,3 +1,5 @@
+#include <algorithm>
+
#include <ost/mol/atom_handle.hh>
#include <ost/mol/residue_handle.hh>
#include <ost/mol/chain_handle.hh>
@@ -7,6 +9,1191 @@
namespace{
+ const uint32_t _bit_masks[25] = {
+ 0, // 0000 0000 0...
+ 2147483648, // 1000 0000 0...
+ 3221225472, // 1100 0000 0...
+ 3758096384, // 1110 0000 0...
+ 4026531840, // 1111 0000 0...
+ 4160749568, // 1111 1000 0...
+ 4227858432, // 1111 1100 0...
+ 4261412864, // 1111 1110 0...
+ 4278190080, // 1111 1111 0...
+ 4286578688 // 1111 1111 1...
+ };
+
+ class BitStorage {
+ // stores arbitrary unsigned integers up to 9 bits
+ // no range checks performed
+ public:
+ BitStorage(): buffer_(2, 0), writing_bit_pos_(0), reading_bit_pos_(0) { }
+
+ void Push(uint32_t v, int n_bits) {
+ int byte_pos = writing_bit_pos_ / 8;
+ v = v << (32 - n_bits - writing_bit_pos_ % 8); // shift the relevant bits to left
+ uint32_t tmp = buffer_[byte_pos];
+ tmp = tmp << 24; // buffer content at byte_pos occupies first 8 bits
+ tmp = tmp | v;
+ buffer_[byte_pos] = (tmp >> 24) & 0xFF;
+ buffer_[byte_pos+1] = (tmp >> 16) & 0xFF;
+ writing_bit_pos_ += n_bits;
+
+ // make sure we have one empty byte in the end
+ int new_byte_pos = writing_bit_pos_ / 8;
+ if(new_byte_pos > byte_pos) buffer_.push_back(0);
+ }
+
+ uint32_t Read(int n_bits) {
+ uint32_t reading_mask = _bit_masks[n_bits];
+ int right_shift = reading_bit_pos_ % 8;
+ reading_mask = reading_mask >> right_shift;
+ int byte_pos = reading_bit_pos_ / 8;
+ uint32_t tmp = static_cast<uint32_t>(buffer_[byte_pos]) << 24;
+ tmp = tmp | (static_cast<uint32_t>(buffer_[byte_pos+1]) << 16);
+ reading_bit_pos_ += n_bits;
+ return (tmp & reading_mask) >> (32 - n_bits - right_shift);
+ }
+
+ void ResetRead() {
+ reading_bit_pos_ = 0;
+ }
+
+ void Dump(std::ostream& stream) const {
+ stream.write(reinterpret_cast<const char*>(&writing_bit_pos_), sizeof(int));
+ int n_bytes = std::ceil(static_cast<Real>(writing_bit_pos_) / 8);
+ stream.write(reinterpret_cast<const char*>(&buffer_[0]), n_bytes);
+ }
+
+ static BitStorage Load(std::istream& stream) {
+ BitStorage storage;
+ stream.read(reinterpret_cast<char*>(&storage.writing_bit_pos_), sizeof(int));
+ int n_bytes = std::ceil(static_cast<Real>(storage.writing_bit_pos_) / 8);
+ storage.buffer_.resize(n_bytes + 1, 0);
+ stream.read(reinterpret_cast<char*>(&storage.buffer_[0]), n_bytes);
+ return storage;
+ }
+
+ private:
+ std::vector<uint8_t> buffer_;
+ int writing_bit_pos_;
+ int reading_bit_pos_;
+ };
+
+ void ConstructOPos(const geom::Vec3& ca_pos, const geom::Vec3& c_pos,
+ const geom::Vec3& n_next_pos, geom::Vec3& o_pos) {
+ geom::Vec3 o_vec = geom::Normalize(geom::Normalize(c_pos - ca_pos) +
+ geom::Normalize(c_pos - n_next_pos));
+ o_pos = c_pos + 1.2339*o_vec;
+ }
+
+ void ConstructAtomPos(const geom::Vec3& A, const geom::Vec3& B,
+ const geom::Vec3& C, Real bond_length, Real angle,
+ Real dihedral, geom::Vec3& pos) {
+
+ Real x,xx,x1;
+ x = std::tan((Real(M_PI)-angle)*Real(0.5));
+ xx = x*x;
+ x1 = Real(1.0)+xx;
+ Real bond_length_x_sin_angle = bond_length*Real(2.0)*x/x1;
+ Real bond_length_x_cos_angle = bond_length*(Real(1.0)-xx)/x1;
+
+ x = std::tan(Real(0.5)*dihedral);
+ xx = x*x;
+ x1 = Real(1.0)+xx;
+ Real sin_dihedral = Real(2.0)*x/x1;
+ Real cos_dihedral = (Real(1.0)-xx)/x1;
+
+ Real ab[] = {B[0]-A[0],B[1]-A[1],B[2]-A[2]};
+
+ Real norm_bc[] = {C[0]-B[0],C[1]-B[1],C[2]-B[2]};
+ Real a = norm_bc[0] * norm_bc[0];
+ a += norm_bc[1] * norm_bc[1];
+ a += norm_bc[2] * norm_bc[2];
+ a = Real(1.0) / std::sqrt(a);
+
+ norm_bc[0]*=a;
+ norm_bc[1]*=a;
+ norm_bc[2]*=a;
+
+ Real norm_n[] = {ab[1]*norm_bc[2]-norm_bc[1]*ab[2],
+ ab[2]*norm_bc[0]-norm_bc[2]*ab[0],
+ ab[0]*norm_bc[1]-norm_bc[0]*ab[1]};
+
+ a = norm_n[0]*norm_n[0];
+ a += norm_n[1]*norm_n[1];
+ a += norm_n[2]*norm_n[2];
+ a = Real(1.0) / std::sqrt(a);
+
+ norm_n[0]*=a;
+ norm_n[1]*=a;
+ norm_n[2]*=a;
+
+ Real n_x_bc[] = {norm_n[1]*norm_bc[2]-norm_bc[1]*norm_n[2],
+ norm_n[2]*norm_bc[0]-norm_bc[2]*norm_n[0],
+ norm_n[0]*norm_bc[1]-norm_bc[0]*norm_n[1]};
+
+ pos[0] = norm_bc[0]*bond_length_x_cos_angle +
+ n_x_bc[0]*cos_dihedral*bond_length_x_sin_angle +
+ norm_n[0]*sin_dihedral*bond_length_x_sin_angle + C[0];
+
+ pos[1] = norm_bc[1]*bond_length_x_cos_angle +
+ n_x_bc[1]*cos_dihedral*bond_length_x_sin_angle +
+ norm_n[1]*sin_dihedral*bond_length_x_sin_angle + C[1];
+
+ pos[2] = norm_bc[2]*bond_length_x_cos_angle +
+ n_x_bc[2]*cos_dihedral*bond_length_x_sin_angle +
+ norm_n[2]*sin_dihedral*bond_length_x_sin_angle + C[2];
+ }
+
+ inline Real PeptideBond() {
+ return 1.3310;
+ }
+
+ inline Real N_CA_Bond(char olc) {
+ switch(olc) {
+ case 'G': {
+ return 1.4556;
+ }
+ case 'A': {
+ return 1.4618;
+ }
+ case 'S': {
+ return 1.4610;
+ }
+ case 'C': {
+ return 1.4605;
+ }
+ case 'V': {
+ return 1.4614;
+ }
+ case 'I': {
+ return 1.4616;
+ }
+ case 'L': {
+ return 1.4612;
+ }
+ case 'T': {
+ return 1.4606;
+ }
+ case 'R': {
+ return 1.4614;
+ }
+ case 'K': {
+ return 1.4616;
+ }
+ case 'D': {
+ return 1.4624;
+ }
+ case 'N': {
+ return 1.4614;
+ }
+ case 'E': {
+ return 1.4615;
+ }
+ case 'Q': {
+ return 1.4614;
+ }
+ case 'M': {
+ return 1.4618;
+ }
+ case 'H': {
+ return 1.4612;
+ }
+ case 'P': {
+ return 1.4667;
+ }
+ case 'F': {
+ return 1.4608;
+ }
+ case 'Y': {
+ return 1.4609;
+ }
+ case 'W': {
+ return 1.4611;
+ }
+ default: {
+ return 1.46;
+ }
+ }
+ }
+
+ inline Real CA_C_Bond(char olc) {
+ switch (olc) {
+ case 'G': {
+ return 1.5164;
+ }
+ case 'A': {
+ return 1.5255;
+ }
+ case 'S': {
+ return 1.5251;
+ }
+ case 'C': {
+ return 1.5242;
+ }
+ case 'V': {
+ return 1.5258;
+ }
+ case 'I': {
+ return 1.5259;
+ }
+ case 'L': {
+ return 1.5248;
+ }
+ case 'T': {
+ return 1.5254;
+ }
+ case 'R': {
+ return 1.5253;
+ }
+ case 'K': {
+ return 1.5255;
+ }
+ case 'D': {
+ return 1.5268;
+ }
+ case 'N': {
+ return 1.5256;
+ }
+ case 'E': {
+ return 1.5258;
+ }
+ case 'Q': {
+ return 1.5254;
+ }
+ case 'M': {
+ return 1.5249;
+ }
+ case 'H': {
+ return 1.5242;
+ }
+ case 'P': {
+ return 1.5255;
+ }
+ case 'F': {
+ return 1.5243;
+ }
+ case 'Y': {
+ return 1.5242;
+ }
+ case 'W': {
+ return 1.5243;
+ }
+ default: {
+ return 1.52;
+ }
+ }
+ }
+
+ inline Real CA_CB_Bond(char olc) {
+ switch(olc) {
+ case 'A': {
+ return 1.5253;
+ }
+ case 'S': {
+ return 1.5288;
+ }
+ case 'C': {
+ return 1.5294;
+ }
+ case 'V': {
+ return 1.5446;
+ }
+ case 'I': {
+ return 1.5443;
+ }
+ case 'L': {
+ return 1.5310;
+ }
+ case 'T': {
+ return 1.5390;
+ }
+ case 'R': {
+ return 1.5311;
+ }
+ case 'K': {
+ return 1.5312;
+ }
+ case 'D': {
+ return 1.5320;
+ }
+ case 'N': {
+ return 1.5314;
+ }
+ case 'E': {
+ return 1.5316;
+ }
+ case 'Q': {
+ return 1.5308;
+ }
+ case 'M': {
+ return 1.5311;
+ }
+ case 'H': {
+ return 1.5316;
+ }
+ case 'P': {
+ return 1.5332;
+ }
+ case 'F': {
+ return 1.5332;
+ }
+ case 'Y': {
+ return 1.5331;
+ }
+ case 'W': {
+ return 1.5324;
+ }
+ default: {
+ return 1.53;
+ }
+ }
+ }
+
+ inline Real C_CA_CB_Angle(char olc) {
+ switch (olc) {
+ case 'A': {
+ return 1.9255;
+ }
+ case 'S': {
+ return 1.9190;
+ }
+ case 'C': {
+ return 1.9205;
+ }
+ case 'V': {
+ return 1.9299;
+ }
+ case 'I': {
+ return 1.9318;
+ }
+ case 'L': {
+ return 1.9209;
+ }
+ case 'T': {
+ return 1.9170;
+ }
+ case 'R': {
+ return 1.9229;
+ }
+ case 'K': {
+ return 1.9227;
+ }
+ case 'D': {
+ return 1.9247;
+ }
+ case 'N': {
+ return 1.9278;
+ }
+ case 'E': {
+ return 1.9236;
+ }
+ case 'Q': {
+ return 1.9230;
+ }
+ case 'M': {
+ return 1.9215;
+ }
+ case 'H': {
+ return 1.9246;
+ }
+ case 'P': {
+ return 1.9356;
+ }
+ case 'F': {
+ return 1.9236;
+ }
+ case 'Y': {
+ return 1.9225;
+ }
+ case 'W': {
+ return 1.9230;
+ }
+ default: {
+ return 1.92;
+ }
+ }
+ }
+
+ inline Real CA_C_N_Angle(char olc) {
+ return 2.0380;
+ }
+
+ inline Real C_N_CA_Angle(char olc) {
+ return 2.1200;
+ }
+
+ inline Real N_CA_C_Angle(char olc) {
+ switch(olc) {
+ case 'G': {
+ return 1.9747;
+ }
+ case 'A': {
+ return 1.9374;
+ }
+ case 'S': {
+ return 1.9401;
+ }
+ case 'C': {
+ return 1.9338;
+ }
+ case 'V': {
+ return 1.9140;
+ }
+ case 'I': {
+ return 1.9139;
+ }
+ case 'L': {
+ return 1.9339;
+ }
+ case 'T': {
+ return 1.9314;
+ }
+ case 'R': {
+ return 1.9359;
+ }
+ case 'K': {
+ return 1.9374;
+ }
+ case 'D': {
+ return 1.9364;
+ }
+ case 'N': {
+ return 1.9434;
+ }
+ case 'E': {
+ return 1.9389;
+ }
+ case 'Q': {
+ return 1.9375;
+ }
+ case 'M': {
+ return 1.9350;
+ }
+ case 'H': {
+ return 1.9374;
+ }
+ case 'P': {
+ return 1.9665;
+ }
+ case 'F': {
+ return 1.9323;
+ }
+ case 'Y': {
+ return 1.9341;
+ }
+ case 'W': {
+ return 1.9348;
+ }
+ default: {
+ return 1.94;
+ }
+ }
+ }
+
+
+ inline Real N_C_CA_CB_DiAngle(char olc) {
+ switch(olc) {
+ case 'A': {
+ return 2.1423;
+ }
+ case 'S': {
+ return 2.1428;
+ }
+ case 'C': {
+ return 2.1409;
+ }
+ case 'V': {
+ return 2.1533;
+ }
+ case 'I': {
+ return 2.1519;
+ }
+ case 'L': {
+ return 2.1377;
+ }
+ case 'T': {
+ return 2.1496;
+ }
+ case 'R': {
+ return 2.1433;
+ }
+ case 'K': {
+ return 2.1432;
+ }
+ case 'D': {
+ return 2.1449;
+ }
+ case 'N': {
+ return 2.1526;
+ }
+ case 'E': {
+ return 2.1452;
+ }
+ case 'Q': {
+ return 2.1442;
+ }
+ case 'M': {
+ return 2.1419;
+ }
+ case 'H': {
+ return 2.1437;
+ }
+ case 'P': {
+ return 2.0121;
+ }
+ case 'F': {
+ return 2.1426;
+ }
+ case 'Y': {
+ return 2.1423;
+ }
+ case 'W': {
+ return 2.1420;
+ }
+ default: {
+ return 2.14;
+ }
+ }
+ }
+
+ void FillInferredTriPeptideIndices(const ost::io::ResidueDefinition& def_one,
+ const ost::io::ResidueDefinition& def_two,
+ const ost::io::ResidueDefinition& def_three,
+ int res_idx,
+ std::vector<std::set<int> >& indices) {
+ indices[res_idx].insert(def_one.GetIdx("N"));
+ indices[res_idx].insert(def_one.GetIdx("C"));
+ int cb_idx = def_one.GetIdx("CB");
+ if(cb_idx != -1) {
+ indices[res_idx].insert(cb_idx);
+ }
+ indices[res_idx+1].insert(def_two.GetIdx("N"));
+ indices[res_idx+1].insert(def_two.GetIdx("C"));
+ cb_idx = def_two.GetIdx("CB");
+ if(cb_idx != -1) {
+ indices[res_idx+1].insert(cb_idx);
+ }
+ indices[res_idx+2].insert(def_three.GetIdx("N"));
+ indices[res_idx+2].insert(def_three.GetIdx("C"));
+ cb_idx = def_three.GetIdx("CB");
+ if(cb_idx != -1) {
+ indices[res_idx+2].insert(cb_idx);
+ }
+ }
+
+ void FillInferredRotIndices(const ost::io::ResidueDefinition& def,
+ int res_idx,
+ std::vector<std::set<int> >& inferred_indices) {
+ const std::vector<ost::io::SidechainAtomRule>& at_rules =
+ def.GetSidechainAtomRules();
+ for(auto it = at_rules.begin(); it != at_rules.end(); ++it) {
+ inferred_indices[res_idx].insert(it->sidechain_atom_idx);
+ }
+ }
+
+ bool EncodeTriPeptide(const ost::io::ResidueDefinition& def_one,
+ const ost::io::ResidueDefinition& def_two,
+ const ost::io::ResidueDefinition& def_three,
+ Real error_thresh,
+ const std::vector<geom::Vec3>& ref_positions,
+ int res_idx,
+ int res_start_idx,
+ std::vector<std::set<int> >& skip_indices,
+ std::vector<geom::Vec3>& positions,
+ BitStorage& data) {
+
+ // extracts data required to reconstruct positions
+ // if max reconstruction error is below specified threshold,
+ // the reconstructed positions are directly fed back into
+ // positions. skip_indices are updated.
+
+ Real max_error = 0.0;
+
+ int n_one_idx = def_one.GetIdx("N");
+ int ca_one_idx = def_one.GetIdx("CA");
+ int c_one_idx = def_one.GetIdx("C");
+ int n_two_idx = def_two.GetIdx("N");
+ int ca_two_idx = def_two.GetIdx("CA");
+ int c_two_idx = def_two.GetIdx("C");
+ int n_three_idx = def_three.GetIdx("N");
+ int ca_three_idx = def_three.GetIdx("CA");
+ int c_three_idx = def_three.GetIdx("C");
+
+ if(n_one_idx == -1 || ca_one_idx == -1 || c_one_idx == -1 ||
+ n_two_idx == -1 || ca_two_idx == -1 || c_two_idx == -1 ||
+ n_three_idx == -1 || ca_three_idx == -1 || c_three_idx == -1) {
+ return false;
+ }
+
+ // CBeta are optional
+ int cb_one_idx = def_one.GetIdx("CB");
+ int cb_two_idx = def_two.GetIdx("CB");
+ int cb_three_idx = def_three.GetIdx("CB");
+
+ int def_one_size = def_one.anames.size();
+ int def_two_size = def_two.anames.size();
+
+ n_one_idx += res_start_idx;
+ ca_one_idx += res_start_idx;
+ c_one_idx += res_start_idx;
+ n_two_idx += (res_start_idx + def_one_size);
+ ca_two_idx += (res_start_idx + def_one_size);
+ c_two_idx += (res_start_idx + def_one_size);
+ n_three_idx += (res_start_idx + def_one_size + def_two_size);
+ ca_three_idx += (res_start_idx + def_one_size + def_two_size);
+ c_three_idx += (res_start_idx + def_one_size + def_two_size);
+
+ if(cb_one_idx != -1) {
+ cb_one_idx += res_start_idx;
+ }
+
+ if(cb_two_idx != -1) {
+ cb_two_idx += (res_start_idx + def_one_size);
+ }
+
+ if(cb_three_idx != -1) {
+ cb_three_idx += (res_start_idx + def_one_size + def_two_size);
+ }
+
+ // derive parameters to reconstruct c_two
+ /////////////////////////////////////////
+ Real da_c_two = geom::DihedralAngle(positions[ca_one_idx],
+ positions[ca_three_idx],
+ positions[ca_two_idx],
+ ref_positions[c_two_idx]);
+ Real a_c_two = geom::Angle(positions[ca_three_idx] - positions[ca_two_idx],
+ ref_positions[c_two_idx] - positions[ca_two_idx]);
+ int int_da_c_two = round((da_c_two + M_PI)/(2*M_PI)*255);
+ int int_a_c_two = round((a_c_two)/(M_PI)*255);
+ geom::Vec3 reconstructed_c_two;
+ ConstructAtomPos(positions[ca_one_idx], positions[ca_three_idx],
+ positions[ca_two_idx], CA_C_Bond(def_two.olc),
+ static_cast<Real>(int_a_c_two)/255*M_PI,
+ static_cast<Real>(int_da_c_two)/255*2*M_PI-M_PI,
+ reconstructed_c_two);
+ max_error = std::max(max_error, geom::Distance(reconstructed_c_two,
+ ref_positions[c_two_idx]));
+
+ // derive parameters to reconstruct n_two
+ /////////////////////////////////////////
+ Real da_n_two = geom::DihedralAngle(positions[ca_one_idx],
+ positions[ca_three_idx],
+ positions[ca_two_idx],
+ ref_positions[n_two_idx]);
+ Real a_n_two = geom::Angle(positions[ca_three_idx] - positions[ca_two_idx],
+ ref_positions[n_two_idx] - positions[ca_two_idx]);
+ int int_da_n_two = round((da_n_two + M_PI)/(2*M_PI)*255);
+ int int_a_n_two = round((a_n_two)/(M_PI)*255);
+ geom::Vec3 reconstructed_n_two;
+ ConstructAtomPos(positions[ca_one_idx], positions[ca_three_idx],
+ positions[ca_two_idx], N_CA_Bond(def_two.olc),
+ static_cast<Real>(int_a_n_two)/255*M_PI,
+ static_cast<Real>(int_da_n_two)/255*2*M_PI-M_PI,
+ reconstructed_n_two);
+ max_error = std::max(max_error, geom::Distance(reconstructed_n_two,
+ ref_positions[n_two_idx]));
+
+ // derive parameters to reconstruct n_three
+ ///////////////////////////////////////////
+ Real da_n_three = geom::DihedralAngle(reconstructed_n_two,
+ positions[ca_two_idx],
+ reconstructed_c_two,
+ ref_positions[n_three_idx]);
+ Real a_n_three = geom::Angle(positions[ca_two_idx] - reconstructed_c_two,
+ ref_positions[n_three_idx] - reconstructed_c_two);
+ int int_da_n_three = round((da_n_three + M_PI)/(2*M_PI)*255);
+ // store angle as diff to ideal angle
+ Real diff = a_n_three-CA_C_N_Angle(def_two.olc);
+ // quantization by 0.5 degrees => 0.0087 in radians
+ int int_diff = round(diff/0.0087);
+ // make it fit in 4 bits
+ int int_a_n_three = std::min(8, std::max(-7, int_diff)) + 7;
+
+ geom::Vec3 reconstructed_n_three;
+ ConstructAtomPos(reconstructed_n_two,
+ positions[ca_two_idx],
+ reconstructed_c_two, PeptideBond(),
+ CA_C_N_Angle(def_two.olc) + (int_a_n_three-7)*0.0087,
+ static_cast<Real>(int_da_n_three)/255*2*M_PI-M_PI,
+ reconstructed_n_three);
+ max_error = std::max(max_error, geom::Distance(reconstructed_n_three,
+ ref_positions[n_three_idx]));
+
+ // derive parameters to reconstruct c_three
+ ///////////////////////////////////////////
+ Real da_c_three = geom::DihedralAngle(reconstructed_c_two,
+ reconstructed_n_three,
+ positions[ca_three_idx],
+ ref_positions[c_three_idx]);
+ Real a_c_three = geom::Angle(reconstructed_n_three - positions[ca_three_idx],
+ ref_positions[c_three_idx] - positions[ca_three_idx]);
+ int int_da_c_three = round((da_c_three + M_PI)/(2*M_PI)*255);
+ // store angle as diff to ideal angle derived from N_CA_C_Angle function
+ diff = a_c_three-N_CA_C_Angle(def_three.olc);
+ // quantization by 0.5 degrees => 0.0087 in radians
+ int_diff = round(diff/0.0087);
+ // make it fit in 4 bits
+ int int_a_c_three = std::min(8, std::max(-7, int_diff)) + 7;
+
+ geom::Vec3 reconstructed_c_three;
+ ConstructAtomPos(reconstructed_c_two,
+ reconstructed_n_three,
+ positions[ca_three_idx], CA_C_Bond(def_three.olc),
+ N_CA_C_Angle(def_three.olc) + (int_a_c_three-7)*0.0087,
+ static_cast<Real>(int_da_c_three)/255*2*M_PI-M_PI,
+ reconstructed_c_three);
+ max_error = std::max(max_error, geom::Distance(reconstructed_c_three,
+ ref_positions[c_three_idx]));
+
+ // derive parameters to reconstruct c_one
+ /////////////////////////////////////////
+ Real da_c_one = geom::DihedralAngle(reconstructed_c_two,
+ positions[ca_two_idx],
+ reconstructed_n_two,
+ ref_positions[c_one_idx]);
+ Real a_c_one = geom::Angle(positions[ca_two_idx] - reconstructed_n_two,
+ ref_positions[c_one_idx] - reconstructed_n_two);
+ int int_da_c_one = round((da_c_one + M_PI)/(2*M_PI)*255);
+ // store angle as diff to ideal peptide angle
+ diff = a_c_one-C_N_CA_Angle(def_two.olc);
+ // quantization by 0.5 degrees => 0.0087 in radians
+ int_diff = round(diff/0.0087);
+ // make it fit in 4 bits
+ int int_a_c_one = std::min(8, std::max(-7, int_diff)) + 7;
+
+ geom::Vec3 reconstructed_c_one;
+ ConstructAtomPos(reconstructed_c_two,
+ positions[ca_two_idx],
+ reconstructed_n_two, PeptideBond(),
+ C_N_CA_Angle(def_two.olc) + (int_a_c_one-7)*0.0087,
+ static_cast<Real>(int_da_c_one)/255*2*M_PI-M_PI,
+ reconstructed_c_one);
+ max_error = std::max(max_error, geom::Distance(reconstructed_c_one,
+ ref_positions[c_one_idx]));
+
+ // derive parameters to reconstruct n_one
+ /////////////////////////////////////////
+ Real da_n_one = geom::DihedralAngle(reconstructed_n_two,
+ reconstructed_c_one,
+ positions[ca_one_idx],
+ ref_positions[n_one_idx]);
+ Real a_n_one = geom::Angle(reconstructed_c_one - positions[ca_one_idx],
+ ref_positions[n_one_idx] - positions[ca_one_idx]);
+ int int_da_n_one = round((da_n_one + M_PI)/(2*M_PI)*255);
+ // store angle as diff to ideal angle derived from N_CA_C_Angle function
+ diff = a_n_one-N_CA_C_Angle(def_one.olc);
+ // quantization by 0.5 degrees => 0.0087 in radians
+ int_diff = round(diff/0.0087);
+ // make it fit in 4 bits
+ int int_a_n_one = std::min(8, std::max(-7, int_diff)) + 7;
+
+ geom::Vec3 reconstructed_n_one;
+ ConstructAtomPos(reconstructed_n_two,
+ reconstructed_c_one,
+ positions[ca_one_idx], N_CA_Bond(def_one.olc),
+ N_CA_C_Angle(def_one.olc) + (int_a_n_one-7)*0.0087,
+ static_cast<Real>(int_da_n_one)/255*2*M_PI-M_PI,
+ reconstructed_n_one);
+ max_error = std::max(max_error, geom::Distance(reconstructed_n_one,
+ ref_positions[n_one_idx]));
+
+ // derive parameters to reconstruct cbetas
+ //////////////////////////////////////////
+ std::vector<int> cb_data;
+ geom::Vec3 reconstructed_cb_one;
+ geom::Vec3 reconstructed_cb_two;
+ geom::Vec3 reconstructed_cb_three;
+ if(cb_one_idx != -1) {
+ Real da_cb = geom::DihedralAngle(reconstructed_n_one,
+ reconstructed_c_one,
+ positions[ca_one_idx],
+ ref_positions[cb_one_idx]);
+ diff = da_cb - N_C_CA_CB_DiAngle(def_one.olc);
+ // quantization by 0.5 degrees => 0.0087 in radians
+ int_diff = round(diff/0.0087);
+ int int_da_cb = std::min(8, std::max(-7, int_diff)) + 7;
+
+ Real a_cb = geom::Angle(reconstructed_c_one - positions[ca_one_idx],
+ ref_positions[cb_one_idx] - positions[ca_one_idx]);
+ diff = a_cb - C_CA_CB_Angle(def_one.olc);
+ // quantization by 0.5 degrees => 0.0087 in radians
+ int_diff = round(diff/0.0087);
+ int int_a_cb = std::min(8, std::max(-7, int_diff)) + 7;
+
+ ConstructAtomPos(reconstructed_n_one,
+ reconstructed_c_one,
+ positions[ca_one_idx], CA_CB_Bond(def_one.olc),
+ C_CA_CB_Angle(def_one.olc) + (static_cast<int>(int_a_cb)-7)*0.0087,
+ N_C_CA_CB_DiAngle(def_one.olc) + (int_da_cb-7) * 0.0087,
+ reconstructed_cb_one);
+ max_error = std::max(max_error, geom::Distance(reconstructed_cb_one,
+ ref_positions[cb_one_idx]));
+ cb_data.push_back(int_a_cb);
+ cb_data.push_back(int_da_cb);
+ }
+
+ if(cb_two_idx != -1) {
+ Real da_cb = geom::DihedralAngle(reconstructed_n_two,
+ reconstructed_c_two,
+ positions[ca_two_idx],
+ ref_positions[cb_two_idx]);
+ diff = da_cb - N_C_CA_CB_DiAngle(def_two.olc);
+ // quantization by 0.5 degrees => 0.0087 in radians
+ int_diff = round(diff/0.0087);
+ int int_da_cb = std::min(8, std::max(-7, int_diff)) + 7;
+
+ Real a_cb = geom::Angle(reconstructed_c_two - positions[ca_two_idx],
+ ref_positions[cb_two_idx] - positions[ca_two_idx]);
+ diff = a_cb - C_CA_CB_Angle(def_two.olc);
+ // quantization by 0.5 degrees => 0.0087 in radians
+ int_diff = round(diff/0.0087);
+ int int_a_cb = std::min(8, std::max(-7, int_diff)) + 7;
+
+ ConstructAtomPos(reconstructed_n_two,
+ reconstructed_c_two,
+ positions[ca_two_idx], CA_CB_Bond(def_two.olc),
+ C_CA_CB_Angle(def_two.olc) + (int_a_cb-7)*0.0087,
+ N_C_CA_CB_DiAngle(def_two.olc) + (int_da_cb-7) * 0.0087,
+ reconstructed_cb_two);
+ max_error = std::max(max_error, geom::Distance(reconstructed_cb_two,
+ ref_positions[cb_two_idx]));
+ cb_data.push_back(int_a_cb);
+ cb_data.push_back(int_da_cb);
+ }
+
+ if(cb_three_idx != -1) {
+ Real da_cb = geom::DihedralAngle(reconstructed_n_three,
+ reconstructed_c_three,
+ positions[ca_three_idx],
+ ref_positions[cb_three_idx]);
+ diff = da_cb - N_C_CA_CB_DiAngle(def_three.olc);
+ // quantization by 0.5 degrees => 0.0087 in radians
+ int_diff = round(diff/0.0087);
+ int int_da_cb = std::min(8, std::max(-7, int_diff)) + 7;
+
+ Real a_cb = geom::Angle(reconstructed_c_three - positions[ca_three_idx],
+ ref_positions[cb_three_idx] - positions[ca_three_idx]);
+ diff = a_cb - C_CA_CB_Angle(def_three.olc);
+ // quantization by 0.5 degrees => 0.0087 in radians
+ int_diff = round(diff/0.0087);
+ int int_a_cb = std::min(8, std::max(-7, int_diff)) + 7;
+
+ ConstructAtomPos(reconstructed_n_three,
+ reconstructed_c_three,
+ positions[ca_three_idx], CA_CB_Bond(def_three.olc),
+ C_CA_CB_Angle(def_three.olc) + (int_a_cb-7)*0.0087,
+ N_C_CA_CB_DiAngle(def_three.olc) + (int_da_cb-7) * 0.0087,
+ reconstructed_cb_three);
+ max_error = std::max(max_error, geom::Distance(reconstructed_cb_three,
+ ref_positions[cb_three_idx]));
+ cb_data.push_back(int_a_cb);
+ cb_data.push_back(int_da_cb);
+ }
+
+ if(max_error < error_thresh) {
+ positions[n_one_idx] = reconstructed_n_one;
+ positions[c_one_idx] = reconstructed_c_one;
+ positions[n_two_idx] = reconstructed_n_two;
+ positions[c_two_idx] = reconstructed_c_two;
+ positions[n_three_idx] = reconstructed_n_three;
+ positions[c_three_idx] = reconstructed_c_three;
+
+ if(cb_one_idx != -1) {
+ positions[cb_one_idx] = reconstructed_cb_one;
+ }
+
+ if(cb_two_idx != -1) {
+ positions[cb_two_idx] = reconstructed_cb_two;
+ }
+
+ if(cb_three_idx != -1) {
+ positions[cb_three_idx] = reconstructed_cb_three;
+ }
+
+ FillInferredTriPeptideIndices(def_one, def_two, def_three, res_idx,
+ skip_indices);
+
+ // push dihedrals to data
+ data.Push(int_da_c_two, 8);
+ data.Push(int_da_n_two, 8);
+ data.Push(int_da_n_three, 8);
+ data.Push(int_da_c_three, 8);
+ data.Push(int_da_c_one, 8);
+ data.Push(int_da_n_one, 8);
+
+ // push angles to data
+ data.Push(int_a_c_two, 8);
+ data.Push(int_a_n_two, 8);
+
+ // push angle diffs to data
+ data.Push(int_a_n_three, 4);
+ data.Push(int_a_c_three, 4);
+ data.Push(int_a_c_one, 4);
+ data.Push(int_a_n_one, 4);
+
+ // push cb data
+ for(auto it = cb_data.begin(); it != cb_data.end(); ++it) {
+ data.Push(*it, 4);
+ }
+ return true;
+ }
+ return false;
+ }
+
+ bool EncodePepRotamer(const ost::io::ResidueDefinition& def, Real error_thresh,
+ const std::vector<geom::Vec3>& ref_positions,
+ int res_idx, int res_start_idx,
+ std::vector<std::set<int> >& skip_indices,
+ std::vector<geom::Vec3>& positions,
+ BitStorage& data) {
+
+ const std::vector<ost::io::SidechainAtomRule>& at_rules =
+ def.GetSidechainAtomRules();
+
+ int res_n_atoms = def.anames.size();
+ std::vector<geom::Vec3> res_ref_positions(ref_positions.begin() + res_start_idx,
+ ref_positions.begin() + res_start_idx + res_n_atoms);
+ std::vector<geom::Vec3> res_positions(positions.begin() + res_start_idx,
+ positions.begin() + res_start_idx + res_n_atoms);
+
+ // deliberately delay angle computations
+ // may lead to tiny corrections for second, third... angle
+ // for errors that were introduced for earlier ones
+ std::vector<int> comp_dihedrals(def.chi_definitions.size(), 0.0);
+ std::vector<bool> dihedral_set(def.chi_definitions.size(), false);
+ std::vector<int> angle_diffs;
+
+ for(auto it = at_rules.begin(); it != at_rules.end(); ++it) {
+ Real bond = it->bond_length;
+ Real angle = it->angle;
+ Real dihedral = it->base_dihedral;
+
+ int d_idx = it->dihedral_idx;
+ if(d_idx != 5) {
+ if(!dihedral_set[d_idx]) {
+ const ost::io::ChiDefinition& chi_def = def.chi_definitions[d_idx];
+ Real a = geom::DihedralAngle(res_positions[chi_def.idx_one],
+ res_positions[chi_def.idx_two],
+ res_positions[chi_def.idx_three],
+ res_ref_positions[chi_def.idx_four]);
+ comp_dihedrals[d_idx] = std::round((a + M_PI)/(2*M_PI)*255);
+
+ dihedral_set[d_idx] = true;
+ }
+ dihedral += static_cast<Real>(comp_dihedrals[d_idx])/255*2*M_PI-M_PI;
+ }
+
+ if(def.critical_sidechain_angles.find(it->sidechain_atom_idx) !=
+ def.critical_sidechain_angles.end()) {
+ Real a = geom::Angle(res_ref_positions[it->sidechain_atom_idx] -
+ res_positions[it->anchor_idx[2]],
+ res_positions[it->anchor_idx[1]] -
+ res_positions[it->anchor_idx[2]]);
+ Real angle_diff = a - angle;
+ // quantization by 0.5 degrees => 0.0087 in radians
+ int int_diff = std::round(angle_diff/0.0087);
+ int_diff = std::min(8, std::max(-7, int_diff)) + 7;
+ angle_diffs.push_back(int_diff);
+
+ angle += ((int_diff-7)*0.0087);
+ }
+
+ ConstructAtomPos(res_positions[it->anchor_idx[0]],
+ res_positions[it->anchor_idx[1]],
+ res_positions[it->anchor_idx[2]],
+ bond, angle, dihedral,
+ res_positions[it->sidechain_atom_idx]);
+
+ if(geom::Distance(res_positions[it->sidechain_atom_idx],
+ res_ref_positions[it->sidechain_atom_idx]) > error_thresh) {
+ return false;
+ }
+ }
+
+ for(auto it = comp_dihedrals.begin(); it != comp_dihedrals.end(); ++it) {
+ data.Push(*it, 8);
+ }
+
+ for(auto it = angle_diffs.begin(); it != angle_diffs.end(); ++it) {
+ data.Push(*it, 4);
+ }
+
+ FillInferredRotIndices(def, res_idx, skip_indices);
+ for(auto it = at_rules.begin(); it != at_rules.end(); ++it) {
+ positions[res_start_idx + it->sidechain_atom_idx] =
+ res_positions[it->sidechain_atom_idx];
+ }
+ return true;
+ }
+
+ void DecodeTriPeptide(const ost::io::ResidueDefinition& def_one,
+ const ost::io::ResidueDefinition& def_two,
+ const ost::io::ResidueDefinition& def_three,
+ int res_start_idx,
+ BitStorage& data,
+ std::vector<geom::Vec3>& positions) {
+
+ int n_one_idx = def_one.GetIdx("N");
+ int ca_one_idx = def_one.GetIdx("CA");
+ int c_one_idx = def_one.GetIdx("C");
+ int n_two_idx = def_two.GetIdx("N");
+ int ca_two_idx = def_two.GetIdx("CA");
+ int c_two_idx = def_two.GetIdx("C");
+ int n_three_idx = def_three.GetIdx("N");
+ int ca_three_idx = def_three.GetIdx("CA");
+ int c_three_idx = def_three.GetIdx("C");
+ int cb_one_idx = def_one.GetIdx("CB");
+ int cb_two_idx = def_two.GetIdx("CB");
+ int cb_three_idx = def_three.GetIdx("CB");
+
+ int def_one_size = def_one.anames.size();
+ int def_two_size = def_two.anames.size();
+
+ n_one_idx += res_start_idx;
+ ca_one_idx += res_start_idx;
+ c_one_idx += res_start_idx;
+ n_two_idx += (res_start_idx + def_one_size);
+ ca_two_idx += (res_start_idx + def_one_size);
+ c_two_idx += (res_start_idx + def_one_size);
+ n_three_idx += (res_start_idx + def_one_size + def_two_size);
+ ca_three_idx += (res_start_idx + def_one_size + def_two_size);
+ c_three_idx += (res_start_idx + def_one_size + def_two_size);
+
+ if(cb_one_idx != -1) {
+ cb_one_idx += res_start_idx;
+ }
+
+ if(cb_two_idx != -1) {
+ cb_two_idx += (res_start_idx + def_one_size);
+ }
+
+ if(cb_three_idx != -1) {
+ cb_three_idx += (res_start_idx + def_one_size + def_two_size);
+ }
+
+ int int_da_c_two = data.Read(8);
+ int int_da_n_two = data.Read(8);
+ int int_da_n_three = data.Read(8);
+ int int_da_c_three = data.Read(8);
+ int int_da_c_one = data.Read(8);
+ int int_da_n_one = data.Read(8);
+
+ int int_a_c_two = data.Read(8);
+ int int_a_n_two = data.Read(8);
+
+ int int_a_n_three = data.Read(4);
+ int int_a_c_three = data.Read(4);
+
+ int int_a_c_one = data.Read(4);
+ int int_a_n_one = data.Read(4);
+
+ ConstructAtomPos(positions[ca_one_idx],
+ positions[ca_three_idx],
+ positions[ca_two_idx], CA_C_Bond(def_two.olc),
+ static_cast<Real>(int_a_c_two)/255*M_PI,
+ static_cast<Real>(int_da_c_two)/255*2*M_PI-M_PI,
+ positions[c_two_idx]);
+
+ ConstructAtomPos(positions[ca_one_idx],
+ positions[ca_three_idx],
+ positions[ca_two_idx], N_CA_Bond(def_two.olc),
+ static_cast<Real>(int_a_n_two)/255*M_PI,
+ static_cast<Real>(int_da_n_two)/255*2*M_PI-M_PI,
+ positions[n_two_idx]);
+
+ ConstructAtomPos(positions[n_two_idx],
+ positions[ca_two_idx],
+ positions[c_two_idx], PeptideBond(),
+ CA_C_N_Angle(def_two.olc) + (int_a_n_three-7)*0.0087,
+ static_cast<Real>(int_da_n_three)/255*2*M_PI-M_PI,
+ positions[n_three_idx]);
+
+ ConstructAtomPos(positions[c_two_idx],
+ positions[n_three_idx],
+ positions[ca_three_idx], CA_C_Bond(def_three.olc),
+ N_CA_C_Angle(def_three.olc) + (int_a_c_three-7)*0.0087,
+ static_cast<Real>(int_da_c_three)/255*2*M_PI-M_PI,
+ positions[c_three_idx]);
+
+ ConstructAtomPos(positions[c_two_idx],
+ positions[ca_two_idx],
+ positions[n_two_idx], PeptideBond(),
+ C_N_CA_Angle(def_two.olc) + (int_a_c_one-7)*0.0087,
+ static_cast<Real>(int_da_c_one)/255*2*M_PI-M_PI,
+ positions[c_one_idx]);
+
+ ConstructAtomPos(positions[n_two_idx],
+ positions[c_one_idx],
+ positions[ca_one_idx], N_CA_Bond(def_one.olc),
+ N_CA_C_Angle(def_one.olc) + (int_a_n_one-7)*0.0087,
+ static_cast<Real>(int_da_n_one)/255*2*M_PI-M_PI,
+ positions[n_one_idx]);
+
+ if(cb_one_idx != -1) {
+ int int_a_cb = data.Read(4);
+ int int_da_cb = data.Read(4);
+ ConstructAtomPos(positions[n_one_idx],
+ positions[c_one_idx],
+ positions[ca_one_idx], CA_CB_Bond(def_one.olc),
+ C_CA_CB_Angle(def_one.olc) + (int_a_cb-7)*0.0087,
+ N_C_CA_CB_DiAngle(def_one.olc) + (int_da_cb-7) * 0.0087,
+ positions[cb_one_idx]);
+ }
+
+ if(cb_two_idx != -1) {
+ int int_a_cb = data.Read(4);
+ int int_da_cb = data.Read(4);
+ ConstructAtomPos(positions[n_two_idx],
+ positions[c_two_idx],
+ positions[ca_two_idx], CA_CB_Bond(def_two.olc),
+ C_CA_CB_Angle(def_two.olc) + (int_a_cb-7)*0.0087,
+ N_C_CA_CB_DiAngle(def_two.olc) + (int_da_cb-7) * 0.0087,
+ positions[cb_two_idx]);
+ }
+
+ if(cb_three_idx != -1) {
+ int int_a_cb = data.Read(4);
+ int int_da_cb = data.Read(4);
+ ConstructAtomPos(positions[n_three_idx],
+ positions[c_three_idx],
+ positions[ca_three_idx], CA_CB_Bond(def_three.olc),
+ C_CA_CB_Angle(def_three.olc) + (int_a_cb-7)*0.0087,
+ N_C_CA_CB_DiAngle(def_three.olc) + (int_da_cb-7) * 0.0087,
+ positions[cb_three_idx]);
+ }
+ }
+
+ void DecodePepRotamer(const ost::io::ResidueDefinition& def,
+ int res_start_idx, BitStorage& data,
+ std::vector<geom::Vec3>& positions) {
+ const std::vector<ost::io::SidechainAtomRule>& at_rules =
+ def.GetSidechainAtomRules();
+
+ std::vector<Real> dihedral_angles;
+ for(int i = 0; i < def.GetNChiAngles(); ++i) {
+ dihedral_angles.push_back(static_cast<Real>(data.Read(8))/255*2*M_PI-M_PI);
+ }
+
+ for(auto it = at_rules.begin(); it != at_rules.end(); ++it) {
+ Real dihedral = it->base_dihedral;
+ if(it->dihedral_idx != 5) {
+ dihedral += dihedral_angles[it->dihedral_idx];
+ }
+ Real angle = it->angle;
+ if(def.critical_sidechain_angles.find(it->sidechain_atom_idx) !=
+ def.critical_sidechain_angles.end()) {
+ int diff = data.Read(4);
+ angle += ((diff-7) * 0.0087);
+ }
+ ConstructAtomPos(positions[res_start_idx+it->anchor_idx[0]],
+ positions[res_start_idx+it->anchor_idx[1]],
+ positions[res_start_idx+it->anchor_idx[2]],
+ it->bond_length, angle, dihedral,
+ positions[res_start_idx+it->sidechain_atom_idx]);
+ }
+ }
+
// some hash function we need for an unordered_map
// stolen from https://stackoverflow.com/questions/32685540/why-cant-i-compile-an-unordered-map-with-a-pair-as-key
struct pair_hash {
@@ -20,10 +1207,10 @@ namespace{
}
};
- // define hash function, so we can use ResidueDefinition as key in an unordered
- // map. The used hash function is overly simple and gives a hash collision
- // whenever we have two residues of same name but different atom composition.
- // That's hopefully rare...
+ // define hash function, so we can use ResidueDefinition as key in an
+ // unordered map. The used hash function is overly simple and gives a hash
+ // collision whenever we have two residues of same name but different atom
+ // composition. That's hopefully rare...
struct ResidueDefinitionHash {
std::size_t operator()(const ost::io::ResidueDefinition& r) const {
return std::hash<String>()(r.name);
@@ -47,52 +1234,6 @@ namespace{
}
}
- // generates as many chain names as you want (potentially multiple characters)
- struct ChainNameGenerator{
- ChainNameGenerator() {
- chain_names = "ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyz";
- n_chain_names = chain_names.size();
- indices.push_back(-1);
- }
-
- String Get() {
- int idx = indices.size() - 1;
- indices[idx] += 1;
- bool more_digits = false;
- while(idx >= 0) {
- if(indices[idx] >= n_chain_names) {
- indices[idx] = 0;
- if(idx>0) {
- indices[idx-1] += 1;
- --idx;
- } else {
- more_digits = true;
- break;
- }
- } else {
- break;
- }
- }
- if(more_digits) {
- indices.insert(indices.begin(), 0);
- }
- String ch_name(indices.size(), 'X');
- for(uint i = 0; i < indices.size(); ++i) {
- ch_name[i] = chain_names[indices[i]];
- }
- return ch_name;
- }
-
- void Reset() {
- indices.clear();
- indices.push_back(-1);
- }
-
- String chain_names;
- int n_chain_names;
- std::vector<int> indices;
- };
-
// delta/runlength encodings/decodings
void DeltaEncoding(const std::vector<int>& in, std::vector<int>& out) {
out.clear();
@@ -315,18 +1456,19 @@ namespace{
stream.write(&ch, sizeof(char));
}
+
// dump and load maps with string as key and ChainDataPtr as value
void Load(std::istream& stream,
std::map<String, ost::io::ChainDataPtr>& map,
const std::vector<ost::io::ResidueDefinition>& res_def,
- int version, bool lossy, bool avg_bfactors, bool round_bfactors,
+ int version, Real max_error, bool avg_bfactors, bool round_bfactors,
bool skip_ss) {
uint32_t size;
stream.read(reinterpret_cast<char*>(&size), sizeof(uint32_t));
map.clear();
for(uint i = 0; i < size; ++i) {
ost::io::ChainDataPtr p(new ost::io::ChainData);
- p->FromStream(stream, res_def, version, lossy, avg_bfactors,
+ p->FromStream(stream, res_def, version, max_error, avg_bfactors,
round_bfactors, skip_ss);
map[p->ch_name] = p;
}
@@ -335,14 +1477,14 @@ namespace{
void Dump(std::ostream& stream,
const std::map<String, ost::io::ChainDataPtr>& map,
const std::vector<ost::io::ResidueDefinition>& res_def,
- bool lossy, bool avg_bfactors, bool round_bfactors,
+ Real max_error, bool avg_bfactors, bool round_bfactors,
bool skip_ss) {
uint32_t size = map.size();
stream.write(reinterpret_cast<char*>(&size), sizeof(uint32_t));
for(auto it = map.begin(); it != map.end(); ++it) {
// we don't dump the key (chain name), that's an attribute of the
// chain itself anyway
- it->second->ToStream(stream, res_def, lossy, avg_bfactors,
+ it->second->ToStream(stream, res_def, max_error, avg_bfactors,
round_bfactors, skip_ss);
}
}
@@ -460,7 +1602,8 @@ namespace{
}
}
- void Dump(std::ostream& stream, const std::vector<ost::io::ResidueDefinition>& vec) {
+ void Dump(std::ostream& stream,
+ const std::vector<ost::io::ResidueDefinition>& vec) {
uint32_t size = vec.size();
stream.write(reinterpret_cast<char*>(&size), sizeof(uint32_t));
for(uint i = 0; i < size; ++i) {
@@ -468,39 +1611,30 @@ namespace{
}
}
- // dump and load vectors with BioUnitDefinition
- void Load(std::istream& stream, std::vector<ost::io::BioUnitDefinition>& vec) {
- uint32_t size;
- stream.read(reinterpret_cast<char*>(&size), sizeof(uint32_t));
- vec.resize(size);
- for(uint i = 0; i < size; ++i) {
- vec[i].FromStream(stream);
- }
- }
-
- void Dump(std::ostream& stream, const std::vector<ost::io::BioUnitDefinition>& vec) {
+ void Dump(std::ostream& stream,
+ const std::vector<bool>& vec) {
uint32_t size = vec.size();
- stream.write(reinterpret_cast<char*>(&size), sizeof(uint32_t));
- for(uint i = 0; i < size; ++i) {
- vec[i].ToStream(stream);
+ uint32_t n_bytes = std::ceil(static_cast<Real>(size)/8);
+ std::vector<uint8_t> bit_vector(n_bytes, 0);
+ for(size_t i = 0; i < size; ++i) {
+ if(vec[i]) bit_vector[i/8] += (1 << (i%8));
}
+ stream.write(reinterpret_cast<char*>(&size), sizeof(uint32_t));
+ stream.write(reinterpret_cast<char*>(&bit_vector[0]),
+ n_bytes * sizeof(uint8_t));
}
- // dump and load vectors with Mat4
- void Load(std::istream& stream, std::vector<geom::Mat4>& vec) {
+ void Load(std::istream& stream,
+ std::vector<bool>& vec) {
uint32_t size;
stream.read(reinterpret_cast<char*>(&size), sizeof(uint32_t));
+ uint32_t n_bytes = std::ceil(static_cast<Real>(size)/8);
+ std::vector<uint8_t> bit_vector(n_bytes);
+ stream.read(reinterpret_cast<char*>(&bit_vector[0]),
+ n_bytes * sizeof(uint8_t));
vec.resize(size);
for(uint i = 0; i < size; ++i) {
- stream.read(reinterpret_cast<char*>(vec[i].Data()),16*sizeof(Real));
- }
- }
-
- void Dump(std::ostream& stream, const std::vector<geom::Mat4>& vec) {
- uint32_t size = vec.size();
- stream.write(reinterpret_cast<char*>(&size), sizeof(uint32_t));
- for(uint i = 0; i < size; ++i) {
- stream.write(reinterpret_cast<const char*>(vec[i].Data()), 16*sizeof(Real));
+ vec[i] = static_cast<bool>(bit_vector[i/8] & (1 << (i%8)));
}
}
@@ -544,58 +1678,152 @@ namespace{
Dump(stream, run_length_encoded);
}
- void LoadPosVec(std::istream& stream, std::vector<Real>& vec, bool lossy) {
- std::vector<int> delta_encoded;
- Load(stream, delta_encoded);
- std::vector<int> int_vec;
- DeltaDecoding(delta_encoded, int_vec);
- if(lossy) {
- IntToRealVec(int_vec, vec, 0.1);
- } else {
- IntToRealVec(int_vec, vec, 0.001);
- }
- }
-
void LoadPositions(std::istream& stream, geom::Vec3List& positions,
bool lossy) {
+
+ int8_t n_pos;
+ stream.read(reinterpret_cast<char*>(&n_pos), sizeof(int8_t));
+
std::vector<Real> x_pos;
std::vector<Real> y_pos;
std::vector<Real> z_pos;
- LoadPosVec(stream, x_pos, lossy);
- LoadPosVec(stream, y_pos, lossy);
- LoadPosVec(stream, z_pos, lossy);
+
+ if(n_pos >= 6) {
+ int first_x;
+ int first_y;
+ int first_z;
+ stream.read(reinterpret_cast<char*>(&first_x), sizeof(int));
+ stream.read(reinterpret_cast<char*>(&first_y), sizeof(int));
+ stream.read(reinterpret_cast<char*>(&first_z), sizeof(int));
+ std::vector<int> loaded_x;
+ std::vector<int> loaded_y;
+ std::vector<int> loaded_z;
+ Load(stream, loaded_x);
+ Load(stream, loaded_y);
+ Load(stream, loaded_z);
+ std::vector<int> delta_encoded_x;
+ std::vector<int> delta_encoded_y;
+ std::vector<int> delta_encoded_z;
+ delta_encoded_x.push_back(first_x);
+ delta_encoded_y.push_back(first_y);
+ delta_encoded_z.push_back(first_z);
+ delta_encoded_x.insert(delta_encoded_x.end(),
+ loaded_x.begin(), loaded_x.end());
+ delta_encoded_y.insert(delta_encoded_y.end(),
+ loaded_y.begin(), loaded_y.end());
+ delta_encoded_z.insert(delta_encoded_z.end(),
+ loaded_z.begin(), loaded_z.end());
+ std::vector<int> int_x;
+ std::vector<int> int_y;
+ std::vector<int> int_z;
+ DeltaDecoding(delta_encoded_x, int_x);
+ DeltaDecoding(delta_encoded_y, int_y);
+ DeltaDecoding(delta_encoded_z, int_z);
+ if(lossy) {
+ IntToRealVec(int_x, x_pos, 0.1);
+ IntToRealVec(int_y, y_pos, 0.1);
+ IntToRealVec(int_z, z_pos, 0.1);
+ } else {
+ IntToRealVec(int_x, x_pos, 0.001);
+ IntToRealVec(int_y, y_pos, 0.001);
+ IntToRealVec(int_z, z_pos, 0.001);
+ }
+ } else {
+ std::vector<int> int_vec;
+ Load(stream, int_vec);
+ std::vector<Real> real_vec;
+ if(lossy) {
+ IntToRealVec(int_vec, real_vec, 0.1);
+ } else {
+ IntToRealVec(int_vec, real_vec, 0.001);
+ }
+ x_pos.resize(n_pos);
+ y_pos.resize(n_pos);
+ z_pos.resize(n_pos);
+ for(int i = 0; i < n_pos; ++i) {
+ x_pos[i] = real_vec[i*3];
+ y_pos[i] = real_vec[i*3+1];
+ z_pos[i] = real_vec[i*3+2];
+ }
+ }
+
positions.resize(x_pos.size());
for(uint i = 0; i < positions.size(); ++i) {
positions[i] = geom::Vec3(x_pos[i], y_pos[i], z_pos[i]);
}
}
- void DumpPosVec(std::ostream& stream, const std::vector<Real>& vec,
- bool lossy) {
- std::vector<int> int_vec;
- if(lossy) {
- RealToIntVec(vec, int_vec, 10);
- } else {
- RealToIntVec(vec, int_vec, 1000);
- }
- std::vector<int> delta_compressed;
- DeltaEncoding(int_vec, delta_compressed);
- Dump(stream, delta_compressed);
- }
-
void DumpPositions(std::ostream& stream, const geom::Vec3List& positions,
bool lossy) {
- std::vector<Real> x_pos(positions.size());
- std::vector<Real> y_pos(positions.size());
- std::vector<Real> z_pos(positions.size());
+
+ int n_pos = positions.size();
+
+ std::vector<Real> x_pos(n_pos);
+ std::vector<Real> y_pos(n_pos);
+ std::vector<Real> z_pos(n_pos);
for(uint i = 0; i < positions.size(); ++i) {
x_pos[i] = positions[i][0];
y_pos[i] = positions[i][1];
z_pos[i] = positions[i][2];
}
- DumpPosVec(stream, x_pos, lossy);
- DumpPosVec(stream, y_pos, lossy);
- DumpPosVec(stream, z_pos, lossy);
+
+ std::vector<int> int_x;
+ std::vector<int> int_y;
+ std::vector<int> int_z;
+
+ if(lossy) {
+ RealToIntVec(x_pos, int_x, 10);
+ RealToIntVec(y_pos, int_y, 10);
+ RealToIntVec(z_pos, int_z, 10);
+ } else {
+ RealToIntVec(x_pos, int_x, 1000);
+ RealToIntVec(y_pos, int_y, 1000);
+ RealToIntVec(z_pos, int_z, 1000);
+ }
+
+ // delta compression is only worth it for a certain amount of
+ // positions...
+ if(n_pos > 5) {
+ // perform delta compression with one quirk: the first values of
+ // the delta compressed vectors get dumped explicitely as they
+ // may overflow when dumping with small integer sizes and cause
+ // excessive integer packing
+ int8_t N = 6;
+ stream.write(reinterpret_cast<char*>(&N), sizeof(int8_t));
+ std::vector<int> x_delta_compressed;
+ std::vector<int> y_delta_compressed;
+ std::vector<int> z_delta_compressed;
+ DeltaEncoding(int_x, x_delta_compressed);
+ DeltaEncoding(int_y, y_delta_compressed);
+ DeltaEncoding(int_z, z_delta_compressed);
+ int first_x = x_delta_compressed[0];
+ int first_y = y_delta_compressed[0];
+ int first_z = z_delta_compressed[0];
+ std::vector<int> x_to_dump(x_delta_compressed.begin() + 1,
+ x_delta_compressed.end());
+ std::vector<int> y_to_dump(y_delta_compressed.begin() + 1,
+ y_delta_compressed.end());
+ std::vector<int> z_to_dump(z_delta_compressed.begin() + 1,
+ z_delta_compressed.end());
+ stream.write(reinterpret_cast<char*>(&first_x), sizeof(int));
+ stream.write(reinterpret_cast<char*>(&first_y), sizeof(int));
+ stream.write(reinterpret_cast<char*>(&first_z), sizeof(int));
+ Dump(stream, x_to_dump);
+ Dump(stream, y_to_dump);
+ Dump(stream, z_to_dump);
+ } else {
+ // feed everything in one int vector without any compression and
+ // dump it
+ int8_t N = n_pos;
+ stream.write(reinterpret_cast<char*>(&N), sizeof(int8_t));
+ std::vector<int> pos_vec(N * 3);
+ for(int i = 0; i < N; ++i) {
+ pos_vec[i*3] = int_x[i];
+ pos_vec[i*3+1] = int_y[i];
+ pos_vec[i*3+2] = int_z[i];
+ }
+ Dump(stream, pos_vec);
+ }
}
void LoadBFactors(std::istream& stream, std::vector<Real>& bfactors,
@@ -664,7 +1892,8 @@ namespace{
IntToRealVec(int_vec, occupancies, 0.01);
}
- void DumpOccupancies(std::ostream& stream, const std::vector<Real>& occupancies) {
+ void DumpOccupancies(std::ostream& stream,
+ const std::vector<Real>& occupancies) {
std::vector<int> int_vec;
RealToIntVec(occupancies, int_vec, 100.0);
std::vector<int> run_length_encoded;
@@ -680,7 +1909,8 @@ namespace{
ins_codes.assign(int_vec.begin(), int_vec.end());
}
- void DumpInsertionCodes(std::ostream& stream, const std::vector<char>& ins_codes) {
+ void DumpInsertionCodes(std::ostream& stream,
+ const std::vector<char>& ins_codes) {
std::vector<int> int_vec(ins_codes.begin(), ins_codes.end());
std::vector<int> run_length_encoded;
RunLengthEncoding(int_vec, run_length_encoded);
@@ -707,7 +1937,8 @@ namespace{
Load(stream, indices);
}
- void DumpResDefIndices(std::ostream& stream, const std::vector<int>& indices) {
+ void DumpResDefIndices(std::ostream& stream,
+ const std::vector<int>& indices) {
Dump(stream, indices);
}
@@ -859,7 +2090,8 @@ ResidueDefinition::ResidueDefinition(const ost::mol::ResidueHandle& res) {
std::unordered_map<std::pair<int, int>, int, pair_hash> bond_order_map;
for(auto at_it = at_list.begin(); at_it != at_list.end(); ++at_it) {
ost::mol::BondHandleList bond_list = at_it->GetBondList();
- for(auto bond_it = bond_list.begin(); bond_it != bond_list.end(); ++bond_it) {
+ for(auto bond_it = bond_list.begin(); bond_it != bond_list.end();
+ ++bond_it) {
// The atom represented by at_it is either first OR second atom of that
// bond. So we check whether BOTH are in hash_idx_mapper to exclude bonds
// to other residues.
@@ -917,62 +2149,74 @@ void ResidueDefinition::ToStream(std::ostream& stream) const{
DumpBondOrders(stream, bond_orders);
}
-BioUnitDefinition::BioUnitDefinition(const ost::io::MMCifInfoBioUnit& bu) {
+int ResidueDefinition::GetIdx(const String& aname) const {
+ if(idx_mapper.empty()){
+ _InitIdxMapper();
+ }
+ auto it = idx_mapper.find(aname);
+ if(it == idx_mapper.end()) {
+ return -1;
+ } else {
+ return it->second;
+ }
+}
- au_chains = bu.GetChainList();
+const std::set<int>& ResidueDefinition::GetRotamericAtoms() const {
+ return rotameric_atoms;
+}
- const std::vector<std::pair<int, int> >& bu_ch_intvl = bu.GetChainIntervalList();
- for(auto it = bu_ch_intvl.begin(); it != bu_ch_intvl.end(); ++it) {
- chain_intvl.push_back(it->first);
- chain_intvl.push_back(it->second);
- }
+const std::vector<ChiDefinition>& ResidueDefinition::GetChiDefinitions() const {
+ return chi_definitions;
+}
- const std::vector<std::vector<MMCifInfoTransOpPtr> >& bu_op_list = bu.GetOperations();
- for(auto i = bu_op_list.begin(); i != bu_op_list.end(); ++i) {
- std::vector<geom::Mat4> mat_list;
- for(auto j = i->begin(); j != i->end(); ++j) {
- geom::Mat4 m;
- m.PasteRotation((*j)->GetMatrix());
- m.PasteTranslation((*j)->GetVector());
- mat_list.push_back(m);
- }
- operations.push_back(mat_list);
- }
+const std::vector<SidechainAtomRule>&
+ResidueDefinition::GetSidechainAtomRules() const {
+ return sidechain_atom_rules;
+}
- const std::vector<std::pair<int, int> >& bu_op_intvl = bu.GetOperationsIntervalList();
- for(auto it = bu_op_intvl.begin(); it != bu_op_intvl.end(); ++it) {
- op_intvl.push_back(it->first);
- op_intvl.push_back(it->second);
- }
+int ResidueDefinition::GetNChiAngles() const {
+ return chi_definitions.size();
}
-void BioUnitDefinition::ToStream(std::ostream& stream) const {
- Dump(stream, au_chains);
- Dump(stream, chain_intvl);
- uint32_t size = operations.size();
- stream.write(reinterpret_cast<char*>(&size), sizeof(uint32_t));
- for(auto it = operations.begin(); it != operations.end(); ++it) {
- Dump(stream, *it);
+void ResidueDefinition::_InitIdxMapper() const {
+ idx_mapper.clear();
+ for(size_t i = 0; i < anames.size(); ++i) {
+ idx_mapper[anames[i]] = i;
}
- Dump(stream, op_intvl);
}
-void BioUnitDefinition::FromStream(std::istream& stream) {
- Load(stream, au_chains);
- Load(stream, chain_intvl);
- uint32_t size = 0;
- stream.read(reinterpret_cast<char*>(&size), sizeof(uint32_t));
- operations.resize(size);
- for(uint i = 0; i < size; ++i) {
- Load(stream, operations[i]);
- }
- Load(stream, op_intvl);
+void ResidueDefinition::_AddChiDefinition(int idx_one, int idx_two,
+ int idx_three, int idx_four) {
+ ChiDefinition chi_definition;
+ chi_definition.idx_one = idx_one;
+ chi_definition.idx_two = idx_two;
+ chi_definition.idx_three = idx_three;
+ chi_definition.idx_four = idx_four;
+ chi_definitions.push_back(chi_definition);
+}
+
+void ResidueDefinition::_AddAtomRule(int a_idx, int anch_one_idx,
+ int anch_two_idx, int anch_three_idx,
+ Real bond_length, Real angle,
+ int dihedral_idx,
+ Real base_dihedral) {
+ SidechainAtomRule rule;
+ rule.sidechain_atom_idx = a_idx;
+ rule.anchor_idx[0] = anch_one_idx;
+ rule.anchor_idx[1] = anch_two_idx;
+ rule.anchor_idx[2] = anch_three_idx;
+ rule.bond_length = bond_length;
+ rule.angle = angle;
+ rule.dihedral_idx = dihedral_idx;
+ rule.base_dihedral = base_dihedral;
+ sidechain_atom_rules.push_back(rule);
}
ChainData::ChainData(const ost::mol::ChainHandle& chain,
const std::vector<ResidueDefinition>& residue_definitions,
const std::unordered_map<unsigned long, int>& res_idx_map,
- const std::vector<std::pair<unsigned long, unsigned long> >&
+ const std::vector<std::pair<unsigned long,
+ unsigned long> >&
inter_residue_bonds,
const std::vector<int>& inter_residue_bond_orders,
std::unordered_map<long, int>& atom_idx_mapper) {
@@ -1024,7 +2268,7 @@ ChainData::ChainData(const ost::mol::ChainHandle& chain,
void ChainData::ToStream(std::ostream& stream,
const std::vector<ResidueDefinition>& res_def,
- bool lossy, bool avg_bfactors,
+ Real max_error, bool avg_bfactors,
bool round_bfactors, bool skip_ss) const {
Dump(stream, ch_name);
if(chain_type > std::numeric_limits<int8_t>::max()) {
@@ -1057,7 +2301,192 @@ void ChainData::ToStream(std::ostream& stream,
DumpBFactors(stream, bfactors, round_bfactors);
}
- DumpPositions(stream, positions, lossy);
+ // Lossy means to reduce the accuracy of atom coordinates to one decimal.
+ // In terms of eucledian distance, this gives a max error of 0.087. Enable
+ // lossy compression if we're above.
+ bool lossy = max_error > 0.087;
+ // Even when going lower, we might get some lucky shots with internal
+ // coordinates. However, at some point it's not worth the overhead...
+ bool infer_pos = max_error > 0.05;
+
+ if(infer_pos) {
+
+ int n_res = res_def_indices.size();
+
+ // required info for peptide specific compression
+ BitStorage inference_data;
+ bool inferred_pep_rotamer = false;
+ bool inferred_pep_bb = false;
+ bool inferred_pep_o = false;
+ std::vector<bool> pep_rotamer_compression;
+ std::vector<bool> pep_bb_compression;
+ std::vector<bool> pep_o_compression;
+
+ // all indices that can be inferred come in here and won't be dumped
+ std::vector<std::set<int> > skip_indices(n_res, std::set<int>());
+
+ // check if we have any peptide residue
+ bool pep_present = false;
+ for(int res_idx = 0; res_idx < n_res; ++res_idx) {
+ const ResidueDefinition& def = res_def[res_def_indices[res_idx]];
+ if(def.chem_type == 'A') {
+ pep_present = true;
+ break;
+ }
+ }
+
+ if(pep_present) {
+ // check for peptide specific compressions
+ // same as positions but possibly with reduced accuracy
+ std::vector<geom::Vec3> comp_positions = positions;
+ if(lossy) {
+ for(auto it = comp_positions.begin(); it != comp_positions.end(); ++it) {
+ (*it)[0] = 0.1*std::round((*it)[0]*10);
+ (*it)[1] = 0.1*std::round((*it)[1]*10);
+ (*it)[2] = 0.1*std::round((*it)[2]*10);
+ }
+ }
+
+ // check tripeptides that can reconstruct with error < 0.5A
+ int res_idx = 0;
+ int res_start_idx = 0;
+ while(res_idx < n_res-2) {
+
+ const ResidueDefinition& res_def_one = res_def[res_def_indices[res_idx]];
+ const ResidueDefinition& res_def_two = res_def[res_def_indices[res_idx+1]];
+ const ResidueDefinition& res_def_three = res_def[res_def_indices[res_idx+2]];
+ if(res_def_one.chem_type == 'A' && res_def_two.chem_type == 'A' &&
+ res_def_three.chem_type == 'A') {
+ pep_bb_compression.push_back(EncodeTriPeptide(res_def_one,
+ res_def_two,
+ res_def_three,
+ max_error, positions,
+ res_idx,
+ res_start_idx,
+ skip_indices,
+ comp_positions,
+ inference_data));
+ if(pep_bb_compression.back()) {
+ res_idx += 3;
+ res_start_idx += res_def_one.anames.size();
+ res_start_idx += res_def_two.anames.size();
+ res_start_idx += res_def_three.anames.size();
+ inferred_pep_bb = true;
+ } else {
+ ++res_idx;
+ res_start_idx += res_def_one.anames.size();
+ }
+ } else {
+ // just jump by one residue
+ ++res_idx;
+ res_start_idx += res_def_one.anames.size();
+ }
+ }
+
+ // check which residues fulfill 0.5A threshold when applying rotamer
+ // compression
+ res_start_idx = 0;
+ for(res_idx = 0; res_idx < n_res; ++res_idx) {
+ const ResidueDefinition& def = res_def[res_def_indices[res_idx]];
+ if(def.chem_type == 'A' && !def.GetRotamericAtoms().empty()) {
+ pep_rotamer_compression.push_back(EncodePepRotamer(def, max_error,
+ positions,
+ res_idx,
+ res_start_idx,
+ skip_indices,
+ comp_positions,
+ inference_data));
+ if(pep_rotamer_compression.back()) {
+ inferred_pep_rotamer = true;
+ }
+
+ }
+ res_start_idx += def.anames.size();
+ }
+
+ // check which oxygens can be reconstructed within 0.5A
+ res_start_idx = 0;
+ for(res_idx = 0; res_idx < n_res-1; ++res_idx) {
+ const ResidueDefinition& res_def_one = res_def[res_def_indices[res_idx]];
+ const ResidueDefinition& res_def_two = res_def[res_def_indices[res_idx+1]];
+ int n_atoms = res_def_one.anames.size();
+ if(res_def_one.chem_type == 'A' and res_def_two.chem_type == 'A') {
+ pep_o_compression.push_back(false);
+ int ca_idx = res_def_one.GetIdx("CA");
+ int c_idx = res_def_one.GetIdx("C");
+ int o_idx = res_def_one.GetIdx("O");
+ int oxt_idx = res_def_one.GetIdx("OXT");
+ int n_next_idx = res_def_two.GetIdx("N");
+ if(ca_idx!=-1 && c_idx!=-1 && o_idx!=-1 && n_next_idx!=-1 &&
+ oxt_idx==-1) {
+ geom::Vec3 reconstructed_o;
+ ConstructOPos(comp_positions[res_start_idx + ca_idx],
+ comp_positions[res_start_idx + c_idx],
+ comp_positions[res_start_idx + n_atoms + n_next_idx],
+ reconstructed_o);
+ Real error = geom::Distance(positions[res_start_idx + o_idx],
+ reconstructed_o);
+ if(error < max_error) {
+ pep_o_compression.back() = true;
+ skip_indices[res_idx].insert(o_idx);
+ inferred_pep_o = true;
+ }
+ }
+ }
+ res_start_idx += n_atoms;
+ }
+ } // done peptide compression
+
+ int8_t flags = 0;
+ if(inferred_pep_rotamer) {
+ flags += 1;
+ }
+ if(inferred_pep_bb) {
+ flags += 2;
+ }
+ if(inferred_pep_o) {
+ flags += 4;
+ }
+
+ stream.write(reinterpret_cast<char*>(&flags), sizeof(uint8_t));
+ if(inferred_pep_rotamer) {
+ Dump(stream, pep_rotamer_compression);
+ }
+ if(inferred_pep_bb) {
+ Dump(stream, pep_bb_compression);
+ }
+ if(inferred_pep_o) {
+ Dump(stream, pep_o_compression);
+ }
+ if(inferred_pep_rotamer || inferred_pep_bb) {
+ inference_data.Dump(stream);
+ }
+
+ // construct vector containing all positions that cannot be inferred
+ geom::Vec3List positions_to_dump;
+ int res_start_idx = 0;
+ for(int res_idx = 0; res_idx < n_res; ++res_idx) {
+ const ResidueDefinition& def = res_def[res_def_indices[res_idx]];
+ int res_n_atoms = def.anames.size();
+
+ if(skip_indices[res_idx].empty()) {
+ positions_to_dump.insert(positions_to_dump.end(),
+ positions.begin() + res_start_idx,
+ positions.begin() + res_start_idx + res_n_atoms);
+ } else {
+ for(int at_idx = 0; at_idx < res_n_atoms; ++at_idx) {
+ if(skip_indices[res_idx].find(at_idx) == skip_indices[res_idx].end()) {
+ positions_to_dump.push_back(positions[res_start_idx + at_idx]);
+ }
+ }
+ }
+ res_start_idx += res_n_atoms;
+ }
+ DumpPositions(stream, positions_to_dump, lossy);
+
+ } else {
+ DumpPositions(stream, positions, lossy);
+ }
DumpBonds(stream, bonds);
DumpBondOrders(stream, bond_orders);
if(!skip_ss) {
@@ -1067,15 +2496,14 @@ void ChainData::ToStream(std::ostream& stream,
void ChainData::FromStream(std::istream& stream,
const std::vector<ResidueDefinition>& res_def,
- int version, bool lossy, bool avg_bfactors,
+ int version, Real max_error, bool avg_bfactors,
bool round_bfactors, bool skip_ss) {
Load(stream, ch_name);
- if(version >= 2) {
- int8_t type;
- stream.read(reinterpret_cast<char*>(&type), sizeof(int8_t));
- chain_type = ost::mol::ChainType(type);
- }
+ int8_t type;
+ stream.read(reinterpret_cast<char*>(&type), sizeof(int8_t));
+ chain_type = ost::mol::ChainType(type);
+
LoadResDefIndices(stream, res_def_indices);
LoadRnums(stream, rnums);
LoadInsertionCodes(stream, insertion_codes);
@@ -1091,81 +2519,190 @@ void ChainData::FromStream(std::istream& stream,
} else {
LoadBFactors(stream, bfactors, round_bfactors);
}
- LoadPositions(stream, positions, lossy);
+
+ // Lossy means to reduce the accuracy of atom coordinates to one decimal.
+ // In terms of eucledian distance, this gives a max error of 0.087. Enable
+ // lossy compression if we're above.
+ bool lossy = max_error > 0.087;
+ // Even when going lower, we might get some lucky shots with internal
+ // coordinates. However, at some point it's not worth the overhead...
+ bool infer_pos = max_error > 0.05;
+
+ if(infer_pos) {
+
+ int n_res = res_def_indices.size();
+ int n_at = 0;
+ for(auto it = res_def_indices.begin(); it != res_def_indices.end(); ++it) {
+ n_at += res_def[*it].anames.size();
+ }
+
+ BitStorage inference_data;
+ std::vector<bool> pep_bb_compression;
+ std::vector<bool> pep_rotamer_compression;
+ std::vector<bool> pep_o_compression;
+
+ int8_t flags = 0;
+ stream.read(reinterpret_cast<char*>(&flags), sizeof(uint8_t));
+ if(flags & 1) {
+ Load(stream, pep_rotamer_compression);
+ }
+ if(flags & 2) {
+ Load(stream, pep_bb_compression);
+ }
+ if(flags & 4) {
+ Load(stream, pep_o_compression);
+ }
+ if(flags & 1 || flags & 2) {
+ inference_data = BitStorage::Load(stream);
+ }
+
+ // Check which atoms are inferred from the different compression strategies
+ std::vector<std::set<int> > inferred_indices(n_res);
+
+ if(!pep_bb_compression.empty()) {
+ int res_idx = 0;
+ int bb_comp_idx = 0;
+ while(res_idx < n_res-2) {
+ const ResidueDefinition& res_def_one = res_def[res_def_indices[res_idx]];
+ const ResidueDefinition& res_def_two = res_def[res_def_indices[res_idx+1]];
+ const ResidueDefinition& res_def_three = res_def[res_def_indices[res_idx+2]];
+ if(res_def_one.chem_type == 'A' && res_def_two.chem_type == 'A' &&
+ res_def_three.chem_type == 'A') {
+ if(pep_bb_compression[bb_comp_idx++]) {
+ FillInferredTriPeptideIndices(res_def_one, res_def_two, res_def_three,
+ res_idx, inferred_indices);
+ res_idx += 3;
+ } else {
+ res_idx += 1;
+ }
+ }
+ }
+ }
+
+ if(!pep_rotamer_compression.empty()) {
+ int rot_comp_idx = 0;
+ for(int res_idx = 0; res_idx < n_res; ++res_idx) {
+ const ResidueDefinition& def = res_def[res_def_indices[res_idx]];
+ if(def.chem_type == 'A' && !def.GetRotamericAtoms().empty() &&
+ pep_rotamer_compression[rot_comp_idx++]) {
+ FillInferredRotIndices(def, res_idx, inferred_indices);
+ }
+ }
+ }
+
+ if(!pep_o_compression.empty()) {
+ int o_comp_idx = 0;
+ for(int res_idx = 0; res_idx < n_res-1; ++res_idx) {
+ const ResidueDefinition& res_def_one = res_def[res_def_indices[res_idx]];
+ const ResidueDefinition& res_def_two = res_def[res_def_indices[res_idx+1]];
+ if(res_def_one.chem_type == 'A' && res_def_two.chem_type == 'A' &&
+ pep_o_compression[o_comp_idx++]) {
+ inferred_indices[res_idx].insert(res_def_one.GetIdx("O"));
+ }
+ }
+ }
+
+ // fill the positions we have
+ LoadPositions(stream, positions, lossy);
+ geom::Vec3List full_positions(n_at);
+
+ int pos_idx = 0;
+ int full_pos_idx = 0;
+ for(int res_idx = 0; res_idx < n_res; ++res_idx) {
+ const ResidueDefinition& def = res_def[res_def_indices[res_idx]];
+ int n_res_at = def.anames.size();
+ if(inferred_indices[res_idx].empty()) {
+ for(int i = 0; i < n_res_at; ++i) {
+ full_positions[full_pos_idx++] = positions[pos_idx++];
+ }
+ } else {
+ for(int i = 0; i < n_res_at; ++i) {
+ if(inferred_indices[res_idx].find(i) == inferred_indices[res_idx].end()) {
+ full_positions[full_pos_idx++] = positions[pos_idx++];
+ } else {
+ ++full_pos_idx; // skip
+ }
+ }
+ }
+ }
+
+ // reconstruct the rest
+ if(!pep_bb_compression.empty()) {
+ int res_idx = 0;
+ int bb_comp_idx = 0;
+ int res_start_idx = 0;
+ while(res_idx < n_res-2) {
+ const ResidueDefinition& res_def_one = res_def[res_def_indices[res_idx]];
+ const ResidueDefinition& res_def_two = res_def[res_def_indices[res_idx+1]];
+ const ResidueDefinition& res_def_three = res_def[res_def_indices[res_idx+2]];
+ if(res_def_one.chem_type == 'A' && res_def_two.chem_type == 'A' &&
+ res_def_three.chem_type == 'A') {
+ if(pep_bb_compression[bb_comp_idx++]) {
+ DecodeTriPeptide(res_def_one, res_def_two, res_def_three,
+ res_start_idx, inference_data, full_positions);
+ res_idx += 3;
+ res_start_idx += res_def_one.anames.size();
+ res_start_idx += res_def_two.anames.size();
+ res_start_idx += res_def_three.anames.size();
+ } else {
+ res_idx += 1;
+ res_start_idx += res_def_one.anames.size();
+ }
+ }
+ }
+ }
+
+ if(!pep_rotamer_compression.empty()) {
+ int res_start_idx = 0;
+ int rot_comp_idx = 0;
+ for(int res_idx = 0; res_idx < n_res; ++res_idx) {
+ const ResidueDefinition& def = res_def[res_def_indices[res_idx]];
+ if(def.chem_type == 'A' && !def.GetRotamericAtoms().empty()) {
+ if(pep_rotamer_compression[rot_comp_idx++]) {
+ DecodePepRotamer(def, res_start_idx, inference_data, full_positions);
+ }
+ }
+ res_start_idx += def.anames.size();
+ }
+ }
+
+ if(!pep_o_compression.empty()) {
+ int res_start_idx = 0;
+ int o_comp_idx = 0;
+ for(int res_idx = 0; res_idx < n_res-1; ++res_idx) {
+ const ResidueDefinition& res_def_one = res_def[res_def_indices[res_idx]];
+ const ResidueDefinition& res_def_two = res_def[res_def_indices[res_idx+1]];
+ int n_atoms = res_def_one.anames.size();
+ if(res_def_one.chem_type == 'A' && res_def_two.chem_type == 'A' &&
+ pep_o_compression[o_comp_idx++]) {
+ int ca_idx = res_def_one.GetIdx("CA");
+ int c_idx = res_def_one.GetIdx("C");
+ int o_idx = res_def_one.GetIdx("O");
+ int n_next_idx = res_def_two.GetIdx("N");
+ ConstructOPos(full_positions[res_start_idx + ca_idx],
+ full_positions[res_start_idx + c_idx],
+ full_positions[res_start_idx + n_atoms + n_next_idx],
+ full_positions[res_start_idx + o_idx]);
+ }
+ res_start_idx += n_atoms;
+ }
+ }
+
+ std::swap(positions, full_positions);
+ } else {
+ LoadPositions(stream, positions, lossy);
+ }
LoadBonds(stream, bonds);
LoadBondOrders(stream, bond_orders);
if(skip_ss) {
sec_structures.assign(res_def_indices.size(), 'C');
} else {
- if(version >= 2) {
- LoadSecStructures(stream, sec_structures);
- } else {
- LoadIntVec(stream, sec_structures);
- }
+ LoadSecStructures(stream, sec_structures);
}
}
DefaultPepLib::DefaultPepLib() {
- /* hardcoded constructor created with:
-
- from ost import conop
- def ProcessCompound(comp_name, lib, skip_oxt=True, ca_only=False):
- c = lib.FindCompound(comp_name)
- anames = list()
- idx_mapper = dict()
- element_mapper = dict()
- for a_idx, a in enumerate(c.atom_specs):
- if a.element == "H":
- continue
- if skip_oxt and a.name == "OXT":
- continue
- if ca_only and a.name != "CA":
- continue
- idx_mapper[a_idx] = a.name
- anames.append(a.name)
- element_mapper[a.name] = a.element
- anames.sort()
- bond_data = list()
- for b in c.bond_specs:
- idx_one = b.atom_one
- idx_two = b.atom_two
- if idx_one in idx_mapper and idx_two in idx_mapper:
- aname_one = idx_mapper[idx_one]
- aname_two = idx_mapper[idx_two]
- idx_one = anames.index(aname_one)
- idx_two = anames.index(aname_two)
- if idx_one < idx_two:
- bond_data.append(((idx_one, idx_two), b.order))
- else:
- bond_data.append(((idx_two, idx_one), b.order))
- bond_data.sort()
- print(f" res_def = ResidueDefinition();")
- print(f" res_def.name = \"{comp_name}\";")
- print(f" res_def.olc = '{c.GetOneLetterCode()}';")
- print(f" res_def.chem_type = '{c.chem_type}';")
- print(f" res_def.chem_class = '{c.chem_class}';")
- for aname in anames:
- print(f" res_def.anames.push_back(\"{aname}\");")
- for aname in anames:
- print(f" res_def.elements.push_back(\"{element_mapper[aname]}\");")
- print(f" res_def.is_hetatm.assign({len(anames)}, false);")
- for b in bond_data:
- print(f" res_def.bonds.push_back({b[0][0]});")
- print(f" res_def.bonds.push_back({b[0][1]});")
- for b in bond_data:
- print(f" res_def.bond_orders.push_back({b[1]});")
- print(" residue_definitions.push_back(res_def);")
- print()
- lib = conop.GetDefaultLib()
- anames = ["ALA", "ARG", "ASN", "ASP", "GLN", "GLU", "LYS", "SER", "CYS", "MET",
- "TRP", "TYR", "THR", "VAL", "ILE", "LEU", "GLY", "PRO", "HIS", "PHE"]
- print(" ResidueDefinition res_def;")
- for aname in anames:
- ProcessCompound(aname, lib)
- ProcessCompound(aname, lib, skip_oxt = False)
- ProcessCompound(aname, lib, ca_only=True)
- */
ResidueDefinition res_def;
res_def = ResidueDefinition();
res_def.name = "ALA";
@@ -1300,6 +2837,19 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(2);
+ res_def._AddChiDefinition(6, 1, 2, 4);
+ res_def._AddChiDefinition(1, 2, 4, 3);
+ res_def._AddChiDefinition(2, 4, 3, 7);
+ res_def._AddChiDefinition(4, 3, 7, 5);
+ res_def._AddChiDefinition(3, 7, 5, 8);
+ res_def._AddAtomRule(4, 6, 1, 2, 1.5209, 1.9872, 0, 0.0); // CG
+ res_def._AddAtomRule(3, 1, 2, 4, 1.5220, 1.9507, 1, 0.0); // CD
+ res_def._AddAtomRule(7, 2, 4, 3, 1.4604, 1.9486, 2, 0.0); // NE
+ res_def._AddAtomRule(5, 4, 3, 7, 1.3304, 2.1771, 3, 0.0); // CZ
+ res_def._AddAtomRule(8, 3, 7, 5, 1.3287, 2.1053, 4, 0.0); // NH1
+ res_def._AddAtomRule(9, 3, 7, 5, 1.3272, 2.0893, 4, M_PI); // NH2
+ res_def.rotameric_atoms.insert({4, 3, 7, 5, 8, 9});
+ res_def.critical_sidechain_angles.insert({3, 4, 5, 7});
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -1365,6 +2915,11 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(2);
+ // same rotamer information as previous one
+ res_def.chi_definitions = residue_definitions.back().chi_definitions;
+ res_def.sidechain_atom_rules = residue_definitions.back().sidechain_atom_rules;
+ res_def.rotameric_atoms = residue_definitions.back().rotameric_atoms;
+ res_def.critical_sidechain_angles = residue_definitions.back().critical_sidechain_angles;
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -1420,6 +2975,13 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(2);
+ res_def._AddChiDefinition(4, 1, 2, 3);
+ res_def._AddChiDefinition(1, 2, 3, 7);
+ res_def._AddAtomRule(3, 4, 1, 2, 1.5154, 1.9661, 0, 0.0); // CG
+ res_def._AddAtomRule(7, 1, 2, 3, 1.2329, 2.1098, 1, 0.0); // OD1
+ res_def._AddAtomRule(5, 1, 2, 3, 1.3272, 2.0328, 1, M_PI); // ND2
+ res_def.rotameric_atoms.insert({3, 7, 5});
+ res_def.critical_sidechain_angles.insert({3});
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -1470,6 +3032,11 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(2);
+ // same rotamer information as previous one
+ res_def.chi_definitions = residue_definitions.back().chi_definitions;
+ res_def.sidechain_atom_rules = residue_definitions.back().sidechain_atom_rules;
+ res_def.rotameric_atoms = residue_definitions.back().rotameric_atoms;
+ res_def.critical_sidechain_angles = residue_definitions.back().critical_sidechain_angles;
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -1525,6 +3092,13 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(2);
res_def.bond_orders.push_back(1);
+ res_def._AddChiDefinition(4, 1, 2, 3);
+ res_def._AddChiDefinition(1, 2, 3, 6);
+ res_def._AddAtomRule(3, 4, 1, 2, 1.5192, 1.9737, 0, 0.0); // CG
+ res_def._AddAtomRule(6, 1, 2, 3, 1.2505, 2.0798, 1, 0.0); // OD1
+ res_def._AddAtomRule(7, 1, 2, 3, 1.2508, 2.0593, 1, M_PI); // OD2
+ res_def.rotameric_atoms.insert({3, 6, 7});
+ res_def.critical_sidechain_angles.insert({3});
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -1575,6 +3149,11 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(2);
res_def.bond_orders.push_back(1);
+ // same rotamer information as previous one
+ res_def.chi_definitions = residue_definitions.back().chi_definitions;
+ res_def.sidechain_atom_rules = residue_definitions.back().sidechain_atom_rules;
+ res_def.rotameric_atoms = residue_definitions.back().rotameric_atoms;
+ res_def.critical_sidechain_angles = residue_definitions.back().critical_sidechain_angles;
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -1635,6 +3214,15 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(2);
+ res_def._AddChiDefinition(5, 1, 2, 4);
+ res_def._AddChiDefinition(1, 2, 4, 3);
+ res_def._AddChiDefinition(2, 4, 3, 8);
+ res_def._AddAtomRule(4, 5, 1, 2, 1.52, 1.9853, 0, 0.0); // CG
+ res_def._AddAtomRule(3, 1, 2, 4, 1.52, 1.9684, 1, 0.0); // CD
+ res_def._AddAtomRule(8, 2, 4, 3, 1.24, 2.1094, 2, 0.0); // OE1
+ res_def._AddAtomRule(6, 2, 4, 3, 1.33, 2.0333, 2, M_PI); // NE2
+ res_def.rotameric_atoms.insert({4, 3, 8, 6});
+ res_def.critical_sidechain_angles.insert({3, 4});
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -1690,6 +3278,11 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(2);
+ // same rotamer information as previous one
+ res_def.chi_definitions = residue_definitions.back().chi_definitions;
+ res_def.sidechain_atom_rules = residue_definitions.back().sidechain_atom_rules;
+ res_def.rotameric_atoms = residue_definitions.back().rotameric_atoms;
+ res_def.critical_sidechain_angles = residue_definitions.back().critical_sidechain_angles;
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -1750,6 +3343,15 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(2);
res_def.bond_orders.push_back(1);
+ res_def._AddChiDefinition(5, 1, 2, 4);
+ res_def._AddChiDefinition(1, 2, 4, 3);
+ res_def._AddChiDefinition(2, 4, 3, 7);
+ res_def._AddAtomRule(4, 5, 1, 2, 1.5215, 1.9869, 0, 0.0); // CG
+ res_def._AddAtomRule(3, 1, 2, 4, 1.5212, 1.9786, 1, 0.0); // CD
+ res_def._AddAtomRule(7, 2, 4, 3, 1.2522, 2.0762, 2, 0.0); // OE1
+ res_def._AddAtomRule(8, 2, 4, 3, 1.2516, 2.0610, 2, M_PI); // OE2
+ res_def.rotameric_atoms.insert({4, 3, 7, 8});
+ res_def.critical_sidechain_angles.insert({3, 4});
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -1805,6 +3407,11 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(2);
res_def.bond_orders.push_back(1);
+ // same rotamer information as previous one
+ res_def.chi_definitions = residue_definitions.back().chi_definitions;
+ res_def.sidechain_atom_rules = residue_definitions.back().sidechain_atom_rules;
+ res_def.rotameric_atoms = residue_definitions.back().rotameric_atoms;
+ res_def.critical_sidechain_angles = residue_definitions.back().critical_sidechain_angles;
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -1865,6 +3472,16 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
+ res_def._AddChiDefinition(6, 1, 2, 5);
+ res_def._AddChiDefinition(1, 2, 5, 3);
+ res_def._AddChiDefinition(2, 5, 3, 4);
+ res_def._AddChiDefinition(5, 3, 4, 7);
+ res_def._AddAtomRule(5, 6, 1, 2, 1.5217, 1.9903, 0, 0.0); // CG
+ res_def._AddAtomRule(3, 1, 2, 5, 1.5230, 1.9488, 1, 0.0); // CD
+ res_def._AddAtomRule(4, 2, 5, 3, 1.5215, 1.9493, 2, 0.0); // CE
+ res_def._AddAtomRule(7, 5, 3, 4, 1.4922, 1.9498, 3, 0.0); // NZ
+ res_def.rotameric_atoms.insert({5, 3, 4, 7});
+ res_def.critical_sidechain_angles.insert({3, 4, 5});
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -1920,6 +3537,11 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
+ // same rotamer information as previous one
+ res_def.chi_definitions = residue_definitions.back().chi_definitions;
+ res_def.sidechain_atom_rules = residue_definitions.back().sidechain_atom_rules;
+ res_def.rotameric_atoms = residue_definitions.back().rotameric_atoms;
+ res_def.critical_sidechain_angles = residue_definitions.back().critical_sidechain_angles;
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -1965,6 +3587,9 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
+ res_def._AddChiDefinition(3, 1, 2, 5);
+ res_def._AddAtomRule(5, 3, 1, 2, 1.4171, 1.9335, 0, 0.0); // OG
+ res_def.rotameric_atoms.insert(5);
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -2005,6 +3630,10 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
+ // same rotamer information as previous one
+ res_def.chi_definitions = residue_definitions.back().chi_definitions;
+ res_def.sidechain_atom_rules = residue_definitions.back().sidechain_atom_rules;
+ res_def.rotameric_atoms = residue_definitions.back().rotameric_atoms;
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -2050,6 +3679,9 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
+ res_def._AddChiDefinition(3, 1, 2, 5);
+ res_def._AddAtomRule(5, 3, 1, 2, 1.8072, 1.9860, 0, 0.0); // SG
+ res_def.rotameric_atoms.insert(5);
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -2090,6 +3722,9 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
+ res_def._AddChiDefinition(3, 1, 2, 6);
+ res_def._AddAtomRule(6, 3, 1, 2, 1.808, 1.9865, 0, 0.0); // SG
+ res_def.rotameric_atoms.insert(6);
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -2145,6 +3780,14 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
+ res_def._AddChiDefinition(5, 1, 2, 4);
+ res_def._AddChiDefinition(1, 2, 4, 7);
+ res_def._AddChiDefinition(2, 4, 7, 3);
+ res_def._AddAtomRule(4, 5, 1, 2, 1.5199, 1.9856, 0, 0.0); // CG
+ res_def._AddAtomRule(7, 1, 2, 4, 1.8063, 1.9668, 1, 0.0); // SD
+ res_def._AddAtomRule(3, 2, 4, 7, 1.7868, 1.7561, 2, 0.0); // CE
+ res_def.rotameric_atoms.insert({4, 7, 3});
+ res_def.critical_sidechain_angles.insert({4, 7});
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -2195,6 +3838,14 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
+ res_def._AddChiDefinition(5, 1, 2, 4);
+ res_def._AddChiDefinition(1, 2, 4, 8);
+ res_def._AddChiDefinition(2, 4, 8, 3);
+ res_def._AddAtomRule(4, 5, 1, 2, 1.5199, 1.9856, 0, 0.0); // CG
+ res_def._AddAtomRule(8, 1, 2, 4, 1.8063, 1.9668, 1, 0.0); // SD
+ res_def._AddAtomRule(3, 2, 4, 8, 1.7868, 1.7561, 2, 0.0); // CE
+ res_def.rotameric_atoms.insert({4, 8, 3});
+ res_def.critical_sidechain_angles.insert({4, 8});
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -2286,6 +3937,19 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(2);
res_def.bond_orders.push_back(2);
res_def.bond_orders.push_back(1);
+ res_def._AddChiDefinition(11, 1, 2, 7);
+ res_def._AddChiDefinition(1, 2, 7, 3);
+ res_def._AddAtomRule(7, 11, 1, 2, 1.4986, 1.9896, 0, 0.0); // CG
+ res_def._AddAtomRule(3, 1, 2, 7, 1.3674, 2.2179, 1, 0.0); // CD1
+ res_def._AddAtomRule(4, 1, 2, 7, 1.4330, 2.2097, 1, M_PI); // CD2
+ res_def._AddAtomRule(5, 3, 7, 4, 1.4127, 1.8710, 5, 0.0); // CE2
+ res_def._AddAtomRule(12, 2, 7, 3, 1.3749, 1.9219, 5, M_PI); // NE1
+ res_def._AddAtomRule(6, 3, 7, 4, 1.4001, 2.3370, 5, M_PI); // CE3
+ res_def._AddAtomRule(10, 5, 4, 6, 1.3882, 2.0715, 5, 0.0); // CZ3
+ res_def._AddAtomRule(8, 4, 6, 10, 1.4025, 2.1130, 5, 0.0); // CH2
+ res_def._AddAtomRule(9, 6, 10, 8, 1.3714, 2.1213, 5, 0.0); // CZ2
+ res_def.rotameric_atoms.insert({7, 3, 4, 5, 12, 6, 10, 8, 9});
+ res_def.critical_sidechain_angles.insert({3, 4, 6, 7, 8, 10});
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -2372,6 +4036,11 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(2);
res_def.bond_orders.push_back(2);
res_def.bond_orders.push_back(1);
+ // same rotamer information as previous one
+ res_def.chi_definitions = residue_definitions.back().chi_definitions;
+ res_def.sidechain_atom_rules = residue_definitions.back().sidechain_atom_rules;
+ res_def.rotameric_atoms = residue_definitions.back().rotameric_atoms;
+ res_def.critical_sidechain_angles = residue_definitions.back().critical_sidechain_angles;
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -2450,6 +4119,17 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(2);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
+ res_def._AddChiDefinition(9, 1, 2, 7);
+ res_def._AddChiDefinition(1, 2, 7, 3);
+ res_def._AddAtomRule(7, 9, 1, 2, 1.5104, 1.9853, 0, 0.0); // CG
+ res_def._AddAtomRule(3, 1, 2, 7, 1.3910, 2.1111, 1, 0.0); // CD1
+ res_def._AddAtomRule(4, 1, 2, 7, 1.3903, 2.1093, 1, M_PI); // CD2
+ res_def._AddAtomRule(5, 4, 7, 3, 1.3888, 2.1144, 5, 0.0); // CE1
+ res_def._AddAtomRule(6, 3, 7, 4, 1.3885, 2.1147, 5, 0.0); // CE2
+ res_def._AddAtomRule(8, 7, 3, 5, 1.3814, 2.0866, 5, 0.0); // CZ
+ res_def._AddAtomRule(11, 3, 5, 8, 1.3771, 2.0909, 5, M_PI); // OH
+ res_def.rotameric_atoms.insert({7, 3, 4, 5, 6, 8, 11});
+ res_def.critical_sidechain_angles.insert({3, 4, 5, 7, 8});
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -2523,6 +4203,11 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(2);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
+ // same rotamer information as previous one
+ res_def.chi_definitions = residue_definitions.back().chi_definitions;
+ res_def.sidechain_atom_rules = residue_definitions.back().sidechain_atom_rules;
+ res_def.rotameric_atoms = residue_definitions.back().rotameric_atoms;
+ res_def.critical_sidechain_angles = residue_definitions.back().critical_sidechain_angles;
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -2573,6 +4258,10 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
+ res_def._AddChiDefinition(4, 1, 2, 6);
+ res_def._AddAtomRule(6, 4, 1, 2, 1.4323, 1.9059, 0, 0.0); // OG1
+ res_def._AddAtomRule(3, 6, 1, 2, 1.5239, 1.9412, 5, -2.1068); // CG2
+ res_def.rotameric_atoms.insert({6, 3});
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -2618,6 +4307,10 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
+ // same rotamer information as previous one
+ res_def.chi_definitions = residue_definitions.back().chi_definitions;
+ res_def.sidechain_atom_rules = residue_definitions.back().sidechain_atom_rules;
+ res_def.rotameric_atoms = residue_definitions.back().rotameric_atoms;
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -2668,6 +4361,10 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
+ res_def._AddChiDefinition(5, 1, 2, 3);
+ res_def._AddAtomRule(3, 5, 1, 2, 1.5262, 1.9338, 0, 0.0); // CG1
+ res_def._AddAtomRule(4, 3, 1, 2, 1.5257, 1.9294, 5, 2.1478); // CG2
+ res_def.rotameric_atoms.insert({3, 4});
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -2713,6 +4410,10 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
+ // same rotamer information as previous one
+ res_def.chi_definitions = residue_definitions.back().chi_definitions;
+ res_def.sidechain_atom_rules = residue_definitions.back().sidechain_atom_rules;
+ res_def.rotameric_atoms = residue_definitions.back().rotameric_atoms;
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -2768,6 +4469,13 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
+ res_def._AddChiDefinition(6, 1, 2, 4);
+ res_def._AddChiDefinition(1, 2, 4, 3);
+ res_def._AddAtomRule(4, 6, 1, 2, 1.5331, 1.9286, 0, 0.0); // CG1
+ res_def._AddAtomRule(5, 4, 1, 2, 1.5300, 1.9320, 5, -2.1534); // CG2
+ res_def._AddAtomRule(3, 1, 2, 4, 1.5194, 1.9887, 1, 0.0); // CD1
+ res_def.rotameric_atoms.insert({4, 5, 3});
+ res_def.critical_sidechain_angles.insert({4});
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -2818,6 +4526,11 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
+ // same rotamer information as previous one
+ res_def.chi_definitions = residue_definitions.back().chi_definitions;
+ res_def.sidechain_atom_rules = residue_definitions.back().sidechain_atom_rules;
+ res_def.rotameric_atoms = residue_definitions.back().rotameric_atoms;
+ res_def.critical_sidechain_angles = residue_definitions.back().critical_sidechain_angles;
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -2873,6 +4586,13 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
+ res_def._AddChiDefinition(6, 1, 2, 5);
+ res_def._AddChiDefinition(1, 2, 5, 3);
+ res_def._AddAtomRule(5, 6, 1, 2, 1.5298, 2.0276, 0, 0.0); // CG
+ res_def._AddAtomRule(3, 1, 2, 5, 1.5236, 1.9276, 1, 0.0); // CD1
+ res_def._AddAtomRule(4, 3, 2, 5, 1.5242, 1.9316, 5, 2.1459); // CD2
+ res_def.rotameric_atoms.insert({5, 3, 4});
+ res_def.critical_sidechain_angles.insert({5});
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -2923,6 +4643,11 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
+ // same rotamer information as previous one
+ res_def.chi_definitions = residue_definitions.back().chi_definitions;
+ res_def.sidechain_atom_rules = residue_definitions.back().sidechain_atom_rules;
+ res_def.rotameric_atoms = residue_definitions.back().rotameric_atoms;
+ res_def.critical_sidechain_angles = residue_definitions.back().critical_sidechain_angles;
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -3041,6 +4766,12 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
+ res_def._AddChiDefinition(5, 1, 2, 4);
+ res_def._AddChiDefinition(1, 2, 4, 3);
+ res_def._AddAtomRule(4, 5, 1, 2, 1.4955, 1.8224, 0, 0.0); // CG
+ res_def._AddAtomRule(3, 1, 2, 4, 1.5063, 1.8391, 1, 0.0); // CD
+ res_def.rotameric_atoms.insert({4, 3});
+ res_def.critical_sidechain_angles.insert({4});
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -3089,6 +4820,10 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
+ // same rotamer information as previous one
+ res_def.chi_definitions = residue_definitions.back().chi_definitions;
+ res_def.sidechain_atom_rules = residue_definitions.back().sidechain_atom_rules;
+ res_def.rotameric_atoms = residue_definitions.back().rotameric_atoms;
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -3157,6 +4892,15 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(2);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
+ res_def._AddChiDefinition(6, 1, 2, 5);
+ res_def._AddChiDefinition(1, 2, 5, 7);
+ res_def._AddAtomRule(5, 6, 1, 2, 1.4953, 1.9832, 0, 0.0); // CG
+ res_def._AddAtomRule(7, 1, 2, 5, 1.3783, 2.1399, 1, 0.0); // ND1
+ res_def._AddAtomRule(3, 1, 2, 5, 1.3551, 2.2869, 1, M_PI); // CD2
+ res_def._AddAtomRule(4, 3, 5, 7, 1.3234, 1.9046, 5, 0.0); // CE1
+ res_def._AddAtomRule(8, 7, 5, 3, 1.3734, 1.8712, 5, 0.0); // NE2
+ res_def.rotameric_atoms.insert({5, 7, 3, 4, 8});
+ res_def.critical_sidechain_angles.insert({3, 5, 7});
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -3220,6 +4964,11 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(2);
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(1);
+ // same rotamer information as previous one
+ res_def.chi_definitions = residue_definitions.back().chi_definitions;
+ res_def.sidechain_atom_rules = residue_definitions.back().sidechain_atom_rules;
+ res_def.rotameric_atoms = residue_definitions.back().rotameric_atoms;
+ res_def.critical_sidechain_angles = residue_definitions.back().critical_sidechain_angles;
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -3293,6 +5042,16 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(2);
res_def.bond_orders.push_back(1);
+ res_def._AddChiDefinition(9, 1, 2, 7);
+ res_def._AddChiDefinition(1, 2, 7, 3);
+ res_def._AddAtomRule(7, 9, 1, 2, 1.5043, 1.9866, 0, 0.0); // CG
+ res_def._AddAtomRule(3, 1, 2, 7, 1.3883, 2.1071, 1, 0.0); // CD1
+ res_def._AddAtomRule(4, 1, 2, 7, 1.3879, 2.1039, 1, M_PI); // CD2
+ res_def._AddAtomRule(5, 4, 7, 3, 1.3906, 2.1079, 5, 0.0); // CE1
+ res_def._AddAtomRule(6, 3, 7, 4, 1.3902, 2.1082, 5, 0.0); // CE2
+ res_def._AddAtomRule(8, 7, 3, 5, 1.3832, 2.0928, 5, 0.0); // CZ
+ res_def.rotameric_atoms.insert({7, 3, 4, 5, 6, 8});
+ res_def.critical_sidechain_angles.insert({3, 4, 5, 7});
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -3361,6 +5120,11 @@ DefaultPepLib::DefaultPepLib() {
res_def.bond_orders.push_back(1);
res_def.bond_orders.push_back(2);
res_def.bond_orders.push_back(1);
+ // same rotamer information as previous one
+ res_def.chi_definitions = residue_definitions.back().chi_definitions;
+ res_def.sidechain_atom_rules = residue_definitions.back().sidechain_atom_rules;
+ res_def.rotameric_atoms = residue_definitions.back().rotameric_atoms;
+ res_def.critical_sidechain_angles = residue_definitions.back().critical_sidechain_angles;
residue_definitions.push_back(res_def);
res_def = ResidueDefinition();
@@ -3375,10 +5139,16 @@ DefaultPepLib::DefaultPepLib() {
}
OMFPtr OMF::FromEntity(const ost::mol::EntityHandle& ent,
+ Real max_error,
uint8_t options) {
+ if(max_error < 0.0 || max_error > 10.0) {
+ throw ost::Error("max_error must be in [0.0, 10.0]");
+ }
+
OMFPtr omf(new OMF);
omf->name_ = ent.GetName();
+ omf->max_error_ = 1000 * max_error;
omf->options_ = options;
omf->version_ = OMF_VERSION;
@@ -3470,7 +5240,7 @@ OMFPtr OMF::FromEntity(const ost::mol::EntityHandle& ent,
}
int idx = chain_idx_map[at_one.GetResidue().GetChain().GetHashCode()];
inter_residue_bonds[idx].push_back(std::make_pair(at_one.GetHashCode(),
- at_two.GetHashCode()));
+ at_two.GetHashCode()));
inter_residue_bond_orders[idx].push_back(bond_it->GetBondOrder());
}
} else {
@@ -3515,18 +5285,6 @@ OMFPtr OMF::FromEntity(const ost::mol::EntityHandle& ent,
return omf;
}
-OMFPtr OMF::FromMMCIF(const ost::mol::EntityHandle& ent,
- const MMCifInfo& info,
- uint8_t options) {
-
- OMFPtr p = OMF::FromEntity(ent, options);
- const std::vector<MMCifInfoBioUnit>& biounits = info.GetBioUnits();
- for(auto it = biounits.begin(); it != biounits.end(); ++it) {
- p->biounit_definitions_.push_back(BioUnitDefinition(*it));
- }
- return p;
-}
-
OMFPtr OMF::FromFile(const String& fn) {
std::ifstream in_stream(fn.c_str(), std::ios::binary);
if (!in_stream) {
@@ -3565,7 +5323,7 @@ ost::mol::EntityHandle OMF::GetAU() const{
for(auto it = chain_data_.begin(); it!=chain_data_.end(); ++it) {
ost::mol::ChainHandle ch = ed.InsertChain(it->first);
- this->FillChain(ch, ed, it->second);
+ this->FillChain(it->second, ed, ch);
}
// deal with inter-chain bonds
@@ -3591,80 +5349,20 @@ ost::mol::EntityHandle OMF::GetAUChain(const String& name) const{
ent.SetName(ss.str());
ost::mol::XCSEditor ed = ent.EditXCS(mol::BUFFERED_EDIT);
ost::mol::ChainHandle ch = ed.InsertChain(name);
- this->FillChain(ch, ed, chain_data_.at(name));
- return ent;
-}
-
-ost::mol::EntityHandle OMF::GetBU(int bu_idx) const{
- if(bu_idx < 0 || bu_idx >= static_cast<int>(biounit_definitions_.size())) {
- throw ost::Error("Invalid biounit idx");
- }
-
- const BioUnitDefinition& bu = biounit_definitions_[bu_idx];
- ost::mol::EntityHandle ent = mol::CreateEntity();
- std::stringstream ss;
- ss << name_ << " " << bu_idx;
- ent.SetName(ss.str());
- ost::mol::XCSEditor ed = ent.EditXCS(mol::BUFFERED_EDIT);
-
- std::vector<String> au_chain_names;
- std::vector<geom::Mat4> transforms;
-
- // The code below is pure magic and heavily inspired by
- // the biounit buildup in modules/io/pymod/__init__.py
- int n_intervals = bu.chain_intvl.size() / 2;
- for(int intvl_idx = 0; intvl_idx < n_intervals; ++intvl_idx) {
- std::vector<geom::Mat4> rts;
- int op_start = bu.op_intvl[2*intvl_idx];
- int op_end = bu.op_intvl[2*intvl_idx+1];
- int n_intv_ops = op_end - op_start;
- if(n_intv_ops) {
- for(auto it = bu.operations[op_start].begin();
- it != bu.operations[op_start].end(); ++it) {
- rts.push_back(*it);
- }
- ++op_start;
- while(op_start < op_end) {
- std::vector<geom::Mat4> tmp_rts;
- for(auto i = bu.operations[op_start].begin();
- i != bu.operations[op_start].end(); ++i) {
- for(auto j = rts.begin(); j != rts.end(); ++j) {
- tmp_rts.push_back((*j)*(*i));
- }
- }
- rts = tmp_rts;
- ++op_start;
- }
- }
- for(int ch_idx = bu.chain_intvl[2*intvl_idx];
- ch_idx < bu.chain_intvl[2*intvl_idx+1]; ++ch_idx) {
- for(auto it = rts.begin(); it != rts.end(); ++it) {
- au_chain_names.push_back(bu.au_chains[ch_idx]);
- transforms.push_back(*it);
- }
- }
- }
-
- ChainNameGenerator gen;
- for(uint bu_ch_idx = 0; bu_ch_idx < au_chain_names.size(); ++bu_ch_idx) {
- String bu_ch_name = gen.Get();
- ost::mol::ChainHandle added_chain = ed.InsertChain(bu_ch_name);
- this->FillChain(added_chain, ed, chain_data_.at(au_chain_names[bu_ch_idx]),
- transforms[bu_ch_idx]);
- }
-
+ this->FillChain(chain_data_.at(name), ed, ch);
return ent;
}
void OMF::ToStream(std::ostream& stream) const {
- uint32_t magic_number = 42;
- stream.write(reinterpret_cast<char*>(&magic_number), sizeof(uint32_t));
+ uint16_t magic_number = 42;
+ stream.write(reinterpret_cast<char*>(&magic_number), sizeof(uint16_t));
// We set it to the current version...
// If you loaded a structure from a previous version and you dump it again,
// the version will be updated.
- uint32_t version = version_;
- stream.write(reinterpret_cast<char*>(&version), sizeof(uint32_t));
+ uint8_t version = version_;
+ stream.write(reinterpret_cast<char*>(&version), sizeof(uint8_t));
+ stream.write(reinterpret_cast<const char*>(&max_error_), sizeof(uint16_t));
stream.write(reinterpret_cast<const char*>(&options_), sizeof(uint8_t));
DumpName(stream, name_);
@@ -3680,8 +5378,7 @@ void OMF::ToStream(std::ostream& stream) const {
Dump(stream, residue_definitions_);
}
- Dump(stream, biounit_definitions_);
- Dump(stream, chain_data_, residue_definitions_, OptionSet(LOSSY),
+ Dump(stream, chain_data_, residue_definitions_, this->GetMaxError(),
OptionSet(AVG_BFACTORS), OptionSet(ROUND_BFACTORS), OptionSet(SKIP_SS));
Dump(stream, bond_chain_names_);
Dump(stream, bond_atoms_);
@@ -3690,26 +5387,26 @@ void OMF::ToStream(std::ostream& stream) const {
void OMF::FromStream(std::istream& stream) {
- uint32_t magic_number;
- stream.read(reinterpret_cast<char*>(&magic_number), sizeof(uint32_t));
+ uint16_t magic_number;
+ stream.read(reinterpret_cast<char*>(&magic_number), sizeof(uint16_t));
if(magic_number != 42) {
throw ost::Error("Cannot read corrupted OMF stream");
}
- uint32_t version;
- stream.read(reinterpret_cast<char*>(&version), sizeof(uint32_t));
- if(version != 1 && version != 2) {
+ uint8_t version;
+ stream.read(reinterpret_cast<char*>(&version), sizeof(uint8_t));
+ if(version < 3) {
std::stringstream ss;
- ss << "OST version only supports OMF version 1 and 2. Got "<<version;
+ ss << "Old OMF versions are deprecated. Can only load versions >= 3, ";
+ ss << "got "<<version;
throw ost::Error(ss.str());
}
version_ = version;
- if(version_ > 1) {
- stream.read(reinterpret_cast<char*>(&options_), sizeof(uint8_t));
- LoadName(stream, name_);
- }
+ stream.read(reinterpret_cast<char*>(&max_error_), sizeof(uint16_t));
+ stream.read(reinterpret_cast<char*>(&options_), sizeof(uint8_t));
+ LoadName(stream, name_);
if(OptionSet(DEFAULT_PEPLIB)) {
// load residue definitions from default lib and append custom definitions
@@ -3723,8 +5420,7 @@ void OMF::FromStream(std::istream& stream) {
Load(stream, residue_definitions_);
}
- Load(stream, biounit_definitions_);
- Load(stream, chain_data_, residue_definitions_, version_, OptionSet(LOSSY),
+ Load(stream, chain_data_, residue_definitions_, version_, this->GetMaxError(),
OptionSet(AVG_BFACTORS), OptionSet(ROUND_BFACTORS), OptionSet(SKIP_SS));
Load(stream, bond_chain_names_);
Load(stream, bond_atoms_);
@@ -3735,26 +5431,11 @@ void OMF::FromStream(std::istream& stream) {
}
}
-void OMF::FillChain(ost::mol::ChainHandle& chain, ost::mol::XCSEditor& ed,
- const ChainDataPtr data, geom::Mat4 t) const {
+void OMF::FillChain(const ChainDataPtr data, ost::mol::XCSEditor& ed,
+ ost::mol::ChainHandle& chain) const {
ed.SetChainType(chain, data->chain_type);
- geom::Vec3List* positions = &data->positions;
- geom::Vec3List transformed_positions; // only filled if non-identity transform
- if(t != geom::Mat4()) {
- transformed_positions.resize(positions->size());
- Real a,b,c;
- for (uint i = 0; i < transformed_positions.size(); ++i) {
- const geom::Vec3& p = data->positions[i];
- a = t(0,0)*p[0]+t(0,1)*p[1]+t(0,2)*p[2]+t(0,3);
- b = t(1,0)*p[0]+t(1,1)*p[1]+t(1,2)*p[2]+t(1,3);
- c = t(2,0)*p[0]+t(2,1)*p[1]+t(2,2)*p[2]+t(2,3);
- transformed_positions[i][0] = a;
- transformed_positions[i][1] = b;
- transformed_positions[i][2] = c;
- }
- positions = &transformed_positions; // bend around
- }
+ const geom::Vec3List& positions = data->positions;
int at_idx = 0;
for(uint res_idx = 0; res_idx < data->res_def_indices.size(); ++res_idx) {
@@ -3769,7 +5450,7 @@ void OMF::FillChain(ost::mol::ChainHandle& chain, ost::mol::XCSEditor& ed,
res.SetSecStructure(ost::mol::SecStructure(data->sec_structures[res_idx]));
for(uint i = 0; i < res_def.anames.size(); ++i) {
- ed.InsertAtom(res, res_def.anames[i], (*positions)[at_idx],
+ ed.InsertAtom(res, res_def.anames[i], positions[at_idx],
res_def.elements[i], data->occupancies[at_idx],
data->bfactors[at_idx], res_def.is_hetatm[i]);
++at_idx;
@@ -3799,8 +5480,9 @@ void OMF::FillChain(ost::mol::ChainHandle& chain, ost::mol::XCSEditor& ed,
Real d = geom::Distance(c.GetPos(), n.GetPos());
if(d > 0.991 && d < 1.681) {
// mean (1.336) +- 15 stds (0.023)
- // This is an extremely loose threshold but makes sure to also handle
- // inaccuracies that have been introduced with lossy compression
+ // This is an extremely loose threshold but makes sure to also
+ // handle inaccuracies that have been introduced with lossy
+ // compression
ed.Connect(c, n);
}
}
diff --git a/modules/io/src/mol/omf.hh b/modules/io/src/mol/omf.hh
index 9503b1f541a928b1a3f3730a39fffc60bbab36c4..7fd8dd331f315bbe5a4ea0f3967c40ef1d8e6339 100644
--- a/modules/io/src/mol/omf.hh
+++ b/modules/io/src/mol/omf.hh
@@ -30,14 +30,32 @@
namespace ost { namespace io {
-const int OMF_VERSION = 2;
+const int OMF_VERSION = 3;
class ChainData;
-class BioUnitData;
class OMF;
typedef boost::shared_ptr<OMF> OMFPtr;
typedef boost::shared_ptr<ChainData> ChainDataPtr;
-typedef boost::shared_ptr<BioUnitData> BioUnitDataPtr;
+
+struct SidechainAtomRule {
+ int sidechain_atom_idx;
+ int anchor_idx[3];
+ Real bond_length;
+ Real angle;
+ // 0: chi1, 1: chi2, 2: chi3, 3: chi4, 4: 0.0
+ int dihedral_idx;
+ // the value of the dihedral above will be added to base_dihedral to get
+ // the final diheral angle. If you want to have the effect of chi3 + M_PI
+ // you define dihedral_idx as 2 and base_dihedral = M_PI.
+ Real base_dihedral;
+};
+
+struct ChiDefinition{
+ int idx_one;
+ int idx_two;
+ int idx_three;
+ int idx_four;
+};
struct ResidueDefinition {
@@ -65,6 +83,26 @@ struct ResidueDefinition {
void FromStream(std::istream& stream);
+ int GetIdx(const String& aname) const;
+
+ const std::set<int>& GetRotamericAtoms() const;
+
+ const std::vector<ChiDefinition>& GetChiDefinitions() const;
+
+ const std::vector<SidechainAtomRule>& GetSidechainAtomRules() const;
+
+ int GetNChiAngles() const;
+
+ void _InitIdxMapper() const;
+
+ void _AddChiDefinition(int idx_one, int idx_two, int idx_three,
+ int idx_four);
+
+ void _AddAtomRule(int a_idx, int anch_one_idx,
+ int anch_two_idx, int anch_three_idx,
+ Real bond_length, Real angle, int dihedral_idx,
+ Real base_dihedral);
+
String name;
char olc;
char chem_type;
@@ -74,25 +112,13 @@ struct ResidueDefinition {
std::vector<bool> is_hetatm;
std::vector<int> bonds;
std::vector<int> bond_orders;
+ mutable std::map<String, int> idx_mapper;
+ std::set<int> rotameric_atoms;
+ std::vector<ChiDefinition> chi_definitions;
+ std::vector<SidechainAtomRule> sidechain_atom_rules;
+ std::set<int> critical_sidechain_angles;
};
-
-struct BioUnitDefinition {
- BioUnitDefinition() { }
-
- BioUnitDefinition(const ost::io::MMCifInfoBioUnit& bu);
-
- void ToStream(std::ostream& stream) const;
-
- void FromStream(std::istream& stream);
-
- std::vector<String> au_chains;
- std::vector<int> chain_intvl;
- std::vector<std::vector<geom::Mat4> > operations;
- std::vector<int> op_intvl;
-};
-
-
struct ChainData {
ChainData(): ch_name(""), chain_type(ost::mol::CHAINTYPE_UNKNOWN) { }
@@ -107,12 +133,12 @@ struct ChainData {
void ToStream(std::ostream& stream,
const std::vector<ResidueDefinition>& res_def,
- bool lossy, bool avg_bfactors, bool round_bfactors,
+ Real max_error, bool avg_bfactors, bool round_bfactors,
bool skip_ss) const;
void FromStream(std::istream& stream,
const std::vector<ResidueDefinition>& res_def,
- int version, bool lossy, bool avg_bfactors,
+ int version, Real max_error, bool avg_bfactors,
bool round_bfactors, bool skip_ss);
// chain features
@@ -151,25 +177,21 @@ private:
DefaultPepLib& operator=(DefaultPepLib const& copy);
};
-
class OMF {
public:
- enum OMFOption {DEFAULT_PEPLIB = 1, LOSSY = 2, AVG_BFACTORS = 4,
- ROUND_BFACTORS = 8, SKIP_SS = 16, INFER_PEP_BONDS = 32};
+ enum OMFOption {DEFAULT_PEPLIB = 1, AVG_BFACTORS = 2, ROUND_BFACTORS = 4,
+ SKIP_SS = 8, INFER_PEP_BONDS = 16};
bool OptionSet(OMFOption opt) const {
return (opt & options_) == opt;
}
static OMFPtr FromEntity(const ost::mol::EntityHandle& ent,
+ Real max_error = 0.0,
uint8_t options = 0);
- static OMFPtr FromMMCIF(const ost::mol::EntityHandle& ent,
- const MMCifInfo& info,
- uint8_t options = 0);
-
static OMFPtr FromFile(const String& fn);
static OMFPtr FromString(const String& s);
@@ -180,14 +202,22 @@ public:
ost::mol::EntityHandle GetAU() const;
+ ost::mol::EntityHandle GetEntity() const {
+ return this->GetAU();
+ }
+
ost::mol::EntityHandle GetAUChain(const String& name) const;
- ost::mol::EntityHandle GetBU(int bu_idx) const;
+ ost::mol::EntityHandle GetEntityChain(const String& name) const {
+ return this->GetAUChain(name);
+ }
int GetVersion() const { return version_; }
static int GetCurrentOMFVersion() { return OMF_VERSION; }
+ Real GetMaxError() const { return 0.001 * max_error_; }
+
// data access without requirement of generating a full
// OpenStructure entity
@@ -211,13 +241,12 @@ private:
void FromStream(std::istream& stream);
- void FillChain(ost::mol::ChainHandle& chain, ost::mol::XCSEditor& ed,
- const ChainDataPtr data,
- geom::Mat4 transform = geom::Mat4()) const;
+ void FillChain(const ChainDataPtr data, ost::mol::XCSEditor& ed,
+ ost::mol::ChainHandle& chain) const;
String name_;
+ uint16_t max_error_;
std::vector<ResidueDefinition> residue_definitions_;
- std::vector<BioUnitDefinition> biounit_definitions_;
std::map<String, ChainDataPtr> chain_data_;
// bond features - only for bonds that are inter-chain
diff --git a/modules/io/src/mol/pdb_reader.cc b/modules/io/src/mol/pdb_reader.cc
index 930ffbcf453f0563768d8aae0351f65fe6ac07bf..ee9cb18eddbb85499e54f4f8636c229e24748f3e 100644
--- a/modules/io/src/mol/pdb_reader.cc
+++ b/modules/io/src/mol/pdb_reader.cc
@@ -737,10 +737,15 @@ void PDBReader::ParseAndAddAtom(const StringRef& line, int line_num,
if(charge.first) {
if(line[79] != '-' && line[79] != '+') {
std::stringstream ss;
- ss << "error on line " << line_num << ": "
- << "expect charge in format 1+, 2-, etc. got: "
+ ss << "invalid charge on line " << line_num << ": "
+ << "expected 1+, 2-, etc. got: "
<< line.substr(78, 2);
- throw IOException(ss.str());
+ if (profile_.fault_tolerant) {
+ LOG_WARNING(ss.str());
+ charge.first = 0.0;
+ } else {
+ throw IOException(ss.str());
+ }
}
if(line[79] == '-') charge.second *= (-1);
}
diff --git a/modules/io/src/mol/sdf_reader.cc b/modules/io/src/mol/sdf_reader.cc
index 3c28e279cb71a3f89575d5fe3bca70ce621c6c6f..660a9dcb5be68494a7d5944ced083d857f945f8c 100644
--- a/modules/io/src/mol/sdf_reader.cc
+++ b/modules/io/src/mol/sdf_reader.cc
@@ -55,27 +55,40 @@ SDFReader::SDFReader(std::istream& instream)
this->ClearState(boost::filesystem::path(""));
}
+boost::iostreams::filtering_stream<boost::iostreams::input>& SDFReader::GetLine(
+ boost::iostreams::filtering_stream<boost::iostreams::input>& in,
+ String& line)
+ // Read next line from in and place it in line.
+ // Remove trailing \r characters.
+{
+ std::getline(in, line);
+ size_t cr_pos = line.find("\r");
+ if (cr_pos != String::npos) {
+ LOG_TRACE( "Remove CR@" << cr_pos);
+ line.erase(cr_pos);
+ }
+ return in;
+}
+
// import data from provided stream
void SDFReader::Import(mol::EntityHandle& ent)
{
String line;
mol::XCSEditor editor=ent.EditXCS(mol::BUFFERED_EDIT);
- while (std::getline(in_,line)) {
+ while (GetLine(in_,line)) {
++line_num;
- // std::getline removes EOL character but may leave a DOS CR (\r) in Unix
- size_t cr_pos = line.find("\r");
- if (cr_pos != String::npos) {
- LOG_TRACE( "Remove CR@" << cr_pos);
- line.erase(cr_pos);
- }
-
if (line_num<=4) {
- ParseAndAddHeader(line, line_num, ent, editor);
- } else if (line_num<=atom_count_+4) {
- ParseAndAddAtom(line, line_num, ent, true, editor);
- } else if (line_num<=bond_count_+atom_count_+4) {
- ParseAndAddBond(line, line_num, ent, editor);
+ ParseHeader(line, line_num, ent, editor);
+ } else if (version_ == "V2000" && line_num<=atom_count_+4) {
+ AddAtom(ParseAtom(line, line_num), line_num, ent, true, editor);
+ } else if (version_ == "V2000" && line_num<=bond_count_+atom_count_+4) {
+ AddBond(ParseBond(line, line_num), line_num, ent, editor);
+ } else if (version_ == "V2000" && boost::iequals(line.substr(0,6), "M CHG")) {
+ auto charges = ParseMCharge(line, line_num);
+ for (const charge_data& c : charges) {
+ AddCharge(c, line_num, ent, editor);
+ }
} else if (boost::iequals(line.substr(0,2), "> ")) {
// parse data items
int data_header_start = line.find('<');
@@ -89,13 +102,15 @@ void SDFReader::Import(mol::EntityHandle& ent)
throw IOException(str(format(msg) % line_num));
}
String data_value="";
- while(std::getline(in_,line) && !boost::iequals(line, "")) {
+ while(GetLine(in_,line) && !boost::iequals(line, "")) {
data_value.append(line);
}
curr_chain_.SetStringProp(data_header, data_value);
} else if (boost::iequals(line, "$$$$")) {
LOG_VERBOSE("MOLECULE " << curr_chain_.GetName() << " (" << chain_count_ << ") added.")
NextMolecule();
+ } else if (version_ == "V3000") {
+ ProcessV3000Line(line, ent, editor);
}
}
@@ -117,6 +132,10 @@ void SDFReader::ClearState(const boost::filesystem::path& loc)
atom_count_=0;
bond_count_=0;
line_num=0;
+ version_="";
+ v3000_bond_block_=false;
+ v3000_atom_block_=false;
+ charges_reset_=false;
}
void SDFReader::NextMolecule()
@@ -125,12 +144,16 @@ void SDFReader::NextMolecule()
atom_count_=0;
bond_count_=0;
line_num=0;
+ version_="";
+ v3000_bond_block_=false;
+ v3000_atom_block_=false;
+ charges_reset_=false;
curr_residue_ = ost::mol::ResidueHandle();
curr_chain_ = ost::mol::ChainHandle();
}
-void SDFReader::ParseAndAddHeader(const String& line, int line_num,
- mol::EntityHandle& ent, mol::XCSEditor& editor)
+void SDFReader::ParseHeader(const String& line, int line_num,
+ mol::EntityHandle& ent, mol::XCSEditor& editor)
{
LOG_TRACE( "line: [" << line << "]" );
format chain_fmter("%05i_%s");
@@ -159,35 +182,57 @@ void SDFReader::ParseAndAddHeader(const String& line, int line_num,
break;
case 4: // counts line
{
- String version_str=line.substr(34, 5);
- if (version_str != "V2000") {
+ String version_str;
+ if (line.length() < 6) {
+ String msg="Bad counts line %d: too short (%i characters, "
+ "should be at least 6 or 39)";
+ throw IOException(str(format(msg) % line_num % line.length()));
+ }
+ else if (line.length() < 39) {
+ String msg="Bad counts line %d: too short (%i characters, "
+ "should be at least 39). "
+ "Proceeding assuming V2000 format.";
+ LOG_WARNING(str(format(msg) % line_num % line.length()));
+ version_str="V2000";
+ }
+ else {
+ version_str=line.substr(34, 5);
+ }
+ if (version_str == "V2000" || version_str == "V3000") {
+ version_=version_str;
+ }
+ else {
String msg="Unsupported SDF version: %s.";
throw IOException(str(format(msg) % version_str));
}
+ // Counts will be overridden in V3000
String s_anum=line.substr(0,3);
- try {
- atom_count_=boost::lexical_cast<int>(boost::trim_copy(s_anum));
- } catch(boost::bad_lexical_cast&) {
- String msg="Bad counts line %d: Can't convert number of atoms"
- " '%s' to integral constant.";
- throw IOException(str(format(msg) % line_num % s_anum));
- }
String s_bnum=line.substr(3,3);
- try {
- bond_count_=boost::lexical_cast<int>(boost::trim_copy(s_bnum));
- } catch(boost::bad_lexical_cast&) {
- String msg="Bad counts line %d: Can't convert number of bonds"
- " '%s' to integral constant.";
- throw IOException(str(format(msg) % line_num % s_bnum));
- }
+ SetCounts(s_anum, s_bnum, line_num);
break;
}
}
}
-void SDFReader::ParseAndAddAtom(const String& line, int line_num,
- mol::EntityHandle& ent, bool hetatm,
- mol::XCSEditor& editor)
+void SDFReader::SetCounts(const String& anum, const String bnum, int line_num)
+{
+ try {
+ atom_count_=boost::lexical_cast<int>(boost::trim_copy(anum));
+ } catch(boost::bad_lexical_cast&) {
+ String msg="Bad counts line %d: Can't convert number of atoms"
+ " '%s' to integral constant.";
+ throw IOException(str(format(msg) % line_num % anum));
+ }
+ try {
+ bond_count_=boost::lexical_cast<int>(boost::trim_copy(bnum));
+ } catch(boost::bad_lexical_cast&) {
+ String msg="Bad counts line %d: Can't convert number of bonds"
+ " '%s' to integral constant.";
+ throw IOException(str(format(msg) % line_num % bnum));
+ }
+}
+
+SDFReader::atom_data SDFReader::ParseAtom(const String& line, int line_num)
{
LOG_TRACE( "line: [" << line << "]" );
@@ -210,6 +255,16 @@ void SDFReader::ParseAndAddAtom(const String& line, int line_num,
String s_ele=line.substr(31,3);
String s_charge=line.substr(36,3);
+ return std::make_tuple(anum, s_posx, s_posy, s_posz, s_ele, s_charge);
+}
+
+void SDFReader::AddAtom(const atom_data& atom_tuple, int line_num, mol::EntityHandle& ent,
+ bool hetatm, mol::XCSEditor& editor)
+{
+ int anum;
+ String s_posx, s_posy, s_posz, s_ele, s_charge;
+ tie(anum, s_posx, s_posy, s_posz, s_ele, s_charge) = atom_tuple;
+
geom::Vec3 apos;
try {
apos=geom::Vec3(boost::lexical_cast<Real>(boost::trim_copy(s_posx)),
@@ -257,8 +312,7 @@ void SDFReader::ParseAndAddAtom(const String& line, int line_num,
}
-void SDFReader::ParseAndAddBond(const String& line, int line_num,
- mol::EntityHandle& ent, mol::XCSEditor& editor)
+SDFReader::bond_data SDFReader::ParseBond(const String& line, int line_num)
{
LOG_TRACE( "line: [" << line << "]" );
@@ -278,10 +332,20 @@ void SDFReader::ParseAndAddBond(const String& line, int line_num,
String s_first_name=line.substr(0,3);
String s_second_name=line.substr(3,3);
String s_type=line.substr(6,3);
- String first_name, second_name;
+
+ return std::make_tuple(s_first_name, s_second_name, s_type);
+}
+
+void SDFReader::AddBond(const bond_data& bond_tuple, int line_num, mol::EntityHandle& ent,
+ mol::XCSEditor& editor)
+{
+ String s_first_name, s_second_name, s_type;
+ tie(s_first_name, s_second_name, s_type) = bond_tuple;
+
unsigned char type;
mol::BondHandle bond;
+ String first_name, second_name;
first_name=boost::trim_copy(s_first_name);
second_name=boost::trim_copy(s_second_name);
@@ -318,4 +382,298 @@ void SDFReader::ParseAndAddBond(const String& line, int line_num,
<< s_type << ") ");
}
+
+void SDFReader::ResetCharges()
+// from doc of V2000 Atom Block:
+// > Retained for compatibility with older Ctabs, M CHG and M RAD lines take
+// > precedence.
+// Therefore we must reset all charges of the residue if we encounter an
+// M CHG line.
+{
+ LOG_DEBUG("Resetting all charges to 0.");
+ for (mol::AtomHandle & atom : curr_residue_.GetAtomList()) {
+ atom.SetCharge(0.0);
+ }
+ charges_reset_=true;
+}
+
+
+std::vector<SDFReader::charge_data> SDFReader::ParseMCharge(const String& line, int line_num)
+{
+ std::vector<charge_data> charges;
+
+ LOG_TRACE( "line: [" << line << "]" );
+
+ if (!charges_reset_) {
+ ResetCharges();
+ }
+
+ if(line.length()<15) {
+ // Handle the case where we have trailing space characters
+ String msg="Bad Charge line %d: Not enough characters on the"
+ " line: %i (should be between 15 or more)";
+ throw IOException(str(format(msg) % line_num % line.length()));
+ }
+
+ int nn=boost::lexical_cast<int>(boost::trim_copy(line.substr(6,3)));
+ LOG_TRACE( "Line contains " << nn << " charge(s)" );
+ charges.reserve(nn);
+
+ for (int i = 0; i < nn; i++) {
+ String atom_index=line.substr(10 + i * 8, 3);
+ String charge=line.substr(14 + i * 8, 3);
+ charges.push_back(std::make_tuple(atom_index, charge));
+ }
+
+ return charges;
+}
+
+ void SDFReader::AddCharge(const charge_data& charge_tuple, int line_num, mol::EntityHandle& ent,
+ mol::XCSEditor& editor)
+{
+ String s_atom_index, s_charge;
+ tie(s_atom_index, s_charge) = charge_tuple;
+
+ int atom_index;
+ Real charge;
+
+ try {
+ atom_index=boost::lexical_cast<int>(boost::trim_copy(s_atom_index));
+ if (atom_index > atom_count_) {
+ String msg="Bad charge line %d: Atom index"
+ " '%d' greater than number of atoms in the molecule (%d).";
+ throw IOException(str(format(msg) % line_num % atom_index % atom_count_));
+ } else if (atom_index < 1) {
+ String msg="Bad charge line %d: Atom index %d < 1.";
+ throw IOException(str(format(msg) % line_num % atom_index));
+ }
+ } catch(boost::bad_lexical_cast&) {
+ String msg="Bad charge line %d: Can't convert atom index"
+ " '%s' to integral constant.";
+ throw IOException(str(format(msg) % line_num % s_atom_index));
+ }
+
+ try {
+ charge=boost::lexical_cast<Real>(boost::trim_copy(s_charge));
+ } catch(boost::bad_lexical_cast&) {
+ String msg="Bad charge line %d: Can't convert charge"
+ " '%s' to real number.";
+ throw IOException(str(format(msg) % line_num % s_charge));
+ }
+
+ curr_residue_.GetAtomList()[atom_index - 1].SetCharge(charge);
+
+ LOG_DEBUG("Setting charge of atom " << atom_index - 1 << " to " << charge);
+}
+
+SDFReader::v3000_line_tokens SDFReader::TokenizeV3000Line(const String& line,
+ int line_num,
+ int num_posval)
+// Read whitespace-separated tokens from a V3000 line.
+// Tokens can be separated by any amount of whitespace.
+// The function is guaranteed to return exactly num_posval positional elements,
+// or throws an error. It returns any number of keyword elements with only
+// syntax checks (ie no checks if the keywords are correct, only well-formed).
+{
+ std::istringstream v30_stream(line);
+ std::vector<String> positional;
+ std::map<String, String> keywords;
+ String token;
+ bool keywords_reached = false;
+ size_t kw_equal_pos;
+ positional.reserve(num_posval);
+
+ while (v30_stream.tellg() != -1) {
+ std::getline(v30_stream, token, ' ');
+ if (token.empty()) {
+ continue;
+ }
+ kw_equal_pos = token.find('=');
+ if (kw_equal_pos != String::npos) {
+ keywords_reached = true;
+ }
+ if (keywords_reached) {
+ // Token can contain a list in round brackets
+ // We don't use them in OST so no fancy parsing, just capture them
+ // as a string keyword
+ if (token.find('(') == kw_equal_pos + 1) {
+ // Search for the closing bracket
+ while (token.find(')') == String::npos) {
+ String next_token;
+ std::getline(v30_stream, next_token, ' ');
+ token = token + " " + next_token;
+ }
+ }
+
+ // Check if keyword is well formed
+ if (token.size() < 3 // too short
+ || kw_equal_pos == String::npos // no =
+ || kw_equal_pos == 0 // no key (starts with =)
+ || kw_equal_pos == token.size() - 1 // no value (ends with =)
+ ) {
+ String msg="Bad V3000 keyword on line %d: '%s'.";
+ throw IOException(str(format(msg) % line_num % token));
+ }
+ String key = token.substr(0, kw_equal_pos);
+ String value = token.substr(kw_equal_pos + 1);
+ keywords.insert({key, value});
+ }
+ else {
+ positional.push_back(token);
+ }
+ }
+
+ int obtained_posval = positional.size();
+ if (obtained_posval != num_posval) {
+ String msg="Bad V3000 line %d: expected %d positional values, got %d.";
+ throw IOException(str(format(msg) % line_num % num_posval %
+ obtained_posval));
+ }
+
+ return std::make_tuple(positional, keywords);
+}
+
+String SDFReader::CleanupV3000Line(const String& line)
+// String cleanup and aggregation for V3000
+// Return a string with no "M V30 " and not ending with -
+{
+ String v30_line = line;
+ if (v30_line.substr(0, 7) != "M V30 ") {
+ String msg="Bad V3000 line %d: starts with '%s'.";
+ throw IOException(str(format(msg) % line_num % line.substr(0, 6)));
+ }
+
+ // Handle line continuation character -
+ while (v30_line.find("-") == v30_line.length()-1) {
+ // Read and append the next line
+ String next_line;
+ GetLine(in_,next_line);
+ ++line_num; // Update class member
+
+ // Ensure we have a valid next_line
+ if (next_line.substr(0, 7) != "M V30 ") {
+ String msg="Bad V3000 line %d: starts with '%s'.";
+ throw IOException(str(format(msg) % line_num % next_line.substr(0, 6)));
+ }
+ // All clear, add data
+ v30_line = v30_line.erase(v30_line.find("-")) + next_line.substr(7);
+ LOG_TRACE( "V3000 line: [" << v30_line << "]" );
+ }
+
+ // Cleanup the line
+ return v30_line.substr(7); // We previously ensured it starts with M V30
+}
+
+SDFReader::atom_data SDFReader::ParseV3000Atom(const String& line, int line_num)
+{
+ v3000_line_tokens tokens = TokenizeV3000Line(line, line_num, 6);
+ std::vector<String> posval;
+ std::map<String, String> keywords;
+ tie(posval, keywords) = tokens;
+
+ String s_anum = posval[0];
+ String atype = posval[1];
+ String posx = posval[2];
+ String posy = posval[3];
+ String posz = posval[4];
+
+ String chg;
+ try {
+ chg = keywords.at("CHG");
+ } catch(std::out_of_range&) {
+ chg = "0";
+ }
+
+ int anum;
+ try {
+ anum=boost::lexical_cast<int>(boost::trim_copy(s_anum));
+ } catch(boost::bad_lexical_cast&) {
+ String msg="Bad atom index '%s' on line %d.";
+ throw IOException(str(format(msg) % s_anum % line_num));
+ }
+
+ return std::make_tuple(anum, posx, posy, posz, atype, chg);
+}
+
+SDFReader::bond_data SDFReader::ParseV3000Bond(const String& line, int line_num)
+{
+ v3000_line_tokens tokens = TokenizeV3000Line(line, line_num, 4);
+ std::vector<String> posval;
+ tie(posval, std::ignore) = tokens;
+
+ String btype = posval[1];
+ String s_first_name = posval[2];
+ String s_second_name = posval[3];
+
+ return std::make_tuple(s_first_name, s_second_name, btype);
+}
+
+std::tuple<String, String> SDFReader::ParseV3000Counts(const String& line, int line_num)
+{
+ v3000_line_tokens tokens = TokenizeV3000Line(line, line_num, 5);
+ std::vector<String> posval;
+ tie(posval, std::ignore) = tokens;
+
+ String anum = posval[0];
+ String bnum = posval[1];
+
+ return std::make_tuple(anum, bnum);
+}
+
+void SDFReader::VerifyV3000Counts()
+{
+ int actual_atom_count = curr_residue_.GetAtomCount();
+ int actual_bond_count = curr_residue_.GetBondCount();
+ if (actual_atom_count != atom_count_) {
+ String msg="Bad counts for molecule ending on line %d: "
+ "expected %d atoms, got %d.";
+ throw IOException(str(format(msg) % line_num % atom_count_ %
+ actual_atom_count));
+ }
+ if (actual_bond_count != bond_count_) {
+ String msg="Bad counts for molecule ending on line %d: "
+ "expected %d bonds, got %d.";
+ throw IOException(str(format(msg) % line_num % bond_count_ %
+ actual_bond_count));
+ }
+}
+
+void SDFReader::ProcessV3000Line(const String& line,
+ mol::EntityHandle& ent,
+ mol::XCSEditor& editor)
+{
+ if (line.substr(0, 6) == "M END") {
+ VerifyV3000Counts();
+ return;
+ }
+ String v30_line = CleanupV3000Line(line);
+
+ if (v30_line.substr(0, 6) == "COUNTS") {
+ String anum, bnum;
+ std::tie(anum, bnum) = ParseV3000Counts(v30_line.substr(7), line_num);
+ SetCounts(anum, bnum, line_num);
+ }
+ else if (v30_line.substr(0, 10) == "BEGIN ATOM") {
+ v3000_atom_block_=true;
+ }
+ else if (v30_line.substr(0, 8) == "END ATOM") {
+ v3000_atom_block_=false;
+ }
+ else if (v30_line.substr(0, 10) == "BEGIN BOND") {
+ v3000_bond_block_=true;
+ }
+ else if (v30_line.substr(0, 8) == "END BOND") {
+ v3000_bond_block_=false;
+ }
+ else if (v3000_atom_block_) {
+ AddAtom(ParseV3000Atom(v30_line, line_num), line_num, ent, true, editor);
+ }
+ else if (v3000_bond_block_) {
+ AddBond(ParseV3000Bond(v30_line, line_num), line_num, ent, editor);
+ }
+ else {
+ LOG_TRACE( "ignoring line: [" << v30_line << "]" );
+ }
+}
+
}}
diff --git a/modules/io/src/mol/sdf_reader.hh b/modules/io/src/mol/sdf_reader.hh
index f786f4e5426bf5068022ef0f8ed3657c8481be2c..59e733a937a3ed0dcb7171deec9ff9a32dd808ae 100644
--- a/modules/io/src/mol/sdf_reader.hh
+++ b/modules/io/src/mol/sdf_reader.hh
@@ -22,6 +22,7 @@
#ifndef OST_IO_SDF_READER_HH
#define OST_IO_SDF_READER_HH
+#include <tuple>
#include <boost/iostreams/filtering_stream.hpp>
#include <boost/filesystem/fstream.hpp>
#include <ost/mol/chain_handle.hh>
@@ -30,6 +31,9 @@
namespace ost { namespace io {
+
+
+
class DLLEXPORT_OST_IO SDFReader {
public:
SDFReader(const String& filename);
@@ -41,17 +45,45 @@ public:
void Import(mol::EntityHandle& ent);
private:
+ typedef std::tuple<int, String, String, String, String, String> atom_data;
+ typedef std::tuple<String, String, String> bond_data;
+ typedef std::tuple<String, String> charge_data;
+ typedef std::tuple<std::vector<String>, std::map<String, String>> v3000_line_tokens;
+
+ boost::iostreams::filtering_stream<boost::iostreams::input>& GetLine(
+ boost::iostreams::filtering_stream<boost::iostreams::input>& in,
+ String& line);
+
void ClearState(const boost::filesystem::path& loc);
void NextMolecule();
- void ParseAndAddHeader(const String& line, int line_num, mol::EntityHandle& ent,
+ void ParseHeader(const String& line, int line_num, mol::EntityHandle& ent,
mol::XCSEditor& editor);
+ void SetCounts(const String& anum, const String bnum, int line_num);
- void ParseAndAddAtom(const String& line, int line_num, mol::EntityHandle& ent,
- bool hetatm, mol::XCSEditor& editor);
+ atom_data ParseAtom(const String& line, int line_num);
+ void AddAtom(const atom_data& atom_tuple, int line_num, mol::EntityHandle& ent,
+ bool hetatm, mol::XCSEditor& editor);
+
+ bond_data ParseBond(const String& line, int line_num);
+ void AddBond(const bond_data& bond_tuple, int line_num, mol::EntityHandle& ent,
+ mol::XCSEditor& editor);
+
+ std::vector<charge_data> ParseMCharge(const String& line, int line_num);
+ void AddCharge(const charge_data& charge_tuple, int line_num, mol::EntityHandle& ent,
+ mol::XCSEditor& editor);
+ void ResetCharges();
- void ParseAndAddBond(const String& line, int line_num, mol::EntityHandle& ent,
+ // V3000 methods
+ v3000_line_tokens TokenizeV3000Line(const String& line, int line_num,
+ int num_posval);
+ String CleanupV3000Line(const String& line);
+ void ProcessV3000Line(const String& line, mol::EntityHandle& ent,
mol::XCSEditor& editor);
+ atom_data ParseV3000Atom(const String& line, int line_num);
+ bond_data ParseV3000Bond(const String& line, int line_num);
+ std::tuple<String, String> ParseV3000Counts(const String& line, int line_num);
+ void VerifyV3000Counts();
String curr_chain_name_;
mol::ResidueKey curr_res_key_;
@@ -65,6 +97,10 @@ private:
boost::filesystem::ifstream infile_;
std::istream& instream_;
boost::iostreams::filtering_stream<boost::iostreams::input> in_;
+ String version_;
+ bool v3000_atom_block_;
+ bool v3000_bond_block_;
+ bool charges_reset_;
};
}}
diff --git a/modules/io/src/mol/sdf_writer.cc b/modules/io/src/mol/sdf_writer.cc
index e39444d0cdd394b568f82568622c6b4fbc006545..c0241211ab8c2ecf0421b2487dcfb4ae19bb518e 100644
--- a/modules/io/src/mol/sdf_writer.cc
+++ b/modules/io/src/mol/sdf_writer.cc
@@ -83,6 +83,8 @@ namespace {
else if (abs(chg) > 3) {
String msg = "SDF format only supports charges from -3 to +3, not %g";
throw IOException(str(format(msg) % chg));
+ // This is not entirely true. We could implement "M CHG" lines with
+ // support from -15 to +15. Or switch to V3000.
}
else {
Real chg_sdf = 4 - chg;
@@ -197,6 +199,21 @@ void SDFWriter::Write(const mol::EntityHandle& ent) {
}
bool SDFWriter::VisitChain(const mol::ChainView& chain) {
+ // Santiy check: only 999 atoms / bonds supported in SDF V2000
+ // If more are needed we need to implement V3000
+ if (chain.GetAtomCount() > 999) {
+ std::stringstream msg_at;
+ msg_at << "Can't write SDF file. Too many atoms (";
+ msg_at << chain.GetAtomCount() <<")";
+ throw IOException(msg_at.str());
+ }
+ if (chain.GetBondCount() > 999) {
+ std::stringstream msg_bo;
+ msg_bo << "Can't write SDF file. Too many bonds (";
+ msg_bo << chain.GetBondCount() <<")";
+ throw IOException(msg_bo.str());
+ }
+
// print end of molecule line
if(counter_ != 0) {
ostr_ << "$$$$" << std::endl;
diff --git a/modules/io/tests/CMakeLists.txt b/modules/io/tests/CMakeLists.txt
index fbfef7413858ee6fdf249e801ca721f10aeb500d..e19fd631ec247f9ecd8fcf0ef5ff7685572281c0 100644
--- a/modules/io/tests/CMakeLists.txt
+++ b/modules/io/tests/CMakeLists.txt
@@ -8,6 +8,7 @@ set(OST_IO_UNIT_TESTS
test_io_crd.cc
test_io_dcd.cc
test_io_sdf.cc
+ test_io_sdf_v3000.cc
test_io_sequence_profile.cc
test_pir.cc
test_iomanager.cc
diff --git a/modules/io/tests/test_io_omf.py b/modules/io/tests/test_io_omf.py
index 8d519c5084969316d2aeab844aeac45cdd89d8bd..0c618b015683e8407ab443d75e5a335f6fa5749a 100644
--- a/modules/io/tests/test_io_omf.py
+++ b/modules/io/tests/test_io_omf.py
@@ -118,17 +118,16 @@ class TestOMF(unittest.TestCase):
self.ent.SetName("This is a name 123")
def test_AU(self):
- omf = io.OMF.FromMMCIF(self.ent, self.info)
+ omf = io.OMF.FromEntity(self.ent)
omf_bytes = omf.ToBytes()
loaded_omf = io.OMF.FromBytes(omf_bytes)
loaded_ent = loaded_omf.GetAU()
self.assertTrue(compare_ent(self.ent, loaded_ent))
def test_default_peplib(self):
- omf = io.OMF.FromMMCIF(self.ent, self.info)
+ omf = io.OMF.FromEntity(self.ent)
omf_bytes = omf.ToBytes()
- omf_def_pep = io.OMF.FromMMCIF(self.ent, self.info,
- io.OMFOption.DEFAULT_PEPLIB)
+ omf_def_pep = io.OMF.FromEntity(self.ent, options = io.OMFOption.DEFAULT_PEPLIB)
omf_def_pep_bytes = omf_def_pep.ToBytes()
loaded_omf_def_pep = io.OMF.FromBytes(omf_def_pep_bytes)
loaded_ent = loaded_omf_def_pep.GetAU()
@@ -136,26 +135,10 @@ class TestOMF(unittest.TestCase):
self.assertTrue(len(omf_def_pep_bytes) < len(omf_bytes))
self.assertTrue(compare_ent(self.ent, loaded_ent))
- def test_lossy(self):
- omf = io.OMF.FromMMCIF(self.ent, self.info)
- omf_bytes = omf.ToBytes()
- omf_lossy = io.OMF.FromMMCIF(self.ent, self.info,
- io.OMFOption.LOSSY)
- omf_lossy_bytes = omf_lossy.ToBytes()
- loaded_omf_lossy = io.OMF.FromBytes(omf_lossy_bytes)
- loaded_ent = loaded_omf_lossy.GetAU()
-
- self.assertTrue(len(omf_lossy_bytes) < len(omf_bytes))
- self.assertFalse(compare_ent(self.ent, loaded_ent))
- max_dist = math.sqrt(3*0.05*0.05)
- self.assertTrue(compare_ent(self.ent, loaded_ent,
- at_dist_thresh=max_dist))
-
def test_avg_bfactors(self):
- omf = io.OMF.FromMMCIF(self.ent, self.info)
+ omf = io.OMF.FromEntity(self.ent)
omf_bytes = omf.ToBytes()
- omf_avg_bfac = io.OMF.FromMMCIF(self.ent, self.info,
- io.OMFOption.AVG_BFACTORS)
+ omf_avg_bfac = io.OMF.FromEntity(self.ent, options = io.OMFOption.AVG_BFACTORS)
omf_avg_bfac_bytes = omf_avg_bfac.ToBytes()
loaded_omf_avg_bfac = io.OMF.FromBytes(omf_avg_bfac_bytes)
loaded_ent = loaded_omf_avg_bfac.GetAU()
@@ -174,10 +157,9 @@ class TestOMF(unittest.TestCase):
self.assertTrue(abs(a.b_factor - exp_bfac) < 0.008)
def test_round_bfactors(self):
- omf = io.OMF.FromMMCIF(self.ent, self.info)
+ omf = io.OMF.FromEntity(self.ent)
omf_bytes = omf.ToBytes()
- omf_round_bfac = io.OMF.FromMMCIF(self.ent, self.info,
- io.OMFOption.ROUND_BFACTORS)
+ omf_round_bfac = io.OMF.FromEntity(self.ent, options = io.OMFOption.ROUND_BFACTORS)
omf_round_bfac_bytes = omf_round_bfac.ToBytes()
loaded_omf_round_bfac = io.OMF.FromBytes(omf_round_bfac_bytes)
loaded_ent = loaded_omf_round_bfac.GetAU()
@@ -188,10 +170,9 @@ class TestOMF(unittest.TestCase):
at_bfactor_thresh=0.5))
def test_skip_ss(self):
- omf = io.OMF.FromMMCIF(self.ent, self.info)
+ omf = io.OMF.FromEntity(self.ent)
omf_bytes = omf.ToBytes()
- omf_skip_ss = io.OMF.FromMMCIF(self.ent, self.info,
- io.OMFOption.SKIP_SS)
+ omf_skip_ss = io.OMF.FromEntity(self.ent, options = io.OMFOption.SKIP_SS)
omf_skip_ss_bytes = omf_skip_ss.ToBytes()
loaded_omf_skip_ss = io.OMF.FromBytes(omf_skip_ss_bytes)
loaded_ent = loaded_omf_skip_ss.GetAU()
@@ -201,10 +182,10 @@ class TestOMF(unittest.TestCase):
self.assertTrue(compare_ent(self.ent, loaded_ent, skip_ss=True))
def test_infer_pep_bonds(self):
- omf = io.OMF.FromMMCIF(self.ent, self.info)
+ omf = io.OMF.FromEntity(self.ent)
omf_bytes = omf.ToBytes()
- omf_infer_pep_bonds = io.OMF.FromMMCIF(self.ent, self.info,
- io.OMFOption.INFER_PEP_BONDS)
+ omf_infer_pep_bonds = io.OMF.FromEntity(self.ent,
+ options = io.OMFOption.INFER_PEP_BONDS)
omf_infer_pep_bonds_bytes = omf_infer_pep_bonds.ToBytes()
loaded_omf_infer_pep_bonds = io.OMF.FromBytes(omf_infer_pep_bonds_bytes)
loaded_ent = loaded_omf_infer_pep_bonds.GetAU()
@@ -212,39 +193,14 @@ class TestOMF(unittest.TestCase):
self.assertTrue(len(omf_infer_pep_bonds_bytes) < len(omf_bytes))
self.assertTrue(compare_ent(self.ent, loaded_ent))
- def test_multiple_BU(self):
- ent, seqres, info = io.LoadMMCIF("testfiles/mmcif/3imj.cif.gz",
- seqres=True,
- info=True)
-
- omf = io.OMF.FromMMCIF(ent, info)
+ def test_lower_precition(self):
+ omf = io.OMF.FromEntity(self.ent, max_error=0.5)
omf_bytes = omf.ToBytes()
- omf_loaded = io.OMF.FromBytes(omf_bytes)
-
- # there are quite some discrepancies between PDBize and OMF
- # - chain names: PDBize has specific chain names for ligands and
- # water etc. OMF just iterates A, B, C, D, ...
- # - skip_bonds: Thats qualified atom name based. PDBize used rnums
- # and insertion codes for waters...
- # - skip_rnums: Again, insertion codes for waters...
- self.assertTrue(compare_ent(info.GetBioUnits()[0].PDBize(ent),
- omf_loaded.GetBU(0),
- skip_cnames=True, skip_bonds=True,
- skip_rnums=True, bu_idx = 0))
-
- self.assertTrue(compare_ent(info.GetBioUnits()[1].PDBize(ent),
- omf_loaded.GetBU(1),
- skip_cnames=True, skip_bonds=True,
- skip_rnums=True, bu_idx = 1))
-
- # no check for the full guy... problem: PDBize throws all water
- # molecules in the same chain, whereas OMF keeps them separate
- # as in the chains from the assymetric unit... maybe needs some
- # thinking on how to resolve discrepancies between PDBize and OMF
- #self.assertTrue(compare_ent(omf_loaded.GetBU(2),
- # info.GetBioUnits()[2].PDBize(ent),
- # skip_cnames=True, skip_bonds=True,
- # skip_rnums=True))
+ loaded_omf = io.OMF.FromBytes(omf_bytes)
+ loaded_ent = loaded_omf.GetAU()
+ self.assertFalse(compare_ent(self.ent, loaded_ent))
+ self.assertTrue(compare_ent(self.ent, loaded_ent, at_dist_thresh=0.5))
+
if __name__== '__main__':
from ost import testutils
diff --git a/modules/io/tests/test_io_pdb.cc b/modules/io/tests/test_io_pdb.cc
index 99071118e987899c00a88dab6ae9e2d010d59e97..ce507a6fed70668fe2eeaa1de486264bb1ff9aa8 100644
--- a/modules/io/tests/test_io_pdb.cc
+++ b/modules/io/tests/test_io_pdb.cc
@@ -1131,4 +1131,42 @@ BOOST_AUTO_TEST_CASE(test_pqr_write_atom)
BOOST_CHECK_EQUAL(fwriter.IsPQR(), true);
}
+// Charges
+BOOST_AUTO_TEST_CASE(test_parse_charge)
+{
+ Logger::Instance().PushVerbosityLevel(0);
+ String fname("testfiles/pdb/charge.pdb");
+ PDBReader reader(fname, IOProfile());
+ mol::EntityHandle ent=mol::CreateEntity();
+ reader.Import(ent);
+
+ BOOST_CHECK(ent.FindAtom("A", 68, "N").GetCharge() == 1.0);
+ BOOST_CHECK(ent.FindAtom("A", 68, "CA").GetCharge() == 0);
+ BOOST_CHECK(ent.FindAtom("A", 68, "CB").GetCharge() == 0);
+ BOOST_CHECK(ent.FindAtom("A", 68, "CG1").GetCharge() == 0);
+ BOOST_CHECK(ent.FindAtom("A", 68, "CG2").GetCharge() == 4);
+ BOOST_CHECK(ent.FindAtom("A", 68, "O").GetCharge() == -1);
+
+}
+BOOST_AUTO_TEST_CASE(faulty_charges)
+{
+ String fname("testfiles/pdb/charge_faulty.pdb");
+ PDBReader reader(fname, IOProfile());
+ mol::EntityHandle ent=mol::CreateEntity();
+ BOOST_CHECK_THROW(reader.Import(ent), IOException);
+
+ ent=mol::CreateEntity(); // Clean entity
+ IOProfile profile;
+ profile.fault_tolerant=true;
+ PDBReader reader2(fname, profile);
+ reader2.Import(ent);
+
+ BOOST_CHECK(ent.FindAtom("A", 68, "N").GetCharge() == 1.0);
+ BOOST_CHECK(ent.FindAtom("A", 68, "CA").GetCharge() == 0);
+ BOOST_CHECK(ent.FindAtom("A", 68, "CB").GetCharge() == 0);
+ BOOST_CHECK(ent.FindAtom("A", 68, "CG1").GetCharge() == 0);
+ BOOST_CHECK(ent.FindAtom("A", 68, "CG2").GetCharge() == 4);
+ BOOST_CHECK(ent.FindAtom("A", 68, "O").GetCharge() == -1);
+}
+
BOOST_AUTO_TEST_SUITE_END();
diff --git a/modules/io/tests/test_io_sdf.cc b/modules/io/tests/test_io_sdf.cc
index df84041b0f47b79b8b19cdf865b1543f05666ce0..68009e9c990d1cf11962eaffdcaea489934d7a7e 100644
--- a/modules/io/tests/test_io_sdf.cc
+++ b/modules/io/tests/test_io_sdf.cc
@@ -252,5 +252,17 @@ BOOST_AUTO_TEST_CASE(empty_dataheader_error_sdf)
BOOST_CHECK_THROW(sdfh.Import(eh,"testfiles/sdf/empty_dataheader.sdf"), IOException);
}
+BOOST_AUTO_TEST_CASE(rcsb_modelserver_sdf)
+{
+ // Check that we can read invalid SDF files from the RCSB model server.
+ // These files have too short
+ mol::EntityHandle eh=mol::CreateEntity();
+ EntityIOSDFHandler sdfh;
+ sdfh.Import(eh,"testfiles/sdf/1atg_C_ACT.sdf.gz");
+
+ // check success
+ BOOST_CHECK_EQUAL(eh.GetChainCount(), 1);
+}
+
BOOST_AUTO_TEST_SUITE_END();
diff --git a/modules/io/tests/test_io_sdf.py b/modules/io/tests/test_io_sdf.py
index 735158fc3c38f8ed2345415ae913143f8b7d1bf1..7277a399d5a58ca696f50fb19e0775345999313a 100644
--- a/modules/io/tests/test_io_sdf.py
+++ b/modules/io/tests/test_io_sdf.py
@@ -38,6 +38,15 @@ class TestSDF(unittest.TestCase):
ent.FindAtom("00001_Simple Ligand", 1, "6").charge = -4
io.EntityToSDFStr(ent)
+ def test_MChg(self):
+ ent = io.LoadSDF('testfiles/sdf/m_chg.sdf')
+ n_at = ent.FindAtom("00001_Simple Ligand", 1, "1")
+ self.assertEqual(n_at.charge, 1)
+ cl_at = ent.FindAtom("00001_Simple Ligand", 1, "6")
+ self.assertEqual(cl_at.charge, -1)
+ # Charge from atom line is ignored
+ o_at = ent.FindAtom("00001_Simple Ligand", 1, "3")
+ self.assertEqual(o_at.charge, 0)
if __name__== '__main__':
from ost import testutils
diff --git a/modules/io/tests/test_io_sdf_v3000.cc b/modules/io/tests/test_io_sdf_v3000.cc
new file mode 100644
index 0000000000000000000000000000000000000000..e9b26a1fd2e663bf0055cf040f580c6f9a047139
--- /dev/null
+++ b/modules/io/tests/test_io_sdf_v3000.cc
@@ -0,0 +1,194 @@
+//------------------------------------------------------------------------------
+// This file is part of the OpenStructure project <www.openstructure.org>
+//
+// Copyright (C) 2008-2020 by the OpenStructure authors
+//
+// This library is free software; you can redistribute it and/or modify it under
+// the terms of the GNU Lesser General Public License as published by the Free
+// Software Foundation; either version 3.0 of the License, or (at your option)
+// any later version.
+// This library is distributed in the hope that it will be useful, but WITHOUT
+// ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS
+// FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more
+// details.
+//
+// You should have received a copy of the GNU Lesser General Public License
+// along with this library; if not, write to the Free Software Foundation, Inc.,
+// 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA
+//------------------------------------------------------------------------------
+#define BOOST_TEST_DYN_LINK
+#include <boost/test/unit_test.hpp>
+#include <boost/lexical_cast.hpp>
+#include <boost/algorithm/string.hpp>
+using boost::unit_test_framework::test_suite;
+
+#include <ost/test_utils/compare_files.hh>
+#include <ost/mol/mol.hh>
+#include <ost/io/mol/entity_io_sdf_handler.hh>
+#include <ost/io/mol/save_entity.hh>
+#include <ost/io/io_exception.hh>
+
+using namespace ost;
+using namespace ost::io;
+
+BOOST_AUTO_TEST_SUITE( io );
+
+BOOST_AUTO_TEST_CASE(simple_sdf_v3000)
+{
+ mol::EntityHandle eh=mol::CreateEntity();
+ EntityIOSDFHandler sdfh;
+ sdfh.Import(eh,"testfiles/sdf_v3000/simple.sdf");
+
+ // check compounds/atoms/bonds count
+ BOOST_CHECK_EQUAL(eh.GetChainCount(), 1);
+ BOOST_CHECK_EQUAL(eh.GetAtomCount(), 6);
+ BOOST_CHECK_EQUAL(eh.GetBondCount(), 6);
+ BOOST_CHECK_CLOSE(eh.GetMass(), Real(121.546997), Real(1e-4));
+
+ // check atom/bond types
+ mol::AtomHandle ah=eh.GetAtomList()[0];
+ mol::AtomHandle ah2=eh.GetAtomList()[5];
+
+ BOOST_CHECK_EQUAL(ah.GetElement(), "N");
+ BOOST_CHECK_EQUAL(ah2.GetElement(), "CL");
+ BOOST_CHECK_CLOSE(ah.GetRadius(), Real(1.55), Real(1e-2));
+ BOOST_CHECK_CLOSE(ah2.GetRadius(), Real(1.75), Real(1e-2));
+ BOOST_CHECK_CLOSE(ah.GetMass(), Real(14.007), Real(1e-4));
+ BOOST_CHECK_CLOSE(ah2.GetMass(), Real(35.453), Real(1e-3));
+ BOOST_CHECK_EQUAL(ah.GetBondCount(), 3);
+ BOOST_CHECK_EQUAL(ah2.GetBondCount(), 1);
+ BOOST_CHECK_EQUAL(ah.GetCharge(), 1);
+ BOOST_CHECK_EQUAL(ah2.GetCharge(), 0);
+
+ mol::BondHandle bh=ah.GetBondList()[0];
+ BOOST_CHECK_EQUAL(bh.GetBondOrder(), 2);
+}
+
+BOOST_AUTO_TEST_CASE(multiple_sdf_v3000)
+{
+ mol::EntityHandle eh=mol::CreateEntity();
+ EntityIOSDFHandler sdfh;
+ sdfh.Import(eh,"testfiles/sdf_v3000/multiple.sdf");
+
+ // check number of compounds
+ BOOST_CHECK_EQUAL(eh.GetChainCount(), 4);
+}
+
+BOOST_AUTO_TEST_CASE(properties_sdf_v3000)
+{
+ mol::EntityHandle eh=mol::CreateEntity();
+ EntityIOSDFHandler sdfh;
+ sdfh.Import(eh,"testfiles/sdf_v3000/properties.sdf");
+
+ // check number of compounds
+ mol::ChainHandleList chl=eh.GetChainList();
+ int count=1;
+ for (mol::ChainHandleList::iterator i=chl.begin();i!=chl.end();++i,count++)
+ {
+ BOOST_REQUIRE(i->HasProp("prop_one"));
+ BOOST_REQUIRE(i->HasProp("prop_two"));
+ BOOST_CHECK_CLOSE(boost::lexical_cast<Real>(i->GetStringProp("prop_one")),
+ Real(count),Real(1e-4));
+ BOOST_CHECK_CLOSE(boost::lexical_cast<Real>(i->GetStringProp("prop_two")),
+ Real(count*(-2.2)),Real(1e-4));
+ }
+}
+
+BOOST_AUTO_TEST_CASE(read_sdf_v3000)
+{
+ const String fname("testfiles/sdf_v3000/compound.sdf");
+
+ mol::EntityHandle eh=mol::CreateEntity();
+ EntityIOSDFHandler sdfh;
+
+ // check import
+ sdfh.Import(eh,"testfiles/sdf_v3000/compound.sdf");
+
+ // check atoms/bonds
+ BOOST_CHECK_EQUAL(eh.GetChainCount(), 4);
+ BOOST_CHECK_EQUAL(eh.GetAtomCount(), 180);
+ BOOST_CHECK_EQUAL(eh.GetBondCount(), 188);
+
+ // check molecule name
+ mol::ChainHandle ch=eh.FindChain("00003_Test Ligand");
+ BOOST_CHECK(ch.IsValid());
+
+ // check properties
+ BOOST_CHECK(ch.HasProp("r_i_glide_rmsd"));
+ BOOST_CHECK_EQUAL(boost::lexical_cast<float>(boost::trim_copy
+ (ch.GetStringProp("r_i_glide_rmsd"))),
+ 0.543804f);
+}
+
+BOOST_AUTO_TEST_CASE(wrong_atomcount_error_sdf_v3000)
+{
+ mol::EntityHandle eh=mol::CreateEntity();
+ EntityIOSDFHandler sdfh;
+ BOOST_CHECK_THROW(sdfh.Import(eh,"testfiles/sdf_v3000/wrong_atomcount.sdf"), IOException);
+}
+
+BOOST_AUTO_TEST_CASE(wrong_bondcount_error_sdf_v3000)
+{
+ mol::EntityHandle eh=mol::CreateEntity();
+ EntityIOSDFHandler sdfh;
+ BOOST_CHECK_THROW(sdfh.Import(eh,"testfiles/sdf_v3000/wrong_bondcount.sdf"), IOException);
+}
+
+BOOST_AUTO_TEST_CASE(wrong_atomlinelength_error_sdf_v3000)
+{
+ mol::EntityHandle eh=mol::CreateEntity();
+ EntityIOSDFHandler sdfh;
+
+ BOOST_CHECK_THROW(sdfh.Import(eh,"testfiles/sdf_v3000/wrong_atomlinelength.sdf"), IOException);
+}
+
+BOOST_AUTO_TEST_CASE(wrong_atompos_error_sdf_v3000)
+{
+ mol::EntityHandle eh=mol::CreateEntity();
+ EntityIOSDFHandler sdfh;
+
+ BOOST_CHECK_THROW(sdfh.Import(eh,"testfiles/sdf_v3000/wrong_atompos.sdf"), IOException);
+}
+
+BOOST_AUTO_TEST_CASE(wrong_charge_error_sdf_v3000)
+{
+ mol::EntityHandle eh=mol::CreateEntity();
+ EntityIOSDFHandler sdfh;
+
+ BOOST_CHECK_THROW(sdfh.Import(eh,"testfiles/sdf_v3000/wrong_charge.sdf"), IOException);
+}
+
+BOOST_AUTO_TEST_CASE(wrong_bondlinelength_error_sdf_v3000)
+{
+ mol::EntityHandle eh=mol::CreateEntity();
+ EntityIOSDFHandler sdfh;
+
+ BOOST_CHECK_THROW(sdfh.Import(eh,"testfiles/sdf_v3000/wrong_bondlinelength.sdf"), IOException);
+}
+
+BOOST_AUTO_TEST_CASE(wrong_bondtype_error_sdf_v3000)
+{
+ mol::EntityHandle eh=mol::CreateEntity();
+ EntityIOSDFHandler sdfh;
+
+ BOOST_CHECK_THROW(sdfh.Import(eh,"testfiles/sdf_v3000/wrong_bondtype.sdf"), IOException);
+}
+
+BOOST_AUTO_TEST_CASE(wrong_bondatomnumber_error_sdf_v3000)
+{
+ mol::EntityHandle eh=mol::CreateEntity();
+ EntityIOSDFHandler sdfh;
+
+ BOOST_CHECK_THROW(sdfh.Import(eh,"testfiles/sdf_v3000/wrong_bondatomnumber.sdf"), IOException);
+}
+
+BOOST_AUTO_TEST_CASE(wrong_keyword_error_sdf_v3000)
+{
+ mol::EntityHandle eh=mol::CreateEntity();
+ EntityIOSDFHandler sdfh;
+
+ BOOST_CHECK_THROW(sdfh.Import(eh,"testfiles/sdf_v3000/wrong_keyword.sdf"), IOException);
+}
+
+
+BOOST_AUTO_TEST_SUITE_END();
diff --git a/modules/io/tests/testfiles/pdb/charge.pdb b/modules/io/tests/testfiles/pdb/charge.pdb
new file mode 100644
index 0000000000000000000000000000000000000000..50cb4d6744b838af652d1acf83d11f3c53ed05d6
--- /dev/null
+++ b/modules/io/tests/testfiles/pdb/charge.pdb
@@ -0,0 +1,7 @@
+ATOM 1 N VAL A 68 -67.790 -2.746 1.520 1.00120.70 1SG 1+
+ATOM 2 CA VAL A 68 -68.907 -2.689 2.484 1.00120.70 1SG
+ATOM 3 CB VAL A 68 -68.374 -2.515 3.872 1.00120.70 1SG 0+
+ATOM 4 CG1 VAL A 68 -67.534 -3.751 4.234 1.00120.70 1SG
+ATOM 5 CG2 VAL A 68 -67.591 -1.194 3.924 1.00120.70 1SG 4+
+ATOM 6 C VAL A 68 -69.796 -1.526 2.177 1.00120.70 1SG
+ATOM 7 O VAL A 68 -69.882 -1.095 1.029 1.00120.70 1SG 1-
\ No newline at end of file
diff --git a/modules/io/tests/testfiles/pdb/charge_faulty.pdb b/modules/io/tests/testfiles/pdb/charge_faulty.pdb
new file mode 100644
index 0000000000000000000000000000000000000000..2fb2446db267a630f4e6e6d6445db99867b40d23
--- /dev/null
+++ b/modules/io/tests/testfiles/pdb/charge_faulty.pdb
@@ -0,0 +1,7 @@
+ATOM 1 N VAL A 68 -67.790 -2.746 1.520 1.00120.70 1SG 1+
+ATOM 2 CA VAL A 68 -68.907 -2.689 2.484 1.00120.70 1SG
+ATOM 3 CB VAL A 68 -68.374 -2.515 3.872 1.00120.70 1SG 68
+ATOM 4 CG1 VAL A 68 -67.534 -3.751 4.234 1.00120.70 1SG
+ATOM 5 CG2 VAL A 68 -67.591 -1.194 3.924 1.00120.70 1SG 4+
+ATOM 6 C VAL A 68 -69.796 -1.526 2.177 1.00120.70 1SG
+ATOM 7 O VAL A 68 -69.882 -1.095 1.029 1.00120.70 1SG 1-
\ No newline at end of file
diff --git a/modules/io/tests/testfiles/sdf/1atg_C_ACT.sdf.gz b/modules/io/tests/testfiles/sdf/1atg_C_ACT.sdf.gz
new file mode 100644
index 0000000000000000000000000000000000000000..436ae0021cac71c13e18238d165b9ebde27cb208
Binary files /dev/null and b/modules/io/tests/testfiles/sdf/1atg_C_ACT.sdf.gz differ
diff --git a/modules/io/tests/testfiles/sdf/m_chg.sdf b/modules/io/tests/testfiles/sdf/m_chg.sdf
new file mode 100644
index 0000000000000000000000000000000000000000..da6b3e7d8262c797fb014867657f27f9759565b9
--- /dev/null
+++ b/modules/io/tests/testfiles/sdf/m_chg.sdf
@@ -0,0 +1,19 @@
+Simple Ligand
+
+ Teststructure
+ 6 6 0 0 1 0 999 V2000
+ 0.0000 0.0000 0.0000 N 0 3 0 0 0 0
+ 1.0000 0.0000 0.0000 C 0 0 0 0 0 0
+ 0.0000 1.0000 0.0000 O 0 5 0 0 0 0
+ 1.0000 1.0000 0.0000 S 0 0 0 0 0 0
+ 2.0000 2.0000 0.0000 C 0 0 0 0 0 0
+ -1.0000 -1.0000 0.0000 Cl 0 0 0 0 0 0
+ 1 2 2 0 0 0
+ 1 3 1 0 0 0
+ 1 6 1 0 0 0
+ 2 4 1 0 0 0
+ 3 4 1 0 0 0
+ 4 5 3 0 0 0
+M CHG 2 1 1 6 -1
+M END
+$$$$
diff --git a/modules/io/tests/testfiles/sdf_v3000/compound.sdf b/modules/io/tests/testfiles/sdf_v3000/compound.sdf
new file mode 100644
index 0000000000000000000000000000000000000000..c1820344e37589ce52e37fade327060a95adb615
--- /dev/null
+++ b/modules/io/tests/testfiles/sdf_v3000/compound.sdf
@@ -0,0 +1,660 @@
+Test Ligand
+ OpenBabel06052308503D
+
+ 0 0 0 0 0 999 V3000
+M V30 BEGIN CTAB
+M V30 COUNTS 45 47 0 0 0
+M V30 BEGIN ATOM
+M V30 1 C 35.9455 5.9021 22.1706 0
+M V30 2 O 34.6074 5.5226 22.4445 0
+M V30 3 C 33.9561 6.2475 23.4088 0
+M V30 4 C 32.6324 6.6232 23.1367 0
+M V30 5 C 34.5295 6.5843 24.6557 0
+M V30 6 C 31.8762 7.3329 24.0856 0
+M V30 7 C 33.7671 7.2733 25.6188 0
+M V30 8 C 32.4286 7.646 25.3459 0
+M V30 9 C 31.5951 8.3119 26.371 0
+M V30 10 C 31.3314 7.914 27.6484 0
+M V30 11 C 31.8735 6.7525 28.4344 0
+M V30 12 O 32.356 5.724 27.9527 0
+M V30 13 N 30.4351 8.7885 28.2094 0
+M V30 14 N 31.7811 6.9129 29.7679 0
+M V30 15 N 30.111 9.7809 27.3482 0
+M V30 16 C 32.3829 6.0325 30.7674 0
+M V30 17 C 30.7767 9.482 26.2306 0
+M V30 18 C 31.3859 4.9676 31.2295 0
+M V30 19 C 30.7144 10.3135 25.0185 0
+M V30 20 C 31.915 10.8059 24.4681 0
+M V30 21 C 31.8995 11.615 23.3143 0
+M V30 22 Cl 33.3805 12.232 22.6834 0
+M V30 23 C 30.6694 11.9024 22.6787 0
+M V30 24 O 30.636 12.6166 21.518 0
+M V30 25 C 29.4673 11.4261 23.2329 0
+M V30 26 C 29.4821 10.6385 24.4075 0
+M V30 27 O 28.2924 10.2274 24.9296 0
+M V30 28 H 36.3421 5.2876 21.3587 0
+M V30 29 H 35.9736 6.9432 21.8453 0
+M V30 30 H 36.6065 5.7791 23.0307 0
+M V30 31 H 32.1915 6.3459 22.1959 0
+M V30 32 H 35.5405 6.2957 24.9105 0
+M V30 33 H 30.8594 7.6089 23.8374 0
+M V30 34 H 34.2045 7.5053 26.5811 0
+M V30 35 H 30.0864 8.7388 29.1508 0
+M V30 36 H 31.3698 7.7591 30.1306 0
+M V30 37 H 33.2889 5.565 30.3864 0
+M V30 38 H 32.6785 6.6486 31.6135 0
+M V30 39 H 31.8211 4.339 32.0105 0
+M V30 40 H 30.4818 5.4213 31.6393 0
+M V30 41 H 31.1006 4.3181 30.401 0
+M V30 42 H 32.8629 10.577 24.9439 0
+M V30 43 H 29.7848 12.6362 21.103 0
+M V30 44 H 28.5336 11.6723 22.7555 0
+M V30 45 H 27.5318 10.6938 24.5843 0
+M V30 END ATOM
+M V30 BEGIN BOND
+M V30 1 1 1 2
+M V30 2 1 1 28
+M V30 3 1 1 29
+M V30 4 1 1 30
+M V30 5 1 2 3
+M V30 6 1 3 4
+M V30 7 2 3 5
+M V30 8 2 4 6
+M V30 9 1 4 31
+M V30 10 1 5 7
+M V30 11 1 5 32
+M V30 12 1 6 8
+M V30 13 1 6 33
+M V30 14 2 7 8
+M V30 15 1 7 34
+M V30 16 1 8 9
+M V30 17 2 9 10
+M V30 18 1 9 17
+M V30 19 1 10 11
+M V30 20 1 10 13
+M V30 21 2 11 12
+M V30 22 1 11 14
+M V30 23 1 13 15
+M V30 24 1 13 35
+M V30 25 1 14 16
+M V30 26 1 14 36
+M V30 27 2 15 17
+M V30 28 1 16 18
+M V30 29 1 16 37
+M V30 30 1 16 38
+M V30 31 1 17 19
+M V30 32 1 18 39
+M V30 33 1 18 40
+M V30 34 1 18 41
+M V30 35 1 19 20
+M V30 36 2 19 26
+M V30 37 2 20 21
+M V30 38 1 20 42
+M V30 39 1 21 22
+M V30 40 1 21 23
+M V30 41 1 23 24
+M V30 42 2 23 25
+M V30 43 1 24 43
+M V30 44 1 25 26
+M V30 45 1 25 44
+M V30 46 1 26 27
+M V30 47 1 27 45
+M V30 END BOND
+M V30 END CTAB
+M END
+> <i_i_glide_confnum>
+2
+
+> <i_i_glide_lignum>
+1
+
+> <i_i_glide_posenum>
+352
+
+> <r_i_docking_score>
+-8.84426
+
+> <r_i_glide_ecoul>
+-16.1644
+
+> <r_i_glide_einternal>
+6.78671
+
+> <r_i_glide_emodel>
+-96.9661
+
+> <r_i_glide_energy>
+-62.2146
+
+> <r_i_glide_erotb>
+0.517993
+
+> <r_i_glide_esite>
+-0.0291388
+
+> <r_i_glide_evdw>
+-46.0502
+
+> <r_i_glide_gscore>
+-8.84426
+
+> <r_i_glide_hbond>
+-0.960751
+
+> <r_i_glide_ligand_efficiency>
+-0.327565
+
+> <r_i_glide_ligand_efficiency_ln>
+-2.0588
+
+> <r_i_glide_ligand_efficiency_sa>
+-0.982695
+
+> <r_i_glide_lipo>
+-2.84534
+
+> <r_i_glide_metal>
+-0
+
+> <r_i_glide_rewards>
+-0.799851
+
+> <r_i_glide_rmsd>
+0.6819
+
+$$$$
+Test Ligand
+ OpenBabel06052308503D
+
+ 0 0 0 0 0 999 V3000
+M V30 BEGIN CTAB
+M V30 COUNTS 45 47 0 0 0
+M V30 BEGIN ATOM
+M V30 1 C 34.3938 4.9895 21.4537 0
+M V30 2 O 34.9786 5.7318 22.5298 0
+M V30 3 C 34.145 6.3862 23.4047 0
+M V30 4 C 34.6745 6.7394 24.6654 0
+M V30 5 C 32.7998 6.7274 23.0916 0
+M V30 6 C 33.8742 7.4015 25.612 0
+M V30 7 C 32.0035 7.3913 24.0448 0
+M V30 8 C 32.5275 7.723 25.3191 0
+M V30 9 C 31.6607 8.3431 26.3377 0
+M V30 10 C 31.4133 7.937 27.6169 0
+M V30 11 C 31.9782 6.7689 28.3776 0
+M V30 12 O 32.369 5.715 27.8804 0
+M V30 13 N 30.5206 8.8053 28.2099 0
+M V30 14 N 32.0029 6.9625 29.7121 0
+M V30 15 N 30.1677 9.805 27.357 0
+M V30 16 C 32.5238 6.0208 30.6934 0
+M V30 17 C 30.8244 9.5086 26.2225 0
+M V30 18 C 31.3863 5.1079 31.1861 0
+M V30 19 C 30.7465 10.3438 25.0101 0
+M V30 20 C 31.9316 10.8558 24.4417 0
+M V30 21 C 31.892 11.6586 23.2829 0
+M V30 22 Cl 33.3681 12.254 22.6096 0
+M V30 23 C 30.6518 11.9231 22.66 0
+M V30 24 O 30.5979 12.6244 21.4907 0
+M V30 25 C 29.4612 11.4393 23.2345 0
+M V30 26 C 29.4978 10.6576 24.4073 0
+M V30 27 O 28.313 10.2277 24.9428 0
+M V30 28 H 35.1654 4.4015 20.952 0
+M V30 29 H 33.6444 4.2945 21.836 0
+M V30 30 H 33.93 5.6189 20.6923 0
+M V30 31 H 35.7051 6.503 24.9029 0
+M V30 32 H 32.3569 6.4909 22.1252 0
+M V30 33 H 34.2923 7.6473 26.581 0
+M V30 34 H 30.9795 7.6612 23.8114 0
+M V30 35 H 30.1658 8.7432 29.1625 0
+M V30 36 H 31.6728 7.8452 30.0908 0
+M V30 37 H 33.3536 5.4297 30.2888 0
+M V30 38 H 32.9238 6.5957 31.5354 0
+M V30 39 H 31.7451 4.4444 31.9834 0
+M V30 40 H 30.5677 5.7018 31.5922 0
+M V30 41 H 31.0015 4.4903 30.3675 0
+M V30 42 H 32.8807 10.6312 24.9124 0
+M V30 43 H 29.7389 12.639 21.0888 0
+M V30 44 H 28.5134 11.6612 22.7648 0
+M V30 45 H 27.5338 10.6743 24.5952 0
+M V30 END ATOM
+M V30 BEGIN BOND
+M V30 1 1 1 2
+M V30 2 1 1 28
+M V30 3 1 1 29
+M V30 4 1 1 30
+M V30 5 1 2 3
+M V30 6 1 3 4
+M V30 7 2 3 5
+M V30 8 2 4 6
+M V30 9 1 4 31
+M V30 10 1 5 7
+M V30 11 1 5 32
+M V30 12 1 6 8
+M V30 13 1 6 33
+M V30 14 2 7 8
+M V30 15 1 7 34
+M V30 16 1 8 9
+M V30 17 2 9 10
+M V30 18 1 9 17
+M V30 19 1 10 11
+M V30 20 1 10 13
+M V30 21 2 11 12
+M V30 22 1 11 14
+M V30 23 1 13 15
+M V30 24 1 13 35
+M V30 25 1 14 16
+M V30 26 1 14 36
+M V30 27 2 15 17
+M V30 28 1 16 18
+M V30 29 1 16 37
+M V30 30 1 16 38
+M V30 31 1 17 19
+M V30 32 1 18 39
+M V30 33 1 18 40
+M V30 34 1 18 41
+M V30 35 1 19 20
+M V30 36 2 19 26
+M V30 37 2 20 21
+M V30 38 1 20 42
+M V30 39 1 21 22
+M V30 40 1 21 23
+M V30 41 1 23 24
+M V30 42 2 23 25
+M V30 43 1 24 43
+M V30 44 1 25 26
+M V30 45 1 25 44
+M V30 46 1 26 27
+M V30 47 1 27 45
+M V30 END BOND
+M V30 END CTAB
+M END
+> <i_i_glide_confnum>
+14
+
+> <i_i_glide_lignum>
+1
+
+> <i_i_glide_posenum>
+302
+
+> <r_i_docking_score>
+-8.79327
+
+> <r_i_glide_ecoul>
+-16.9687
+
+> <r_i_glide_einternal>
+5.76514
+
+> <r_i_glide_emodel>
+-98.4298
+
+> <r_i_glide_energy>
+-63.3874
+
+> <r_i_glide_erotb>
+0.517993
+
+> <r_i_glide_esite>
+-0.00975737
+
+> <r_i_glide_evdw>
+-46.4187
+
+> <r_i_glide_gscore>
+-8.79327
+
+> <r_i_glide_hbond>
+-0.966475
+
+> <r_i_glide_ligand_efficiency>
+-0.325677
+
+> <r_i_glide_ligand_efficiency_ln>
+-2.04693
+
+> <r_i_glide_ligand_efficiency_sa>
+-0.97703
+
+> <r_i_glide_lipo>
+-2.69167
+
+> <r_i_glide_metal>
+-0
+
+> <r_i_glide_rewards>
+-0.777126
+
+> <r_i_glide_rmsd>
+0.605551
+
+$$$$
+Test Ligand
+ OpenBabel06052308503D
+
+ 0 0 0 0 0 999 V3000
+M V30 BEGIN CTAB
+M V30 COUNTS 45 47 0 0 0
+M V30 BEGIN ATOM
+M V30 1 C 36.2241 5.1749 22.8554 0
+M V30 2 O 35.0609 5.8871 22.4479 0
+M V30 3 C 34.2768 6.4601 23.4276 0
+M V30 4 C 34.7199 6.6807 24.7535 0
+M V30 5 C 32.9608 6.8443 23.074 0
+M V30 6 C 33.8637 7.2655 25.7079 0
+M V30 7 C 32.1001 7.4207 24.0338 0
+M V30 8 C 32.5448 7.6388 25.3572 0
+M V30 9 C 31.6578 8.2493 26.3632 0
+M V30 10 C 31.3829 7.8493 27.6381 0
+M V30 11 C 31.8957 6.6637 28.4136 0
+M V30 12 O 32.3784 5.637 27.9299 0
+M V30 13 N 30.4903 8.7246 28.2064 0
+M V30 14 N 31.7656 6.7961 29.7467 0
+M V30 15 N 30.1647 9.7304 27.3526 0
+M V30 16 C 32.1947 5.8187 30.7363 0
+M V30 17 C 30.843 9.4334 26.233 0
+M V30 18 C 33.6957 5.9781 31.0077 0
+M V30 19 C 30.7874 10.2877 25.0301 0
+M V30 20 C 31.9854 10.7833 24.4695 0
+M V30 21 C 31.9583 11.608 23.3306 0
+M V30 22 Cl 33.4405 12.2408 22.7079 0
+M V30 23 C 30.7247 11.9044 22.7018 0
+M V30 24 O 30.6845 12.6266 21.5474 0
+M V30 25 C 29.5221 11.4297 23.2588 0
+M V30 26 C 29.5448 10.64 24.4309 0
+M V30 27 O 28.3508 10.232 24.9581 0
+M V30 28 H 36.6559 4.6879 21.9802 0
+M V30 29 H 36.9908 5.8287 23.2736 0
+M V30 30 H 35.9784 4.409 23.5916 0
+M V30 31 H 35.7217 6.4151 25.0626 0
+M V30 32 H 32.6094 6.6834 22.0613 0
+M V30 33 H 34.237 7.4405 26.7062 0
+M V30 34 H 31.0912 7.6917 23.745 0
+M V30 35 H 30.1426 8.6905 29.1645 0
+M V30 36 H 31.3915 7.6554 30.1264 0
+M V30 37 H 31.6292 6.0008 31.6531 0
+M V30 38 H 31.9544 4.8033 30.4192 0
+M V30 39 H 34.0395 5.2434 31.7401 0
+M V30 40 H 34.2801 5.8472 30.0923 0
+M V30 41 H 33.9143 6.9734 31.4067 0
+M V30 42 H 32.9388 10.5461 24.9301 0
+M V30 43 H 29.8267 12.6411 21.1471 0
+M V30 44 H 28.5699 11.6759 22.8051 0
+M V30 45 H 27.5929 10.6933 24.609 0
+M V30 END ATOM
+M V30 BEGIN BOND
+M V30 1 1 1 2
+M V30 2 1 1 28
+M V30 3 1 1 29
+M V30 4 1 1 30
+M V30 5 1 2 3
+M V30 6 1 3 4
+M V30 7 2 3 5
+M V30 8 2 4 6
+M V30 9 1 4 31
+M V30 10 1 5 7
+M V30 11 1 5 32
+M V30 12 1 6 8
+M V30 13 1 6 33
+M V30 14 2 7 8
+M V30 15 1 7 34
+M V30 16 1 8 9
+M V30 17 2 9 10
+M V30 18 1 9 17
+M V30 19 1 10 11
+M V30 20 1 10 13
+M V30 21 2 11 12
+M V30 22 1 11 14
+M V30 23 1 13 15
+M V30 24 1 13 35
+M V30 25 1 14 16
+M V30 26 1 14 36
+M V30 27 2 15 17
+M V30 28 1 16 18
+M V30 29 1 16 37
+M V30 30 1 16 38
+M V30 31 1 17 19
+M V30 32 1 18 39
+M V30 33 1 18 40
+M V30 34 1 18 41
+M V30 35 1 19 20
+M V30 36 2 19 26
+M V30 37 2 20 21
+M V30 38 1 20 42
+M V30 39 1 21 22
+M V30 40 1 21 23
+M V30 41 1 23 24
+M V30 42 2 23 25
+M V30 43 1 24 43
+M V30 44 1 25 26
+M V30 45 1 25 44
+M V30 46 1 26 27
+M V30 47 1 27 45
+M V30 END BOND
+M V30 END CTAB
+M END
+> <i_i_glide_confnum>
+1
+
+> <i_i_glide_lignum>
+1
+
+> <i_i_glide_posenum>
+177
+
+> <r_i_docking_score>
+-8.70173
+
+> <r_i_glide_ecoul>
+-15.8862
+
+> <r_i_glide_einternal>
+1.84397
+
+> <r_i_glide_emodel>
+-99.0481
+
+> <r_i_glide_energy>
+-62.44
+
+> <r_i_glide_erotb>
+0.517993
+
+> <r_i_glide_esite>
+-0.0274759
+
+> <r_i_glide_evdw>
+-46.5538
+
+> <r_i_glide_gscore>
+-8.70173
+
+> <r_i_glide_hbond>
+-0.97397
+
+> <r_i_glide_ligand_efficiency>
+-0.322286
+
+> <r_i_glide_ligand_efficiency_ln>
+-2.02562
+
+> <r_i_glide_ligand_efficiency_sa>
+-0.966858
+
+> <r_i_glide_lipo>
+-2.74283
+
+> <r_i_glide_metal>
+-0
+
+> <r_i_glide_rewards>
+-0.764823
+
+> <r_i_glide_rmsd>
+0.543804
+
+$$$$
+Test Ligand
+ OpenBabel06052308503D
+
+ 0 0 0 0 0 999 V3000
+M V30 BEGIN CTAB
+M V30 COUNTS 45 47 0 0 0
+M V30 BEGIN ATOM
+M V30 1 C 36.1312 5.0238 22.8745 0
+M V30 2 O 35.3492 6.1234 22.4285 0
+M V30 3 C 34.5144 6.6833 23.3611 0
+M V30 4 C 33.188 6.9515 22.986 0
+M V30 5 C 34.9381 7.0224 24.661 0
+M V30 6 C 32.287 7.546 23.8905 0
+M V30 7 C 34.0422 7.6076 25.572 0
+M V30 8 C 32.7085 7.8735 25.1943 0
+M V30 9 C 31.7655 8.4568 26.1623 0
+M V30 10 C 31.4563 8.0176 27.4151 0
+M V30 11 C 31.9612 6.8234 28.1735 0
+M V30 12 O 32.4816 5.8265 27.6667 0
+M V30 13 N 30.4991 8.8399 27.9505 0
+M V30 14 N 31.7656 6.8973 29.5011 0
+M V30 15 N 30.1623 9.8254 27.0921 0
+M V30 16 C 32.179 5.9073 30.4826 0
+M V30 17 C 30.8968 9.5864 26.0023 0
+M V30 18 C 33.4739 6.3765 31.1528 0
+M V30 19 C 30.8088 10.4312 24.8021 0
+M V30 20 C 31.98 11.0176 24.2785 0
+M V30 21 C 31.9238 11.8291 23.1331 0
+M V30 22 Cl 33.3643 12.5911 22.5784 0
+M V30 23 C 30.6968 12.0157 22.4634 0
+M V30 24 O 30.6398 12.6873 21.2763 0
+M V30 25 C 29.5186 11.4761 23.006 0
+M V30 26 C 29.5649 10.7043 24.1795 0
+M V30 27 O 28.3911 10.2293 24.6826 0
+M V30 28 H 36.6829 4.6047 22.0257 0
+M V30 29 H 36.8626 5.3082 23.636 0
+M V30 30 H 35.4815 4.2419 23.2796 0
+M V30 31 H 32.8514 6.6935 21.9933 0
+M V30 32 H 35.957 6.8606 24.9671 0
+M V30 33 H 31.2689 7.7361 23.5858 0
+M V30 34 H 34.3918 7.8724 26.559 0
+M V30 35 H 30.065 8.7441 28.8594 0
+M V30 36 H 31.3489 7.7378 29.8826 0
+M V30 37 H 31.3881 5.8177 31.2263 0
+M V30 38 H 32.3154 4.9187 30.0437 0
+M V30 39 H 33.8094 5.6628 31.9076 0
+M V30 40 H 34.2829 6.5014 30.4282 0
+M V30 41 H 33.3311 7.3365 31.6549 0
+M V30 42 H 32.9245 10.8652 24.7777 0
+M V30 43 H 29.7851 12.6657 20.8657 0
+M V30 44 H 28.5664 11.6345 22.5199 0
+M V30 45 H 27.6152 10.7061 24.3768 0
+M V30 END ATOM
+M V30 BEGIN BOND
+M V30 1 1 1 2
+M V30 2 1 1 28
+M V30 3 1 1 29
+M V30 4 1 1 30
+M V30 5 1 2 3
+M V30 6 1 3 4
+M V30 7 2 3 5
+M V30 8 2 4 6
+M V30 9 1 4 31
+M V30 10 1 5 7
+M V30 11 1 5 32
+M V30 12 1 6 8
+M V30 13 1 6 33
+M V30 14 2 7 8
+M V30 15 1 7 34
+M V30 16 1 8 9
+M V30 17 2 9 10
+M V30 18 1 9 17
+M V30 19 1 10 11
+M V30 20 1 10 13
+M V30 21 2 11 12
+M V30 22 1 11 14
+M V30 23 1 13 15
+M V30 24 1 13 35
+M V30 25 1 14 16
+M V30 26 1 14 36
+M V30 27 2 15 17
+M V30 28 1 16 18
+M V30 29 1 16 37
+M V30 30 1 16 38
+M V30 31 1 17 19
+M V30 32 1 18 39
+M V30 33 1 18 40
+M V30 34 1 18 41
+M V30 35 1 19 20
+M V30 36 2 19 26
+M V30 37 2 20 21
+M V30 38 1 20 42
+M V30 39 1 21 22
+M V30 40 1 21 23
+M V30 41 1 23 24
+M V30 42 2 23 25
+M V30 43 1 24 43
+M V30 44 1 25 26
+M V30 45 1 25 44
+M V30 46 1 26 27
+M V30 47 1 27 45
+M V30 END BOND
+M V30 END CTAB
+M END
+> <i_i_glide_confnum>
+9
+
+> <i_i_glide_lignum>
+1
+
+> <i_i_glide_posenum>
+294
+
+> <r_i_docking_score>
+-8.69162
+
+> <r_i_glide_ecoul>
+-14.7519
+
+> <r_i_glide_einternal>
+5.89466
+
+> <r_i_glide_emodel>
+-97.7232
+
+> <r_i_glide_energy>
+-63.1839
+
+> <r_i_glide_erotb>
+0.517993
+
+> <r_i_glide_esite>
+-0.0119369
+
+> <r_i_glide_evdw>
+-48.432
+
+> <r_i_glide_gscore>
+-8.69162
+
+> <r_i_glide_hbond>
+-0.870172
+
+> <r_i_glide_ligand_efficiency>
+-0.321912
+
+> <r_i_glide_ligand_efficiency_ln>
+-2.02327
+
+> <r_i_glide_ligand_efficiency_sa>
+-0.965735
+
+> <r_i_glide_lipo>
+-2.92829
+
+> <r_i_glide_metal>
+-0
+
+> <r_i_glide_rewards>
+-0.764823
+
+> <r_i_glide_rmsd>
+0.463026
+
+$$$$
diff --git a/modules/io/tests/testfiles/sdf_v3000/multiple.sdf b/modules/io/tests/testfiles/sdf_v3000/multiple.sdf
new file mode 100644
index 0000000000000000000000000000000000000000..339ef0a58f64cb51c493c6296004cda33f1cc37a
--- /dev/null
+++ b/modules/io/tests/testfiles/sdf_v3000/multiple.sdf
@@ -0,0 +1,100 @@
+Simple Ligand 1
+ OpenBabel06052308472D
+Teststructure
+ 0 0 0 0 0 999 V3000
+M V30 BEGIN CTAB
+M V30 COUNTS 6 6 0 0 1
+M V30 BEGIN ATOM
+M V30 1 N 0 0 0 0 CHG=1
+M V30 2 C 1 0 0 0
+M V30 3 O 0 1 0 0
+M V30 4 S 1 1 0 0
+M V30 5 C 2 2 0 0
+M V30 6 Cl -1 -1 0 0
+M V30 END ATOM
+M V30 BEGIN BOND
+M V30 1 2 1 2
+M V30 2 1 1 3
+M V30 3 1 1 6
+M V30 4 1 2 4
+M V30 5 1 3 4
+M V30 6 3 4 5
+M V30 END BOND
+M V30 END CTAB
+M END
+$$$$
+Simple Ligand 2
+ OpenBabel06052308472D
+Teststructure
+ 0 0 0 0 0 999 V3000
+M V30 BEGIN CTAB
+M V30 COUNTS 6 6 0 0 1
+M V30 BEGIN ATOM
+M V30 1 N 0 0 0 0 CHG=1
+M V30 2 C 1 0 0 0
+M V30 3 O 0 1 0 0
+M V30 4 S 1 1 0 0
+M V30 5 C 2 2 0 0
+M V30 6 Cl -1 -1 0 0
+M V30 END ATOM
+M V30 BEGIN BOND
+M V30 1 2 1 2
+M V30 2 1 1 3
+M V30 3 1 1 6
+M V30 4 1 2 4
+M V30 5 1 3 4
+M V30 6 3 4 5
+M V30 END BOND
+M V30 END CTAB
+M END
+$$$$
+Simple Ligand 3
+ OpenBabel06052308472D
+Teststructure
+ 0 0 0 0 0 999 V3000
+M V30 BEGIN CTAB
+M V30 COUNTS 6 6 0 0 1
+M V30 BEGIN ATOM
+M V30 1 N 0 0 0 0 CHG=1
+M V30 2 C 1 0 0 0
+M V30 3 O 0 1 0 0
+M V30 4 S 1 1 0 0
+M V30 5 C 2 2 0 0
+M V30 6 Cl -1 -1 0 0
+M V30 END ATOM
+M V30 BEGIN BOND
+M V30 1 2 1 2
+M V30 2 1 1 3
+M V30 3 1 1 6
+M V30 4 1 2 4
+M V30 5 1 3 4
+M V30 6 3 4 5
+M V30 END BOND
+M V30 END CTAB
+M END
+$$$$
+Simple Ligand 4
+ OpenBabel06052308472D
+Teststructure
+ 0 0 0 0 0 999 V3000
+M V30 BEGIN CTAB
+M V30 COUNTS 6 6 0 0 1
+M V30 BEGIN ATOM
+M V30 1 N 0 0 0 0 CHG=1
+M V30 2 C 1 0 0 0
+M V30 3 O 0 1 0 0
+M V30 4 S 1 1 0 0
+M V30 5 C 2 2 0 0
+M V30 6 Cl -1 -1 0 0
+M V30 END ATOM
+M V30 BEGIN BOND
+M V30 1 2 1 2
+M V30 2 1 1 3
+M V30 3 1 1 6
+M V30 4 1 2 4
+M V30 5 1 3 4
+M V30 6 3 4 5
+M V30 END BOND
+M V30 END CTAB
+M END
+$$$$
diff --git a/modules/io/tests/testfiles/sdf_v3000/properties.sdf b/modules/io/tests/testfiles/sdf_v3000/properties.sdf
new file mode 100644
index 0000000000000000000000000000000000000000..2f6b6ed0be990baba2708a73a96619264944fcf3
--- /dev/null
+++ b/modules/io/tests/testfiles/sdf_v3000/properties.sdf
@@ -0,0 +1,62 @@
+Simple Ligand 1
+ OpenBabel06052308492D
+Teststructure
+ 0 0 0 0 0 999 V3000
+M V30 BEGIN CTAB
+M V30 COUNTS 6 6 0 0 1
+M V30 BEGIN ATOM
+M V30 1 N 0 0 0 0 CHG=1
+M V30 2 C 1 0 0 0
+M V30 3 O 0 1 0 0
+M V30 4 S 1 1 0 0
+M V30 5 C 2 2 0 0
+M V30 6 Cl -1 -1 0 0
+M V30 END ATOM
+M V30 BEGIN BOND
+M V30 1 2 1 2
+M V30 2 1 1 3
+M V30 3 1 1 6
+M V30 4 1 2 4
+M V30 5 1 3 4
+M V30 6 3 4 5
+M V30 END BOND
+M V30 END CTAB
+M END
+> <prop_one>
+1
+
+> <prop_two>
+-2.2
+
+$$$$
+Simple Ligand 2
+ OpenBabel06052308492D
+Teststructure
+ 0 0 0 0 0 999 V3000
+M V30 BEGIN CTAB
+M V30 COUNTS 6 6 0 0 1
+M V30 BEGIN ATOM
+M V30 1 N 0 0 0 0 CHG=1
+M V30 2 C 1 0 0 0
+M V30 3 O 0 1 0 0
+M V30 4 S 1 1 0 0
+M V30 5 C 2 2 0 0
+M V30 6 Cl -1 -1 0 0
+M V30 END ATOM
+M V30 BEGIN BOND
+M V30 1 2 1 2
+M V30 2 1 1 3
+M V30 3 1 1 6
+M V30 4 1 2 4
+M V30 5 1 3 4
+M V30 6 3 4 5
+M V30 END BOND
+M V30 END CTAB
+M END
+> <prop_one>
+2
+
+> <prop_two>
+-4.4
+
+$$$$
diff --git a/modules/io/tests/testfiles/sdf_v3000/simple.sdf b/modules/io/tests/testfiles/sdf_v3000/simple.sdf
new file mode 100644
index 0000000000000000000000000000000000000000..1d4946404ec77c7ab100a48d1bcd0b17f94744ac
--- /dev/null
+++ b/modules/io/tests/testfiles/sdf_v3000/simple.sdf
@@ -0,0 +1,26 @@
+Simple Ligand
+ OpenBabel06022310462D
+Teststructure
+ 0 0 0 0 0 999 V3000
+M V30 BEGIN CTAB
+M V30 COUNTS 6 6 0 0 1
+M V30 BEGIN ATOM
+M V30 1 N 0 0 0 0 Rgroups=(2 1 2) CHG=-
+M V30 3
+M V30 2 C 1 0 0 0
+M V30 3 O 0 1 0 0
+M V30 4 S 1 1 0 0
+M V30 5 C 2 2 0 0
+M V30 6 Cl -1 -1 0 0
+M V30 END ATOM
+M V30 BEGIN BOND
+M V30 1 2 1 2
+M V30 2 1 1 3
+M V30 3 1 1 6
+M V30 4 1 2 4
+M V30 5 1 3 4
+M V30 6 3 4 5
+M V30 END BOND
+M V30 END CTAB
+M END
+$$$$
diff --git a/modules/io/tests/testfiles/sdf_v3000/test.py b/modules/io/tests/testfiles/sdf_v3000/test.py
new file mode 100644
index 0000000000000000000000000000000000000000..85fa247dbe95dc5f9bd6aaadbd117f4dc07bb7da
--- /dev/null
+++ b/modules/io/tests/testfiles/sdf_v3000/test.py
@@ -0,0 +1,5 @@
+#!/usr/bin/env python
+
+import ost.io
+ent = ost.io.LoadSDF("simple.sdf")
+
diff --git a/modules/io/tests/testfiles/sdf_v3000/wrong_atomcount.sdf b/modules/io/tests/testfiles/sdf_v3000/wrong_atomcount.sdf
new file mode 100644
index 0000000000000000000000000000000000000000..6914bb7be339dd859f1b6dda565a4732ddf69b57
--- /dev/null
+++ b/modules/io/tests/testfiles/sdf_v3000/wrong_atomcount.sdf
@@ -0,0 +1,26 @@
+Simple Ligand
+ OpenBabel06022310462D
+Teststructure
+ 0 0 0 0 0 999 V3000
+M V30 BEGIN CTAB
+M V30 COUNTS 7 6 0 0 1
+M V30 BEGIN ATOM
+M V30 1 N 0 0 0 0 CHG=-
+M V30 1
+M V30 2 C 1 0 0 0
+M V30 3 O 0 1 0 0
+M V30 4 S 1 1 0 0
+M V30 5 C 2 2 0 0
+M V30 6 Cl -1 -1 0 0
+M V30 END ATOM
+M V30 BEGIN BOND
+M V30 1 2 1 2
+M V30 2 1 1 3
+M V30 3 1 1 6
+M V30 4 1 2 4
+M V30 5 1 3 4
+M V30 6 3 4 5
+M V30 END BOND
+M V30 END CTAB
+M END
+$$$$
diff --git a/modules/io/tests/testfiles/sdf_v3000/wrong_atomlinelength.sdf b/modules/io/tests/testfiles/sdf_v3000/wrong_atomlinelength.sdf
new file mode 100644
index 0000000000000000000000000000000000000000..db284bab1c22ed2683e5a4f485cd114ca6df6a77
--- /dev/null
+++ b/modules/io/tests/testfiles/sdf_v3000/wrong_atomlinelength.sdf
@@ -0,0 +1,26 @@
+Simple Ligand
+ OpenBabel06022310462D
+Teststructure
+ 0 0 0 0 0 999 V3000
+M V30 BEGIN CTAB
+M V30 COUNTS 6 6 0 0 1
+M V30 BEGIN ATOM
+M V30 1 N 0 0 0 0 CHG=-
+M V30 1
+M V30 2 C 1 0 0
+M V30 3 O 0 1 0 0
+M V30 4 S 1 1 0 0
+M V30 5 C 2 2 0 0
+M V30 6 Cl -1 -1 0 0
+M V30 END ATOM
+M V30 BEGIN BOND
+M V30 1 2 1 2
+M V30 2 1 1 3
+M V30 3 1 1 6
+M V30 4 1 2 4
+M V30 5 1 3 4
+M V30 6 3 4 5
+M V30 END BOND
+M V30 END CTAB
+M END
+$$$$
diff --git a/modules/io/tests/testfiles/sdf_v3000/wrong_bondatomnumber.sdf b/modules/io/tests/testfiles/sdf_v3000/wrong_bondatomnumber.sdf
new file mode 100644
index 0000000000000000000000000000000000000000..bd9115bfbae2ca0e49949325a6d6ebb3f6414b23
--- /dev/null
+++ b/modules/io/tests/testfiles/sdf_v3000/wrong_bondatomnumber.sdf
@@ -0,0 +1,26 @@
+Simple Ligand
+ OpenBabel06022310462D
+Teststructure
+ 0 0 0 0 0 999 V3000
+M V30 BEGIN CTAB
+M V30 COUNTS 6 6 0 0 1
+M V30 BEGIN ATOM
+M V30 1 N 0 0 0 0 CHG=-
+M V30 1
+M V30 2 C 1 0 0 0
+M V30 3 O 0 1 0 0
+M V30 4 S 1 1 0 0
+M V30 5 C 2 2 0 0
+M V30 6 Cl -1 -1 0 0
+M V30 END ATOM
+M V30 BEGIN BOND
+M V30 1 2 1 2
+M V30 2 1 1 3
+M V30 3 1 1 8
+M V30 4 1 2 4
+M V30 5 1 3 4
+M V30 6 3 4 5
+M V30 END BOND
+M V30 END CTAB
+M END
+$$$$
diff --git a/modules/io/tests/testfiles/sdf_v3000/wrong_bondcount.sdf b/modules/io/tests/testfiles/sdf_v3000/wrong_bondcount.sdf
new file mode 100644
index 0000000000000000000000000000000000000000..384d29ff4717fb5949ffe2835ad39c077c328afe
--- /dev/null
+++ b/modules/io/tests/testfiles/sdf_v3000/wrong_bondcount.sdf
@@ -0,0 +1,26 @@
+Simple Ligand
+ OpenBabel06022310462D
+Teststructure
+ 0 0 0 0 0 999 V3000
+M V30 BEGIN CTAB
+M V30 COUNTS 6 7 0 0 1
+M V30 BEGIN ATOM
+M V30 1 N 0 0 0 0 CHG=-
+M V30 1
+M V30 2 C 1 0 0 0
+M V30 3 O 0 1 0 0
+M V30 4 S 1 1 0 0
+M V30 5 C 2 2 0 0
+M V30 6 Cl -1 -1 0 0
+M V30 END ATOM
+M V30 BEGIN BOND
+M V30 1 2 1 2
+M V30 2 1 1 3
+M V30 3 1 1 6
+M V30 4 1 2 4
+M V30 5 1 3 4
+M V30 6 3 4 5
+M V30 END BOND
+M V30 END CTAB
+M END
+$$$$
diff --git a/modules/io/tests/testfiles/sdf_v3000/wrong_bondlinelength.sdf b/modules/io/tests/testfiles/sdf_v3000/wrong_bondlinelength.sdf
new file mode 100644
index 0000000000000000000000000000000000000000..4b994b3f1accd915bbd822087d2c286487de5d0c
--- /dev/null
+++ b/modules/io/tests/testfiles/sdf_v3000/wrong_bondlinelength.sdf
@@ -0,0 +1,26 @@
+Simple Ligand
+ OpenBabel06022310462D
+Teststructure
+ 0 0 0 0 0 999 V3000
+M V30 BEGIN CTAB
+M V30 COUNTS 6 6 0 0 1
+M V30 BEGIN ATOM
+M V30 1 N 0 0 0 0 CHG=-
+M V30 1
+M V30 2 C 1 0 0 0
+M V30 3 O 0 1 0 0
+M V30 4 S 1 1 0 0
+M V30 5 C 2 2 0 0
+M V30 6 Cl -1 -1 0 0
+M V30 END ATOM
+M V30 BEGIN BOND
+M V30 1 2 1 2
+M V30 2 1 1
+M V30 3 1 1 6
+M V30 4 1 2 4
+M V30 5 1 3 4
+M V30 6 3 4 5
+M V30 END BOND
+M V30 END CTAB
+M END
+$$$$
diff --git a/modules/io/tests/testfiles/sdf_v3000/wrong_bondtype.sdf b/modules/io/tests/testfiles/sdf_v3000/wrong_bondtype.sdf
new file mode 100644
index 0000000000000000000000000000000000000000..da4ad57405ee06f8a4645420e3f6841b5c8b68b8
--- /dev/null
+++ b/modules/io/tests/testfiles/sdf_v3000/wrong_bondtype.sdf
@@ -0,0 +1,26 @@
+Simple Ligand
+ OpenBabel06022310462D
+Teststructure
+ 0 0 0 0 0 999 V3000
+M V30 BEGIN CTAB
+M V30 COUNTS 6 6 0 0 1
+M V30 BEGIN ATOM
+M V30 1 N 0 0 0 0 CHG=-
+M V30 1
+M V30 2 C 1 0 0 0
+M V30 3 O 0 1 0 0
+M V30 4 S 1 1 0 0
+M V30 5 C 2 2 0 0
+M V30 6 Cl -1 -1 0 0
+M V30 END ATOM
+M V30 BEGIN BOND
+M V30 1 2 1 2
+M V30 2 1 1 3
+M V30 3 1 1 6
+M V30 4 -1 2 4
+M V30 5 1 3 4
+M V30 6 3 4 5
+M V30 END BOND
+M V30 END CTAB
+M END
+$$$$
diff --git a/modules/io/tests/testfiles/sdf_v3000/wrong_charge.sdf b/modules/io/tests/testfiles/sdf_v3000/wrong_charge.sdf
new file mode 100644
index 0000000000000000000000000000000000000000..ac7ee610f06570f2314df73646b1f27d51662b28
--- /dev/null
+++ b/modules/io/tests/testfiles/sdf_v3000/wrong_charge.sdf
@@ -0,0 +1,26 @@
+Simple Ligand
+ OpenBabel06022310462D
+Teststructure
+ 0 0 0 0 0 999 V3000
+M V30 BEGIN CTAB
+M V30 COUNTS 6 6 0 0 1
+M V30 BEGIN ATOM
+M V30 1 N 0 0 0 0 CHG=-
+M V30 i
+M V30 2 C 1 0 0 0
+M V30 3 O 0 1 0 0
+M V30 4 S 1 1 0 0
+M V30 5 C 2 2 0 0
+M V30 6 Cl -1 -1 0 0
+M V30 END ATOM
+M V30 BEGIN BOND
+M V30 1 2 1 2
+M V30 2 1 1 3
+M V30 3 1 1 6
+M V30 4 1 2 4
+M V30 5 1 3 4
+M V30 6 3 4 5
+M V30 END BOND
+M V30 END CTAB
+M END
+$$$$
diff --git a/modules/io/tests/testfiles/sdf_v3000/wrong_keyword.sdf b/modules/io/tests/testfiles/sdf_v3000/wrong_keyword.sdf
new file mode 100644
index 0000000000000000000000000000000000000000..eb79262e467962dd7ab9b7a2b055e41c1ec4e824
--- /dev/null
+++ b/modules/io/tests/testfiles/sdf_v3000/wrong_keyword.sdf
@@ -0,0 +1,26 @@
+Simple Ligand
+ OpenBabel06022310462D
+Teststructure
+ 0 0 0 0 0 999 V3000
+M V30 BEGIN CTAB
+M V30 COUNTS 6 6 0 0 1
+M V30 BEGIN ATOM
+M V30 1 N 0 0 0 0 Rgroups=(2 1 2) CHG=-
+M V30 3
+M V30 2 C 1 0 0 0
+M V30 3 O 0 1 0 0 CHG= 2
+M V30 4 S 1 1 0 0
+M V30 5 C 2 2 0 0
+M V30 6 Cl -1 -1 0 0
+M V30 END ATOM
+M V30 BEGIN BOND
+M V30 1 2 1 2
+M V30 2 1 1 3
+M V30 3 1 1 6
+M V30 4 1 2 4
+M V30 5 1 3 4
+M V30 6 3 4 5
+M V30 END BOND
+M V30 END CTAB
+M END
+$$$$
diff --git a/modules/mol/alg/doc/molalg.rst b/modules/mol/alg/doc/molalg.rst
index 3a43ea5de90b8b5bf14393c15754b09b6e2d37d4..366b1cb83e8a861740075e6fec0e2e24479bc6b4 100644
--- a/modules/mol/alg/doc/molalg.rst
+++ b/modules/mol/alg/doc/molalg.rst
@@ -162,6 +162,17 @@ Local Distance Test scores (lDDT, DRMSD)
.. currentmodule:: ost.mol.alg
+:mod:`Contact Scores <ost.mol.alg.contact_scores>` -- Contact based scores
+--------------------------------------------------------------------------------
+
+.. automodule:: ost.mol.alg.contact_score
+ :members:
+ :member-order: bysource
+ :synopsis: Contact Scores
+
+.. currentmodule:: ost.mol.alg
+
+
.. _steric-clashes:
Steric Clashes
@@ -1403,3 +1414,70 @@ API
:type ent: :class:`~ost.mol.EntityHandle`
:param lib: Compound library
:type lib: :class:`~ost.conop.CompoundLib`
+
+
+
+Biounits
+--------------------------------------------------------------------------------
+
+Biological assemblies, i.e. biounits, are an integral part of mmCIF files and
+their construction is fully defined in :class:`ost.io.MMCifInfoBioUnit`.
+:func:`ost.io.MMCifInfoBioUnit.PDBize` provides one possibility to construct
+such biounits with compatibility with the PDB format in mind. That is single
+character chain names, dumping all ligands in one chain etc. Here we provide a
+more mmCIF-style way of constructing biounits. This can either be done starting
+from a :class:`ost.io.MMCifInfoBioUnit` or the derived
+:class:`ost.mol.alg.BUInfo`. The latter is a minimalistic representation of
+:class:`ost.io.MMCifInfoBioUnit` and can be serialized to a byte string.
+
+.. class:: BUInfo(mmcif_buinfo):
+
+ Preprocesses data from :class:`ost.io.MMCifInfoBioUnit` that are required
+ to construct a biounit from an assymetric unit. Can be serialized.
+
+ :param mmcif_buinfo: Biounit definition
+ :type mmcif_buinfo: :class:`ost.io.MMCifInfoBioUnit`
+
+ .. method:: ToBytes()
+
+ :returns: A byte string from which the object can be reconstructed.
+
+ .. staticmethod:: FromBytes(byte_string)
+
+ :param byte_string: Can be created with :func:`ToBytes`
+ :returns: A :class:`BUInfo` object
+
+.. function:: CreateBU(asu, bu_info)
+
+ Constructs a biounit given an assymetric unit and transformation
+ information. The following properties are copied from the assymetric
+ unit and are expected to be set (this is the case if you use
+ :func:`ost.io.LoadMMCIF` for the assymetric unit):
+
+ * Chain level:
+
+ * Chain type (see :attr:`ost.mol.ChainHandle.type`)
+
+ * Residue level:
+
+ * Chem type (see :attr:`ost.mol.ResidueHandle.chem_type`)
+ * Chem class (:attr:`ost.mol.ResidueHandle.chem_class`)
+ * One letter code (see :attr:`ost.mol.ResidueHandle.one_letter_code`)
+ * Secondary structure (see :attr:`ost.mol.ResidueHandle.sec_structure`)
+ * IsProtein and IsLigand properties (see :attr:`ost.mol.ResidueHandle.is_protein`/:attr:`ost.mol.ResidueHandle.is_ligand`)
+
+ Each chain in the returned biounit can be referenced back to the
+ assymetric unit as they follow a standardised naming scheme:
+ <*idx*>.<*asu_cname*>, where *asu_cname* is the chain name in the assymetric
+ unit and *idx* is the nth occurence of that chain in the biounit with
+ one based indexing. There is a quirk though. An index of 1, for example 1.A,
+ is reserved for the original AU chain with identity transform (read: no
+ transform) applied. If a certain AU chain only occurs with an actual
+ transform applied, numbering starts at 2.
+
+ :param asu: The assymetric unit
+ :type asu: :class:`ost.mol.EntityHandle`
+ :param bu_info: Info object
+ :type bu_info: :class:`MMCifInfoBioUnit`/:class:`BUInfo`
+ :returns: A :class:`ost.mol.EntityHandle` of the requested biounit
+
diff --git a/modules/mol/alg/pymod/CMakeLists.txt b/modules/mol/alg/pymod/CMakeLists.txt
index 9c65a6b87cf2b330b53868278135f62e473d036b..146774722d330305601088fd7fa18735b821c001 100644
--- a/modules/mol/alg/pymod/CMakeLists.txt
+++ b/modules/mol/alg/pymod/CMakeLists.txt
@@ -11,6 +11,7 @@ set(OST_MOL_ALG_PYMOD_SOURCES
export_molck.cc
export_membrane.cc
export_entity_to_density.cc
+ export_biounit.cc
)
set(OST_MOL_ALG_PYMOD_MODULES
@@ -29,6 +30,7 @@ set(OST_MOL_ALG_PYMOD_MODULES
stereochemistry.py
ligand_scoring.py
dockq.py
+ contact_score.py
)
if (NOT ENABLE_STATIC)
diff --git a/modules/mol/alg/pymod/chain_mapping.py b/modules/mol/alg/pymod/chain_mapping.py
index 25a19259a2de600490e74a89f292246ed15e76e3..417cfa58d59b55c1e67be4e3d3b40dd1251f53de 100644
--- a/modules/mol/alg/pymod/chain_mapping.py
+++ b/modules/mol/alg/pymod/chain_mapping.py
@@ -12,6 +12,7 @@ from scipy.special import factorial
from scipy.special import binom # as of Python 3.8, the math module implements
# comb, i.e. n choose k
+import ost
from ost import seq
from ost import mol
from ost import geom
@@ -786,8 +787,8 @@ class ChainMapper:
def GetlDDTMapping(self, model, inclusion_radius=15.0,
thresholds=[0.5, 1.0, 2.0, 4.0], strategy="naive",
- steep_opt_rate = None, full_n_mdl_chains = None,
- block_seed_size = 5, block_blocks_per_chem_group = 5,
+ steep_opt_rate = None, block_seed_size = 5,
+ block_blocks_per_chem_group = 5,
chem_mapping_result = None):
""" Identify chain mapping by optimizing lDDT score
@@ -814,15 +815,12 @@ class ChainMapper:
* **greedy_full**: try multiple seeds for greedy extension, i.e. try
all ref/mdl chain combinations within the respective chem groups and
- retain the mapping leading to the best lDDT. Optionally, you can
- reduce the number of mdl chains per ref chain to the
- *full_n_mdl_chains* best scoring ones.
+ retain the mapping leading to the best lDDT.
* **greedy_block**: try multiple seeds for greedy extension, i.e. try
all ref/mdl chain combinations within the respective chem groups and
- compute single chain lDDTs. The *block_blocks_per_chem_group* best
- scoring ones are extend by *block_seed_size* chains and the best
- scoring one is exhaustively extended.
+ extend them to *block_seed_size*. *block_blocks_per_chem_group*
+ for each chem group are selected for exhaustive extension.
Sets :attr:`MappingResult.opt_score` in case of no trivial one-to-one
mapping.
@@ -845,10 +843,6 @@ class ChainMapper:
swaps that improve lDDT score. Iteration stops as
soon as no improvement can be achieved anymore.
:type steep_opt_rate: :class:`int`
- :param full_n_mdl_chains: Param for *greedy_full* strategy - Max number of
- mdl chains that are tried per ref chain. The
- default (None) tries all of them.
- :type full_n_mdl_chains: :class:`int`
:param block_seed_size: Param for *greedy_block* strategy - Initial seeds
are extended by that number of chains.
:type block_seed_size: :class:`int`
@@ -911,7 +905,7 @@ class ChainMapper:
if strategy == "greedy_fast":
mapping = _lDDTGreedyFast(the_greed)
elif strategy == "greedy_full":
- mapping = _lDDTGreedyFull(the_greed, full_n_mdl_chains)
+ mapping = _lDDTGreedyFull(the_greed)
elif strategy == "greedy_block":
mapping = _lDDTGreedyBlock(the_greed, block_seed_size,
block_blocks_per_chem_group)
@@ -932,16 +926,14 @@ class ChainMapper:
def GetQSScoreMapping(self, model, contact_d = 12.0, strategy = "naive",
- full_n_mdl_chains = None, block_seed_size = 5,
- block_blocks_per_chem_group = 5,
- steep_opt_rate = None, chem_mapping_result = None):
+ block_seed_size = 5, block_blocks_per_chem_group = 5,
+ steep_opt_rate = None, chem_mapping_result = None,
+ greedy_prune_contact_map = False):
""" Identify chain mapping based on QSScore
Scoring is based on CA/C3' positions which are present in all chains of
a :attr:`chem_groups` as well as the *model* chains which are mapped to
- that respective chem group. QS score is not defined for single chains.
- The greedy strategies that require to identify starting seeds thus
- often rely on single chain lDDTs.
+ that respective chem group.
The following strategies are available:
@@ -951,19 +943,16 @@ class ChainMapper:
* **greedy_fast**: perform all vs. all single chain lDDTs within the
respective ref/mdl chem groups. The mapping with highest number of
conserved contacts is selected as seed for greedy extension.
- Extension is based on QS score.
+ Extension is based on QS-score.
* **greedy_full**: try multiple seeds for greedy extension, i.e. try
all ref/mdl chain combinations within the respective chem groups and
- retain the mapping leading to the best QS score. Optionally, you can
- reduce the number of mdl chains per ref chain to the
- *full_n_mdl_chains* best scoring with respect to single chain lDDT.
+ retain the mapping leading to the best QS-score.
* **greedy_block**: try multiple seeds for greedy extension, i.e. try
all ref/mdl chain combinations within the respective chem groups and
- compute single chain lDDTs. The *block_blocks_per_chem_group* best
- scoring ones are extend by *block_seed_size* chains and the block with
- with best QS score is exhaustively extended.
+ extend them to *block_seed_size*. *block_blocks_per_chem_group*
+ for each chem group are selected for exhaustive extension.
Sets :attr:`MappingResult.opt_score` in case of no trivial one-to-one
mapping.
@@ -980,6 +969,17 @@ class ChainMapper:
*model*. If set, *model* parameter is not
used.
:type chem_mapping_result: :class:`tuple`
+ :param greedy_prune_contact_map: Relevant for all strategies that use
+ greedy extensions. If True, only chains
+ with at least 3 contacts (8A CB
+ distance) towards already mapped chains
+ in trg/mdl are considered for
+ extension. All chains that give a
+ potential non-zero QS-score increase
+ are used otherwise (at least one
+ contact within 12A). The consequence
+ is reduced runtime and usually no
+ real reduction in accuracy.
:returns: A :class:`MappingResult`
"""
@@ -1023,18 +1023,18 @@ class ChainMapper:
self.chem_groups,
chem_mapping, ref_mdl_alns,
contact_d = contact_d,
- steep_opt_rate=steep_opt_rate)
+ steep_opt_rate=steep_opt_rate,
+ greedy_prune_contact_map = greedy_prune_contact_map)
if strategy == "greedy_fast":
mapping = _QSScoreGreedyFast(the_greed)
elif strategy == "greedy_full":
- mapping = _QSScoreGreedyFull(the_greed, full_n_mdl_chains)
+ mapping = _QSScoreGreedyFull(the_greed)
elif strategy == "greedy_block":
mapping = _QSScoreGreedyBlock(the_greed, block_seed_size,
block_blocks_per_chem_group)
# cached => QSScore computation is fast here
opt_qsscore = the_greed.Score(mapping, check=False)
-
alns = dict()
for ref_group, mdl_group in zip(self.chem_groups, mapping):
for ref_ch, mdl_ch in zip(ref_group, mdl_group):
@@ -1228,25 +1228,24 @@ class ChainMapper:
return MappingResult(self.target, mdl, self.chem_groups, chem_mapping,
final_mapping, alns)
- def GetMapping(self, model, n_max_naive = 12):
+ def GetMapping(self, model, n_max_naive = 40320):
""" Convenience function to get mapping with currently preferred method
- If number of chains in model and target are <= *n_max_naive*, a naive
- QS-score mapping is performed. For anything else, a QS-score mapping
- with the greedy_block strategy is performed (steep_opt_rate = 3,
- block_seed_size = 5, block_blocks_per_chem_group = 6).
+ If number of possible chain mappings is <= *n_max_naive*, a naive
+ QS-score mapping is performed and optimal QS-score is guaranteed.
+ For anything else, a QS-score mapping with the greedy_full strategy is
+ performed (greedy_prune_contact_map = True). The default for
+ *n_max_naive* of 40320 corresponds to an octamer (8!=40320). A
+ structure with stoichiometry A6B2 would be 6!*2!=1440 etc.
"""
- n_trg_chains = len(self.target.chains)
- res = self.GetChemMapping(model)
- n_mdl_chains = len(res[2].chains)
- if n_trg_chains <= n_max_naive and n_mdl_chains <= n_max_naive:
+ chem_mapping_res = self.GetChemMapping(model)
+ if _NMappingsWithin(self.chem_groups, chem_mapping_res[0], n_max_naive):
return self.GetQSScoreMapping(model, strategy="naive",
- chem_mapping_result=res)
+ chem_mapping_result=chem_mapping_res)
else:
- return self.GetQSScoreMapping(model, strategy="greedy_block",
- steep_opt_rate=3, block_seed_size=5,
- block_blocks_per_chem_group=6,
- chem_mapping_result=res)
+ return self.GetQSScoreMapping(model, strategy="greedy_full",
+ greedy_prune_contact_map=True,
+ chem_mapping_result=chem_mapping_res)
def GetRepr(self, substructure, model, topn=1, inclusion_radius=15.0,
thresholds=[0.5, 1.0, 2.0, 4.0], bb_only=False,
@@ -1467,6 +1466,7 @@ class ChainMapper:
no_intrachain = only_interchain)
if lDDT is None:
+ ost.LogVerbose("No valid contacts in the reference")
lDDT = 0.0 # that means, that we have not a single valid contact
# in lDDT. For the code below to work, we just set it
# to a terrible score => 0.0
@@ -2231,12 +2231,6 @@ class _lDDTGreedySearcher(_lDDTDecomposer):
if len(mapping) == 0:
raise RuntimError("Mapping must contain a starting point")
- for ref_ch, mdl_ch in mapping.items():
- assert(ref_ch in self.ref_ch_group_mapper)
- assert(mdl_ch in self.mdl_ch_group_mapper)
- assert(self.ref_ch_group_mapper[ref_ch] == \
- self.mdl_ch_group_mapper[mdl_ch])
-
# Ref chains onto which we can map. The algorithm starts with a mapping
# on ref_ch. From there we can start to expand to connected neighbors.
# All neighbors that we can reach from the already mapped chains are
@@ -2406,6 +2400,19 @@ def _lDDTNaive(trg, mdl, inclusion_radius, thresholds, chem_groups,
return (best_mapping, best_lddt)
+def _GetSeeds(ref_chem_groups, mdl_chem_groups, mapped_ref_chains = set(),
+ mapped_mdl_chains = set()):
+ seeds = list()
+ for ref_chains, mdl_chains in zip(ref_chem_groups,
+ mdl_chem_groups):
+ for ref_ch in ref_chains:
+ if ref_ch not in mapped_ref_chains:
+ for mdl_ch in mdl_chains:
+ if mdl_ch not in mapped_mdl_chains:
+ seeds.append((ref_ch, mdl_ch))
+ return seeds
+
+
def _lDDTGreedyFast(the_greed):
something_happened = True
@@ -2413,21 +2420,18 @@ def _lDDTGreedyFast(the_greed):
while something_happened:
something_happened = False
+ seeds = _GetSeeds(the_greed.ref_chem_groups,
+ the_greed.mdl_chem_groups,
+ mapped_ref_chains = set(mapping.keys()),
+ mapped_mdl_chains = set(mapping.values()))
# search for best scoring starting point
n_best = 0
best_seed = None
- mapped_ref_chains = set(mapping.keys())
- mapped_mdl_chains = set(mapping.values())
- for ref_chains, mdl_chains in zip(the_greed.ref_chem_groups,
- the_greed.mdl_chem_groups):
- for ref_ch in ref_chains:
- if ref_ch not in mapped_ref_chains:
- for mdl_ch in mdl_chains:
- if mdl_ch not in mapped_mdl_chains:
- n = the_greed.SCCounts(ref_ch, mdl_ch)
- if n > n_best:
- n_best = n
- best_seed = (ref_ch, mdl_ch)
+ for seed in seeds:
+ n = the_greed.SCCounts(seed[0], seed[1])
+ if n > n_best:
+ n_best = n
+ best_seed = seed
if n_best == 0:
break # no proper seed found anymore...
# add seed to mapping and start the greed
@@ -2435,7 +2439,6 @@ def _lDDTGreedyFast(the_greed):
mapping = the_greed.ExtendMapping(mapping)
something_happened = True
-
# translate mapping format and return
final_mapping = list()
for ref_chains in the_greed.ref_chem_groups:
@@ -2450,53 +2453,49 @@ def _lDDTGreedyFast(the_greed):
return final_mapping
-def _lDDTGreedyFull(the_greed, n_mdl_chains):
+def _lDDTGreedyFull(the_greed):
""" Uses each reference chain as starting point for expansion
-
- However, not all mdl chain are mapped onto these reference chains,
- that's controlled by *n_mdl_chains*
"""
- if n_mdl_chains is not None and n_mdl_chains < 1:
- raise RuntimeError("n_mdl_chains must be None or >= 1")
+ seeds = _GetSeeds(the_greed.ref_chem_groups, the_greed.mdl_chem_groups)
+ best_overall_score = -1.0
+ best_overall_mapping = dict()
- something_happened = True
- mapping = dict()
+ for seed in seeds:
- while something_happened:
- something_happened = False
- # Try all possible starting points and keep the one giving the best lDDT
- best_lddt = 0.0
- best_mapping = None
- mapped_ref_chains = set(mapping.keys())
- mapped_mdl_chains = set(mapping.values())
- for ref_chains, mdl_chains in zip(the_greed.ref_chem_groups,
- the_greed.mdl_chem_groups):
- for ref_ch in ref_chains:
- if ref_ch not in mapped_ref_chains:
- seeds = list()
- for mdl_ch in mdl_chains:
- if mdl_ch not in mapped_mdl_chains:
- seeds.append((ref_ch, mdl_ch))
- if n_mdl_chains is not None and n_mdl_chains < len(seeds):
- counts = [the_greed.SCCounts(s[0], s[1]) for s in seeds]
- tmp = [(a,b) for a,b in zip(counts, seeds)]
- tmp.sort(reverse=True)
- seeds = [item[1] for item in tmp[:n_mdl_chains]]
- for seed in seeds:
- tmp_mapping = dict(mapping)
- tmp_mapping[seed[0]] = seed[1]
- tmp_mapping = the_greed.ExtendMapping(tmp_mapping)
- tmp_lddt = the_greed.lDDTFromFlatMap(tmp_mapping)
- if tmp_lddt > best_lddt:
- best_lddt = tmp_lddt
- best_mapping = tmp_mapping
-
- if best_lddt == 0.0:
- break # no proper mapping found anymore...
+ # do initial extension
+ mapping = the_greed.ExtendMapping({seed[0]: seed[1]})
+ # repeat the process until we have a full mapping
something_happened = True
- mapping = best_mapping
+ while something_happened:
+ something_happened = False
+ remnant_seeds = _GetSeeds(the_greed.ref_chem_groups,
+ the_greed.mdl_chem_groups,
+ mapped_ref_chains = set(mapping.keys()),
+ mapped_mdl_chains = set(mapping.values()))
+ if len(remnant_seeds) > 0:
+ # still more mapping to be done
+ best_score = -1.0
+ best_mapping = None
+ for remnant_seed in remnant_seeds:
+ tmp_mapping = dict(mapping)
+ tmp_mapping[remnant_seed[0]] = remnant_seed[1]
+ tmp_mapping = the_greed.ExtendMapping(tmp_mapping)
+ score = the_greed.lDDTFromFlatMap(tmp_mapping)
+ if score > best_score:
+ best_score = score
+ best_mapping = tmp_mapping
+ if best_mapping is not None:
+ something_happened = True
+ mapping = best_mapping
+
+ score = the_greed.lDDTFromFlatMap(mapping)
+ if score > best_overall_score:
+ best_overall_score = score
+ best_overall_mapping = mapping
+
+ mapping = best_overall_mapping
# translate mapping format and return
final_mapping = list()
@@ -2532,7 +2531,6 @@ def _lDDTGreedyBlock(the_greed, seed_size, blocks_per_chem_group):
mdl_chem_groups = copy.deepcopy(the_greed.mdl_chem_groups)
mapping = dict()
-
something_happened = True
while something_happened:
something_happened = False
@@ -2540,30 +2538,32 @@ def _lDDTGreedyBlock(the_greed, seed_size, blocks_per_chem_group):
for ref_chains, mdl_chains in zip(ref_chem_groups, mdl_chem_groups):
if len(mdl_chains) == 0:
continue # nothing to map
-
- # Identify starting seeds for *blocks_per_chem_group* blocks
- seeds = list()
- for ref_ch in ref_chains:
- seeds += [(ref_ch, mdl_ch) for mdl_ch in mdl_chains]
- counts = [the_greed.SCCounts(s[0], s[1]) for s in seeds]
- tmp = [(a,b) for a,b in zip(counts, seeds)]
- tmp.sort(reverse=True)
- seeds = [item[1] for item in tmp[:blocks_per_chem_group]]
-
- # extend starting seeds to *seed_size* and retain best scoring block
- # for further extension
- best_lddt = 0.0
- best_mapping = None
- for s in seeds:
- seed = dict(mapping)
- seed.update({s[0]: s[1]})
- seed = the_greed.ExtendMapping(seed, max_ext = max_ext)
- seed_lddt = the_greed.lDDTFromFlatMap(seed)
- if seed_lddt > best_lddt:
- best_lddt = seed_lddt
- best_mapping = seed
- if best_mapping != None:
- starting_blocks.append(best_mapping)
+ ref_chains_copy = list(ref_chains)
+ for i in range(blocks_per_chem_group):
+ if len(ref_chains_copy) == 0:
+ break
+ seeds = list()
+ for ref_ch in ref_chains_copy:
+ seeds += [(ref_ch, mdl_ch) for mdl_ch in mdl_chains]
+ # extend starting seeds to *seed_size* and retain best scoring
+ # block for further extension
+ best_score = -1.0
+ best_mapping = None
+ best_seed = None
+ for s in seeds:
+ seed = dict(mapping)
+ seed.update({s[0]: s[1]})
+ seed = the_greed.ExtendMapping(seed, max_ext = max_ext)
+ seed_lddt = the_greed.lDDTFromFlatMap(seed)
+ if seed_lddt > best_score:
+ best_score = seed_lddt
+ best_mapping = seed
+ best_seed = s
+ if best_mapping != None:
+ starting_blocks.append(best_mapping)
+ if best_seed[0] in ref_chains_copy:
+ # remove that ref chain to enforce diversity
+ ref_chains_copy.remove(best_seed[0])
# fully expand initial starting blocks
best_lddt = 0.0
@@ -2604,7 +2604,7 @@ def _lDDTGreedyBlock(the_greed, seed_size, blocks_per_chem_group):
class _QSScoreGreedySearcher(qsscore.QSScorer):
def __init__(self, ref, mdl, ref_chem_groups, mdl_chem_groups,
ref_mdl_alns, contact_d = 12.0,
- steep_opt_rate = None):
+ steep_opt_rate = None, greedy_prune_contact_map=False):
""" Greedy extension of already existing but incomplete chain mappings
"""
super().__init__(ref, ref_chem_groups, mdl, ref_mdl_alns,
@@ -2614,15 +2614,30 @@ class _QSScoreGreedySearcher(qsscore.QSScorer):
self.ref_mdl_alns = ref_mdl_alns
self.steep_opt_rate = steep_opt_rate
- self.neighbors = {k: set() for k in self.qsent1.chain_names}
- for p in self.qsent1.interacting_chains:
- self.neighbors[p[0]].add(p[1])
- self.neighbors[p[1]].add(p[0])
+ if greedy_prune_contact_map:
+ self.neighbors = {k: set() for k in self.qsent1.chain_names}
+ for p in self.qsent1.interacting_chains:
+ if np.count_nonzero(self.qsent1.PairDist(p[0], p[1])<=8) >= 3:
+ self.neighbors[p[0]].add(p[1])
+ self.neighbors[p[1]].add(p[0])
+
+ self.mdl_neighbors = {k: set() for k in self.qsent2.chain_names}
+ for p in self.qsent2.interacting_chains:
+ if np.count_nonzero(self.qsent2.PairDist(p[0], p[1])<=8) >= 3:
+ self.mdl_neighbors[p[0]].add(p[1])
+ self.mdl_neighbors[p[1]].add(p[0])
- self.mdl_neighbors = {k: set() for k in self.qsent2.chain_names}
- for p in self.qsent2.interacting_chains:
- self.mdl_neighbors[p[0]].add(p[1])
- self.mdl_neighbors[p[1]].add(p[0])
+
+ else:
+ self.neighbors = {k: set() for k in self.qsent1.chain_names}
+ for p in self.qsent1.interacting_chains:
+ self.neighbors[p[0]].add(p[1])
+ self.neighbors[p[1]].add(p[0])
+
+ self.mdl_neighbors = {k: set() for k in self.qsent2.chain_names}
+ for p in self.qsent2.interacting_chains:
+ self.mdl_neighbors[p[0]].add(p[1])
+ self.mdl_neighbors[p[1]].add(p[0])
assert(len(ref_chem_groups) == len(mdl_chem_groups))
self.ref_chem_groups = ref_chem_groups
@@ -2666,12 +2681,6 @@ class _QSScoreGreedySearcher(qsscore.QSScorer):
if len(mapping) == 0:
raise RuntimError("Mapping must contain a starting point")
- for ref_ch, mdl_ch in mapping.items():
- assert(ref_ch in self.ref_ch_group_mapper)
- assert(mdl_ch in self.mdl_ch_group_mapper)
- assert(self.ref_ch_group_mapper[ref_ch] == \
- self.mdl_ch_group_mapper[mdl_ch])
-
# Ref chains onto which we can map. The algorithm starts with a mapping
# on ref_ch. From there we can start to expand to connected neighbors.
# All neighbors that we can reach from the already mapped chains are
@@ -2718,6 +2727,8 @@ class _QSScoreGreedySearcher(qsscore.QSScorer):
for ref_ch in map_targets:
chem_group_idx = self.ref_ch_group_mapper[ref_ch]
for mdl_ch in free_mdl_chains[chem_group_idx]:
+ # we're not computing full QS-score here, we directly hack
+ # into the QS-score formula to compute a diff
nominator_diff = 0.0
denominator_diff = 0.0
for neighbor in self.neighbors[ref_ch]:
@@ -2833,24 +2844,20 @@ def _QSScoreGreedyFast(the_greed):
something_happened = True
mapping = dict()
-
while something_happened:
something_happened = False
# search for best scoring starting point, we're using lDDT here
n_best = 0
best_seed = None
- mapped_ref_chains = set(mapping.keys())
- mapped_mdl_chains = set(mapping.values())
- for ref_chains, mdl_chains in zip(the_greed.ref_chem_groups,
- the_greed.mdl_chem_groups):
- for ref_ch in ref_chains:
- if ref_ch not in mapped_ref_chains:
- for mdl_ch in mdl_chains:
- if mdl_ch not in mapped_mdl_chains:
- n = the_greed.SCCounts(ref_ch, mdl_ch)
- if n > n_best:
- n_best = n
- best_seed = (ref_ch, mdl_ch)
+ seeds = _GetSeeds(the_greed.ref_chem_groups,
+ the_greed.mdl_chem_groups,
+ mapped_ref_chains = set(mapping.keys()),
+ mapped_mdl_chains = set(mapping.values()))
+ for seed in seeds:
+ n = the_greed.SCCounts(seed[0], seed[1])
+ if n > n_best:
+ n_best = n
+ best_seed = seed
if n_best == 0:
break # no proper seed found anymore...
# add seed to mapping and start the greed
@@ -2858,7 +2865,6 @@ def _QSScoreGreedyFast(the_greed):
mapping = the_greed.ExtendMapping(mapping)
something_happened = True
-
# translate mapping format and return
final_mapping = list()
for ref_chains in the_greed.ref_chem_groups:
@@ -2873,53 +2879,49 @@ def _QSScoreGreedyFast(the_greed):
return final_mapping
-def _QSScoreGreedyFull(the_greed, n_mdl_chains):
+def _QSScoreGreedyFull(the_greed):
""" Uses each reference chain as starting point for expansion
-
- However, not all mdl chain are mapped onto these reference chains,
- that's controlled by *n_mdl_chains*
"""
- if n_mdl_chains is not None and n_mdl_chains < 1:
- raise RuntimeError("n_mdl_chains must be None or >= 1")
+ seeds = _GetSeeds(the_greed.ref_chem_groups, the_greed.mdl_chem_groups)
+ best_overall_score = -1.0
+ best_overall_mapping = dict()
- something_happened = True
- mapping = dict()
+ for seed in seeds:
- while something_happened:
- something_happened = False
- # Try all possible starting points and keep the one giving the best QS score
- best_score = -1.0
- best_mapping = None
- mapped_ref_chains = set(mapping.keys())
- mapped_mdl_chains = set(mapping.values())
- for ref_chains, mdl_chains in zip(the_greed.ref_chem_groups,
- the_greed.mdl_chem_groups):
- for ref_ch in ref_chains:
- if ref_ch not in mapped_ref_chains:
- seeds = list()
- for mdl_ch in mdl_chains:
- if mdl_ch not in mapped_mdl_chains:
- seeds.append((ref_ch, mdl_ch))
- if n_mdl_chains is not None and n_mdl_chains < len(seeds):
- counts = [the_greed.SCCounts(s[0], s[1]) for s in seeds]
- tmp = [(a,b) for a,b in zip(counts, seeds)]
- tmp.sort(reverse=True)
- seeds = [item[1] for item in tmp[:n_mdl_chains]]
- for seed in seeds:
- tmp_mapping = dict(mapping)
- tmp_mapping[seed[0]] = seed[1]
- tmp_mapping = the_greed.ExtendMapping(tmp_mapping)
- score_result = the_greed.FromFlatMapping(tmp_mapping)
- if score_result.QS_global > best_score:
- best_score = score_result.QS_global
- best_mapping = tmp_mapping
+ # do initial extension
+ mapping = the_greed.ExtendMapping({seed[0]: seed[1]})
- if best_mapping is not None and len(best_mapping) > len(mapping):
- # this even accepts extensions that lead to no increase in QS-score
- # at least they make sense from an lDDT perspective
- something_happened = True
- mapping = best_mapping
+ # repeat the process until we have a full mapping
+ something_happened = True
+ while something_happened:
+ something_happened = False
+ remnant_seeds = _GetSeeds(the_greed.ref_chem_groups,
+ the_greed.mdl_chem_groups,
+ mapped_ref_chains = set(mapping.keys()),
+ mapped_mdl_chains = set(mapping.values()))
+ if len(remnant_seeds) > 0:
+ # still more mapping to be done
+ best_score = -1.0
+ best_mapping = None
+ for remnant_seed in remnant_seeds:
+ tmp_mapping = dict(mapping)
+ tmp_mapping[remnant_seed[0]] = remnant_seed[1]
+ tmp_mapping = the_greed.ExtendMapping(tmp_mapping)
+ score_result = the_greed.FromFlatMapping(tmp_mapping)
+ if score_result.QS_global > best_score:
+ best_score = score_result.QS_global
+ best_mapping = tmp_mapping
+ if best_mapping is not None:
+ something_happened = True
+ mapping = best_mapping
+
+ score_result = the_greed.FromFlatMapping(mapping)
+ if score_result.QS_global > best_overall_score:
+ best_overall_score = score_result.QS_global
+ best_overall_mapping = mapping
+
+ mapping = best_overall_mapping
# translate mapping format and return
final_mapping = list()
@@ -2963,31 +2965,32 @@ def _QSScoreGreedyBlock(the_greed, seed_size, blocks_per_chem_group):
for ref_chains, mdl_chains in zip(ref_chem_groups, mdl_chem_groups):
if len(mdl_chains) == 0:
continue # nothing to map
-
- # Identify starting seeds for *blocks_per_chem_group* blocks
- # thats done with lDDT
- seeds = list()
- for ref_ch in ref_chains:
- seeds += [(ref_ch, mdl_ch) for mdl_ch in mdl_chains]
- counts = [the_greed.SCCounts(s[0], s[1]) for s in seeds]
- tmp = [(a,b) for a,b in zip(counts, seeds)]
- tmp.sort(reverse=True)
- seeds = [item[1] for item in tmp[:blocks_per_chem_group]]
-
- # extend starting seeds to *seed_size* and retain best scoring block
- # for further extension
- best_score = -1.0
- best_mapping = None
- for s in seeds:
- seed = dict(mapping)
- seed.update({s[0]: s[1]})
- seed = the_greed.ExtendMapping(seed, max_ext = max_ext)
- score_result = the_greed.FromFlatMapping(seed)
- if score_result.QS_global > best_score:
- best_score = score_result.QS_global
- best_mapping = seed
- if best_mapping != None:
- starting_blocks.append(best_mapping)
+ ref_chains_copy = list(ref_chains)
+ for i in range(blocks_per_chem_group):
+ if len(ref_chains_copy) == 0:
+ break
+ seeds = list()
+ for ref_ch in ref_chains_copy:
+ seeds += [(ref_ch, mdl_ch) for mdl_ch in mdl_chains]
+ # extend starting seeds to *seed_size* and retain best scoring block
+ # for further extension
+ best_score = -1.0
+ best_mapping = None
+ best_seed = None
+ for s in seeds:
+ seed = dict(mapping)
+ seed.update({s[0]: s[1]})
+ seed = the_greed.ExtendMapping(seed, max_ext = max_ext)
+ score_result = the_greed.FromFlatMapping(seed)
+ if score_result.QS_global > best_score:
+ best_score = score_result.QS_global
+ best_mapping = seed
+ best_seed = s
+ if best_mapping != None:
+ starting_blocks.append(best_mapping)
+ if best_seed[0] in ref_chains_copy:
+ # remove selected ref chain to enforce diversity
+ ref_chains_copy.remove(best_seed[0])
# fully expand initial starting blocks
best_score = -1.0
diff --git a/modules/mol/alg/pymod/contact_score.py b/modules/mol/alg/pymod/contact_score.py
new file mode 100644
index 0000000000000000000000000000000000000000..b5ddeb10b7d3d3b7072e2a9bbbac28b9a78d9c4b
--- /dev/null
+++ b/modules/mol/alg/pymod/contact_score.py
@@ -0,0 +1,817 @@
+import itertools
+import numpy as np
+
+import time
+from ost import mol
+from ost import geom
+from ost import io
+
+class ContactEntity:
+ """ Helper object for Contact-score computation
+ """
+ def __init__(self, ent, contact_d = 5.0, contact_mode="aa"):
+
+ if contact_mode not in ["aa", "repr"]:
+ raise RuntimeError("contact_mode must be in [\"aa\", \"repr\"]")
+
+ if contact_mode == "repr":
+ for r in ent.residues:
+ repr_at = None
+ if r.IsPeptideLinking():
+ cb = r.FindAtom("CB")
+ if cb.IsValid():
+ repr_at = cb
+ elif r.GetName() == "GLY":
+ ca = r.FindAtom("CA")
+ if ca.IsValid():
+ repr_at = ca
+ elif r.IsNucleotideLinking():
+ c3 = r.FindAtom("C3'")
+ if c3.IsValid():
+ repr_at = c3
+ else:
+ raise RuntimeError(f"Only support peptide and nucleotide "
+ f"residues in \"repr\" contact mode. "
+ f"Problematic residue: {r}")
+ if repr_at is None:
+ raise RuntimeError(f"Residue {r} has no required "
+ f"representative atom (CB for peptide "
+ f"residues (CA for GLY) C3' for "
+ f"nucleotide residues.")
+
+ self._contact_mode = contact_mode
+
+ if self.contact_mode == "aa":
+ self._view = ent.CreateFullView()
+ elif self.contact_mode == "repr":
+ pep_query = "(peptide=true and (aname=\"CB\" or (rname=\"GLY\" and aname=\"CA\")))"
+ nuc_query = "(nucleotide=True and aname=\"C3'\")"
+ self._view = ent.Select(" or ".join([pep_query, nuc_query]))
+ self._contact_d = contact_d
+
+ # the following attributes will be lazily evaluated
+ self._chain_names = None
+ self._interacting_chains = None
+ self._sequence = dict()
+ self._contacts = None
+ self._hr_contacts = None
+ self._interface_residues = None
+ self._hr_interface_residues = None
+
+ @property
+ def view(self):
+ """ The structure depending on *contact_mode*
+
+ Full view in case of "aa", view that only contains representative
+ atoms in case of "repr".
+
+ :type: :class:`ost.mol.EntityView`
+ """
+ return self._view
+
+ @property
+ def contact_mode(self):
+ """ The contact mode
+
+ Can either be "aa", meaning that all atoms are considered to identify
+ contacts, or "repr" which only considers distances between
+ representative atoms. For peptides thats CB (CA for GLY), for
+ nucleotides thats C3'.
+
+ :type: :class:`str`
+ """
+ return self._contact_mode
+
+ @property
+ def contact_d(self):
+ """ Pairwise distance of residues to be considered as contacts
+
+ Given at :class:`ContactScorer` construction
+
+ :type: :class:`float`
+ """
+ return self._contact_d
+
+ @property
+ def chain_names(self):
+ """ Chain names in :attr:`~view`
+
+ Names are sorted
+
+ :type: :class:`list` of :class:`str`
+ """
+ if self._chain_names is None:
+ self._chain_names = sorted([ch.name for ch in self.view.chains])
+ return self._chain_names
+
+ @property
+ def interacting_chains(self):
+ """ Pairs of chains in :attr:`~view` with at least one contact
+
+ :type: :class:`list` of :class:`tuples`
+ """
+ if self._interacting_chains is None:
+ self._interacting_chains = list(self.contacts.keys())
+ return self._interacting_chains
+
+ @property
+ def contacts(self):
+ """ Interchain contacts
+
+ Organized as :class:`dict` with key (cname1, cname2) and values being
+ a set of tuples with the respective residue indices.
+ cname1 < cname2 evaluates to True.
+ """
+ if self._contacts is None:
+ self._SetupContacts()
+ return self._contacts
+
+ @property
+ def hr_contacts(self):
+ """ Human readable interchain contacts
+
+ Human readable version of :attr:`~contacts`. Simple list with tuples
+ containing two strings specifying the residues in contact. Format:
+ <cname>.<rnum>.<ins_code>
+ """
+ if self._hr_contacts is None:
+ self._SetupContacts()
+ return self._hr_contacts
+
+ @property
+ def interface_residues(self):
+ """ Interface residues
+
+ Residues in each chain that are in contact with any other chain.
+ Organized as :class:`dict` with key cname and values the respective
+ residue indices in a :class:`set`.
+ """
+ if self._interface_residues is None:
+ self._SetupInterfaceResidues()
+ return self._interface_residues
+
+ @property
+ def hr_interface_residues(self):
+ """ Human readable interface residues
+
+ Human readable version of :attr:`interface_residues`. :class:`list` of
+ strings specifying the interface residues in format:
+ <cname>.<rnum>.<ins_code>
+ """
+ if self._interface_residues is None:
+ self._SetupHRInterfaceResidues()
+ return self._hr_interface_residues
+
+ def GetChain(self, chain_name):
+ """ Get chain by name
+
+ :param chain_name: Chain in :attr:`~view`
+ :type chain_name: :class:`str`
+ """
+ chain = self.view.FindChain(chain_name)
+ if not chain.IsValid():
+ raise RuntimeError(f"view has no chain named \"{chain_name}\"")
+ return chain
+
+ def GetSequence(self, chain_name):
+ """ Get sequence of chain
+
+ Returns sequence of specified chain as raw :class:`str`
+
+ :param chain_name: Chain in :attr:`~view`
+ :type chain_name: :class:`str`
+ """
+ if chain_name not in self._sequence:
+ ch = self.GetChain(chain_name)
+ s = ''.join([r.one_letter_code for r in ch.residues])
+ self._sequence[chain_name] = s
+ return self._sequence[chain_name]
+
+ def _SetupContacts(self):
+ # this function is incredibly inefficient... if performance is an issue,
+ # go ahead and optimize
+ self._contacts = dict()
+ self._hr_contacts = list()
+
+ # set indices relative to full view
+ for ch in self.view.chains:
+ for r_idx, r in enumerate(ch.residues):
+ r.SetIntProp("contact_idx", r_idx)
+
+ for cname in self.chain_names:
+ # q1 selects stuff in current chain that is close to any other chain
+ q1 = f"cname={cname} and {self.contact_d} <> [cname!={cname}]"
+ # q2 selects stuff in other chains that is close to current chain
+ q2 = f"cname!={cname} and {self.contact_d} <> [cname={cname}]"
+ v1 = self.view.Select(q1)
+ v2 = self.view.Select(q2)
+ v1_p = [geom.Vec3List([a.pos for a in r.atoms]) for r in v1.residues]
+ for r1, p1 in zip(v1.residues, v1_p):
+ for ch2 in v2.chains:
+ cname2 = ch2.GetName()
+ if cname2 > cname:
+ v2_p = [geom.Vec3List([a.pos for a in r.atoms]) for r in ch2.residues]
+ for r2, p2 in zip(ch2.residues, v2_p):
+ if p1.IsWithin(p2, self.contact_d):
+ cname_key = (cname, cname2)
+ if cname_key not in self._contacts:
+ self._contacts[cname_key] = set()
+ self._contacts[cname_key].add((r1.GetIntProp("contact_idx"),
+ r2.GetIntProp("contact_idx")))
+ rnum1 = r1.GetNumber()
+ hr1 = f"{cname}.{rnum1.num}.{rnum1.ins_code}"
+ rnum2 = r2.GetNumber()
+ hr2 = f"{cname2}.{rnum2.num}.{rnum2.ins_code}"
+ self._hr_contacts.append((hr1.strip("\u0000"),
+ hr2.strip("\u0000")))
+
+ def _SetupInterfaceResidues(self):
+ self._interface_residues = {cname: set() for cname in self.chain_names}
+ for k,v in self.contacts.items():
+ for item in v:
+ self._interface_residues[k[0]].add(item[0])
+ self._interface_residues[k[1]].add(item[1])
+
+ def _SetupHRInterfaceResidues(self):
+ interface_residues = set()
+ for item in self.hr_contacts:
+ interface_residues.add(item[0])
+ interface_residues.add(item[1])
+ self._hr_interface_residues = list(interface_residues)
+
+
+class ContactScorerResultICS:
+ """
+ Holds data relevant to compute ics
+ """
+ def __init__(self, n_trg_contacts, n_mdl_contacts, n_union, n_intersection):
+ self._n_trg_contacts = n_trg_contacts
+ self._n_mdl_contacts = n_mdl_contacts
+ self._n_union = n_union
+ self._n_intersection = n_intersection
+
+ @property
+ def n_trg_contacts(self):
+ """ Number of contacts in target
+
+ :type: :class:`int`
+ """
+ return self._n_trg_contacts
+
+ @property
+ def n_mdl_contacts(self):
+ """ Number of contacts in model
+
+ :type: :class:`int`
+ """
+ return self._n_mdl_contacts
+
+ @property
+ def precision(self):
+ """ Precision of model contacts
+
+ The fraction of model contacts that are also present in target
+
+ :type: :class:`int`
+ """
+ if self._n_mdl_contacts != 0:
+ return self._n_intersection / self._n_mdl_contacts
+ else:
+ return 0.0
+
+ @property
+ def recall(self):
+ """ Recall of model contacts
+
+ The fraction of target contacts that are also present in model
+
+ :type: :class:`int`
+ """
+ if self._n_trg_contacts != 0:
+ return self._n_intersection / self._n_trg_contacts
+ else:
+ return 0.0
+
+ @property
+ def ics(self):
+ """ The Interface Contact Similarity score (ICS)
+
+ Combination of :attr:`precision` and :attr:`recall` using the F1-measure
+
+ :type: :class:`float`
+ """
+ p = self.precision
+ r = self.recall
+ nominator = p*r
+ denominator = p + r
+ if denominator != 0.0:
+ return 2*nominator/denominator
+ else:
+ return 0.0
+
+class ContactScorerResultIPS:
+ """
+ Holds data relevant to compute ips
+ """
+ def __init__(self, n_trg_int_res, n_mdl_int_res, n_union, n_intersection):
+ self._n_trg_int_res = n_trg_int_res
+ self._n_mdl_int_res = n_mdl_int_res
+ self._n_union = n_union
+ self._n_intersection = n_intersection
+
+ @property
+ def n_trg_int_res(self):
+ """ Number of interface residues in target
+
+ :type: :class:`int`
+ """
+ return self._n_trg_contacts
+
+ @property
+ def n_mdl_int_res(self):
+ """ Number of interface residues in model
+
+ :type: :class:`int`
+ """
+ return self._n_mdl_int_res
+
+ @property
+ def precision(self):
+ """ Precision of model interface residues
+
+ The fraction of model interface residues that are also interface
+ residues in target
+
+ :type: :class:`int`
+ """
+ if self._n_mdl_int_res != 0:
+ return self._n_intersection / self._n_mdl_int_res
+ else:
+ return 0.0
+
+ @property
+ def recall(self):
+ """ Recall of model interface residues
+
+ The fraction of target interface residues that are also interface
+ residues in model
+
+ :type: :class:`int`
+ """
+ if self._n_trg_int_res != 0:
+ return self._n_intersection / self._n_trg_int_res
+ else:
+ return 0.0
+
+ @property
+ def ips(self):
+ """ The Interface Patch Similarity score (IPS)
+
+ Jaccard coefficient of interface residues in model/target.
+ Technically thats :attr:`intersection`/:attr:`union`
+
+ :type: :class:`float`
+ """
+ if(self._n_union > 0):
+ return self._n_intersection/self._n_union
+ return 0.0
+
+class ContactScorer:
+ """ Helper object to compute Contact scores
+
+ Tightly integrated into the mechanisms from the chain_mapping module.
+ The prefered way to derive an object of type :class:`ContactScorer` is
+ through the static constructor: :func:`~FromMappingResult`.
+
+ Usage is the same as for :class:`ost.mol.alg.QSScorer`
+ """
+
+ def __init__(self, target, chem_groups, model, alns,
+ contact_mode="aa", contact_d=5.0):
+ self._cent1 = ContactEntity(target, contact_mode = contact_mode,
+ contact_d = contact_d)
+ # ensure that target chain names match the ones in chem_groups
+ chem_group_ch_names = list(itertools.chain.from_iterable(chem_groups))
+ if self._cent1.chain_names != sorted(chem_group_ch_names):
+ raise RuntimeError(f"Expect exact same chain names in chem_groups "
+ f"and in target (which is processed to only "
+ f"contain peptides/nucleotides). target: "
+ f"{self._cent1.chain_names}, chem_groups: "
+ f"{chem_group_ch_names}")
+
+ self._chem_groups = chem_groups
+ self._cent2 = ContactEntity(model, contact_mode = contact_mode,
+ contact_d = contact_d)
+ self._alns = alns
+
+ # cache for mapped interface scores
+ # key: tuple of tuple ((qsent1_ch1, qsent1_ch2),
+ # ((qsent2_ch1, qsent2_ch2))
+ # value: tuple with four numbers required for computation of
+ # per-interface scores.
+ # The first two are relevant for ICS, the others for per
+ # interface IPS.
+ # 1: n_union_contacts
+ # 2: n_intersection_contacts
+ # 3: n_union_interface_residues
+ # 4: n_intersection_interface_residues
+ self._mapped_cache_interface = dict()
+
+ # cache for mapped single chain scores
+ # for interface residues of single chains
+ # key: tuple: (qsent1_ch, qsent2_ch)
+ # value: tuple with two numbers required for computation of IPS
+ # 1: n_union
+ # 2: n_intersection
+ self._mapped_cache_sc = dict()
+
+ @staticmethod
+ def FromMappingResult(mapping_result, contact_mode="aa", contact_d = 5.0):
+ """ The preferred way to get a :class:`ContactScorer`
+
+ Static constructor that derives an object of type :class:`ContactScorer`
+ using a :class:`ost.mol.alg.chain_mapping.MappingResult`
+
+ :param mapping_result: Data source
+ :type mapping_result: :class:`ost.mol.alg.chain_mapping.MappingResult`
+ """
+ contact_scorer = ContactScorer(mapping_result.target,
+ mapping_result.chem_groups,
+ mapping_result.model,
+ mapping_result.alns,
+ contact_mode = contact_mode,
+ contact_d = contact_d)
+ return contact_scorer
+
+ @property
+ def cent1(self):
+ """ Represents *target*
+
+ :type: :class:`ContactEntity`
+ """
+ return self._cent1
+
+ @property
+ def chem_groups(self):
+ """ Groups of chemically equivalent chains in *target*
+
+ Provided at object construction
+
+ :type: :class:`list` of :class:`list` of :class:`str`
+ """
+ return self._chem_groups
+
+ @property
+ def cent2(self):
+ """ Represents *model*
+
+ :type: :class:`ContactEntity`
+ """
+ return self._cent2
+
+ @property
+ def alns(self):
+ """ Alignments between chains in :attr:`~cent1` and :attr:`~cent2`
+
+ Provided at object construction. Each alignment is accessible with
+ ``alns[(t_chain,m_chain)]``. First sequence is the sequence of the
+ respective chain in :attr:`~cent1`, second sequence the one from
+ :attr:`~cent2`.
+
+ :type: :class:`dict` with key: :class:`tuple` of :class:`str`, value:
+ :class:`ost.seq.AlignmentHandle`
+ """
+ return self._alns
+
+ def ScoreICS(self, mapping, check=True):
+ """ Computes ICS given chain mapping
+
+ Again, the preferred way is to get *mapping* is from an object
+ of type :class:`ost.mol.alg.chain_mapping.MappingResult`.
+
+ :param mapping: see
+ :attr:`ost.mol.alg.chain_mapping.MappingResult.mapping`
+ :type mapping: :class:`list` of :class:`list` of :class:`str`
+ :param check: Perform input checks, can be disabled for speed purposes
+ if you know what you're doing.
+ :type check: :class:`bool`
+ :returns: Result object of type :class:`ContactScorerResultICS`
+ """
+
+ if check:
+ # ensure that dimensionality of mapping matches self.chem_groups
+ if len(self.chem_groups) != len(mapping):
+ raise RuntimeError("Dimensions of self.chem_groups and mapping "
+ "must match")
+ for a,b in zip(self.chem_groups, mapping):
+ if len(a) != len(b):
+ raise RuntimeError("Dimensions of self.chem_groups and "
+ "mapping must match")
+ # ensure that chain names in mapping are all present in cent2
+ for name in itertools.chain.from_iterable(mapping):
+ if name is not None and name not in self.cent2.chain_names:
+ raise RuntimeError(f"Each chain in mapping must be present "
+ f"in self.cent2. No match for "
+ f"\"{name}\"")
+
+ flat_mapping = dict()
+ for a, b in zip(self.chem_groups, mapping):
+ flat_mapping.update({x: y for x, y in zip(a, b) if y is not None})
+
+ return self.ICSFromFlatMapping(flat_mapping)
+
+ def ScoreICSInterface(self, trg_ch1, trg_ch2, mdl_ch1, mdl_ch2):
+ """ Computes ICS scores only considering one interface
+
+ This only works for interfaces that are computed in :func:`Score`, i.e.
+ interfaces for which the alignments are set up correctly.
+
+ :param trg_ch1: Name of first interface chain in target
+ :type trg_ch1: :class:`str`
+ :param trg_ch2: Name of second interface chain in target
+ :type trg_ch2: :class:`str`
+ :param mdl_ch1: Name of first interface chain in model
+ :type mdl_ch1: :class:`str`
+ :param mdl_ch2: Name of second interface chain in model
+ :type mdl_ch2: :class:`str`
+ :returns: Result object of type :class:`ContactScorerResultICS`
+ :raises: :class:`RuntimeError` if no aln for trg_ch1/mdl_ch1 or
+ trg_ch2/mdl_ch2 is available.
+ """
+ if (trg_ch1, mdl_ch1) not in self.alns:
+ raise RuntimeError(f"No aln between trg_ch1 ({trg_ch1}) and "
+ f"mdl_ch1 ({mdl_ch1}) available. Did you "
+ f"construct the QSScorer object from a "
+ f"MappingResult and are trg_ch1 and mdl_ch1 "
+ f"mapped to each other?")
+ if (trg_ch2, mdl_ch2) not in self.alns:
+ raise RuntimeError(f"No aln between trg_ch1 ({trg_ch1}) and "
+ f"mdl_ch1 ({mdl_ch1}) available. Did you "
+ f"construct the QSScorer object from a "
+ f"MappingResult and are trg_ch1 and mdl_ch1 "
+ f"mapped to each other?")
+ trg_int = (trg_ch1, trg_ch2)
+ mdl_int = (mdl_ch1, mdl_ch2)
+ trg_int_r = (trg_ch2, trg_ch1)
+ mdl_int_r = (mdl_ch2, mdl_ch1)
+
+ if trg_int in self.cent1.contacts:
+ n_trg = len(self.cent1.contacts[trg_int])
+ elif trg_int_r in self.cent1.contacts:
+ n_trg = len(self.cent1.contacts[trg_int_r])
+ else:
+ n_trg = 0
+
+ if mdl_int in self.cent2.contacts:
+ n_mdl = len(self.cent2.contacts[mdl_int])
+ elif mdl_int_r in self.cent2.contacts:
+ n_mdl = len(self.cent2.contacts[mdl_int_r])
+ else:
+ n_mdl = 0
+
+ n_union, n_intersection, _, _ = self._MappedInterfaceScores(trg_int, mdl_int)
+ return ContactScorerResultICS(n_trg, n_mdl, n_union, n_intersection)
+
+ def ICSFromFlatMapping(self, flat_mapping):
+ """ Same as :func:`ScoreICS` but with flat mapping
+
+ :param flat_mapping: Dictionary with target chain names as keys and
+ the mapped model chain names as value
+ :type flat_mapping: :class:`dict` with :class:`str` as key and value
+ :returns: Result object of type :class:`ContactScorerResultICS`
+ """
+ n_trg = sum([len(x) for x in self.cent1.contacts.values()])
+ n_mdl = sum([len(x) for x in self.cent2.contacts.values()])
+ n_union = 0
+ n_intersection = 0
+
+ processed_cent2_interfaces = set()
+ for int1 in self.cent1.interacting_chains:
+ if int1[0] in flat_mapping and int1[1] in flat_mapping:
+ int2 = (flat_mapping[int1[0]], flat_mapping[int1[1]])
+ a, b, _, _ = self._MappedInterfaceScores(int1, int2)
+ n_union += a
+ n_intersection += b
+ processed_cent2_interfaces.add((min(int2), max(int2)))
+
+ # process interfaces that only exist in qsent2
+ r_flat_mapping = {v:k for k,v in flat_mapping.items()} # reverse mapping
+ for int2 in self.cent2.interacting_chains:
+ if int2 not in processed_cent2_interfaces:
+ if int2[0] in r_flat_mapping and int2[1] in r_flat_mapping:
+ int1 = (r_flat_mapping[int2[0]], r_flat_mapping[int2[1]])
+ a, b, _, _ = self._MappedInterfaceScores(int1, int2)
+ n_union += a
+ n_intersection += b
+
+ return ContactScorerResultICS(n_trg, n_mdl,
+ n_union, n_intersection)
+
+ def ScoreIPS(self, mapping, check=True):
+ """ Computes IPS given chain mapping
+
+ Again, the preferred way is to get *mapping* is from an object
+ of type :class:`ost.mol.alg.chain_mapping.MappingResult`.
+
+ :param mapping: see
+ :attr:`ost.mol.alg.chain_mapping.MappingResult.mapping`
+ :type mapping: :class:`list` of :class:`list` of :class:`str`
+ :param check: Perform input checks, can be disabled for speed purposes
+ if you know what you're doing.
+ :type check: :class:`bool`
+ :returns: Result object of type :class:`ContactScorerResultIPS`
+ """
+
+ if check:
+ # ensure that dimensionality of mapping matches self.chem_groups
+ if len(self.chem_groups) != len(mapping):
+ raise RuntimeError("Dimensions of self.chem_groups and mapping "
+ "must match")
+ for a,b in zip(self.chem_groups, mapping):
+ if len(a) != len(b):
+ raise RuntimeError("Dimensions of self.chem_groups and "
+ "mapping must match")
+ # ensure that chain names in mapping are all present in cent2
+ for name in itertools.chain.from_iterable(mapping):
+ if name is not None and name not in self.cent2.chain_names:
+ raise RuntimeError(f"Each chain in mapping must be present "
+ f"in self.cent2. No match for "
+ f"\"{name}\"")
+
+ flat_mapping = dict()
+ for a, b in zip(self.chem_groups, mapping):
+ flat_mapping.update({x: y for x, y in zip(a, b) if y is not None})
+
+ return self.IPSFromFlatMapping(flat_mapping)
+
+ def ScoreIPSInterface(self, trg_ch1, trg_ch2, mdl_ch1, mdl_ch2):
+ """ Computes IPS scores only considering one interface
+
+ This only works for interfaces that are computed in :func:`Score`, i.e.
+ interfaces for which the alignments are set up correctly.
+
+ :param trg_ch1: Name of first interface chain in target
+ :type trg_ch1: :class:`str`
+ :param trg_ch2: Name of second interface chain in target
+ :type trg_ch2: :class:`str`
+ :param mdl_ch1: Name of first interface chain in model
+ :type mdl_ch1: :class:`str`
+ :param mdl_ch2: Name of second interface chain in model
+ :type mdl_ch2: :class:`str`
+ :returns: Result object of type :class:`ContactScorerResultIPS`
+ :raises: :class:`RuntimeError` if no aln for trg_ch1/mdl_ch1 or
+ trg_ch2/mdl_ch2 is available.
+ """
+ if (trg_ch1, mdl_ch1) not in self.alns:
+ raise RuntimeError(f"No aln between trg_ch1 ({trg_ch1}) and "
+ f"mdl_ch1 ({mdl_ch1}) available. Did you "
+ f"construct the QSScorer object from a "
+ f"MappingResult and are trg_ch1 and mdl_ch1 "
+ f"mapped to each other?")
+ if (trg_ch2, mdl_ch2) not in self.alns:
+ raise RuntimeError(f"No aln between trg_ch1 ({trg_ch1}) and "
+ f"mdl_ch1 ({mdl_ch1}) available. Did you "
+ f"construct the QSScorer object from a "
+ f"MappingResult and are trg_ch1 and mdl_ch1 "
+ f"mapped to each other?")
+ trg_int = (trg_ch1, trg_ch2)
+ mdl_int = (mdl_ch1, mdl_ch2)
+ trg_int_r = (trg_ch2, trg_ch1)
+ mdl_int_r = (mdl_ch2, mdl_ch1)
+
+ if trg_int in self.cent1.contacts:
+ n_trg = len(self.cent1.contacts[trg_int])
+ elif trg_int_r in self.cent1.contacts:
+ n_trg = len(self.cent1.contacts[trg_int_r])
+ else:
+ n_trg = 0
+
+ if mdl_int in self.cent2.contacts:
+ n_mdl = len(self.cent2.contacts[mdl_int])
+ elif mdl_int_r in self.cent2.contacts:
+ n_mdl = len(self.cent2.contacts[mdl_int_r])
+ else:
+ n_mdl = 0
+
+ _, _, n_union, n_intersection = self._MappedInterfaceScores(trg_int, mdl_int)
+ return ContactScorerResultIPS(n_trg, n_mdl, n_union, n_intersection)
+
+
+ def IPSFromFlatMapping(self, flat_mapping):
+ """ Same as :func:`ScoreIPS` but with flat mapping
+
+ :param flat_mapping: Dictionary with target chain names as keys and
+ the mapped model chain names as value
+ :type flat_mapping: :class:`dict` with :class:`str` as key and value
+ :returns: Result object of type :class:`ContactScorerResultIPS`
+ """
+ n_trg = sum([len(x) for x in self.cent1.interface_residues.values()])
+ n_mdl = sum([len(x) for x in self.cent2.interface_residues.values()])
+ n_union = 0
+ n_intersection = 0
+
+ processed_cent2_chains = set()
+ for trg_ch in self.cent1.chain_names:
+ if trg_ch in flat_mapping:
+ a, b = self._MappedSCScores(trg_ch, flat_mapping[trg_ch])
+ n_union += a
+ n_intersection += b
+ processed_cent2_chains.add(flat_mapping[trg_ch])
+ else:
+ n_union += len(self.cent1.interface_residues[trg_ch])
+
+ for mdl_ch in self._cent2.chain_names:
+ if mdl_ch not in processed_cent2_chains:
+ n_union += len(self.cent2.interface_residues[mdl_ch])
+
+ return ContactScorerResultIPS(n_trg, n_mdl,
+ n_union, n_intersection)
+
+
+ def _MappedInterfaceScores(self, int1, int2):
+ key_one = (int1, int2)
+ if key_one in self._mapped_cache_interface:
+ return self._mapped_cache_interface[key_one]
+ key_two = ((int1[1], int1[0]), (int2[1], int2[0]))
+ if key_two in self._mapped_cache_interface:
+ return self._mapped_cache_interface[key_two]
+
+ a, b, c, d = self._InterfaceScores(int1, int2)
+ self._mapped_cache_interface[key_one] = (a, b, c, d)
+ return (a, b, c, d)
+
+ def _InterfaceScores(self, int1, int2):
+ if int1 in self.cent1.contacts:
+ ref_contacts = self.cent1.contacts[int1]
+ elif (int1[1], int1[0]) in self.cent1.contacts:
+ ref_contacts = self.cent1.contacts[(int1[1], int1[0])]
+ # need to reverse contacts
+ ref_contacts = set([(x[1], x[0]) for x in ref_contacts])
+ else:
+ ref_contacts = set() # no contacts at all
+
+ if int2 in self.cent2.contacts:
+ mdl_contacts = self.cent2.contacts[int2]
+ elif (int2[1], int2[0]) in self.cent2.contacts:
+ mdl_contacts = self.cent2.contacts[(int2[1], int2[0])]
+ # need to reverse contacts
+ mdl_contacts = set([(x[1], x[0]) for x in mdl_contacts])
+ else:
+ mdl_contacts = set() # no contacts at all
+
+ # indices in contacts lists are specific to the respective
+ # structures, need manual mapping from alignments
+ ch1_aln = self.alns[(int1[0], int2[0])]
+ ch2_aln = self.alns[(int1[1], int2[1])]
+ mapped_ref_contacts = set()
+ mapped_mdl_contacts = set()
+ for c in ref_contacts:
+ mapped_c = (ch1_aln.GetPos(0, c[0]), ch2_aln.GetPos(0, c[1]))
+ mapped_ref_contacts.add(mapped_c)
+ for c in mdl_contacts:
+ mapped_c = (ch1_aln.GetPos(1, c[0]), ch2_aln.GetPos(1, c[1]))
+ mapped_mdl_contacts.add(mapped_c)
+
+ contact_union = len(mapped_ref_contacts.union(mapped_mdl_contacts))
+ contact_intersection = len(mapped_ref_contacts.intersection(mapped_mdl_contacts))
+
+ # above, we computed the union and intersection on actual
+ # contacts. Here, we do the same on interface residues
+
+ # process interface residues of chain one in interface
+ tmp_ref = set([x[0] for x in mapped_ref_contacts])
+ tmp_mdl = set([x[0] for x in mapped_mdl_contacts])
+ intres_union = len(tmp_ref.union(tmp_mdl))
+ intres_intersection = len(tmp_ref.intersection(tmp_mdl))
+
+ # process interface residues of chain two in interface
+ tmp_ref = set([x[1] for x in mapped_ref_contacts])
+ tmp_mdl = set([x[1] for x in mapped_mdl_contacts])
+ intres_union += len(tmp_ref.union(tmp_mdl))
+ intres_intersection += len(tmp_ref.intersection(tmp_mdl))
+
+ return (contact_union, contact_intersection,
+ intres_union, intres_intersection)
+
+ def _MappedSCScores(self, ref_ch, mdl_ch):
+ if (ref_ch, mdl_ch) in self._mapped_cache_sc:
+ return self._mapped_cache_sc[(ref_ch, mdl_ch)]
+ n_union, n_intersection = self._SCScores(ref_ch, mdl_ch)
+ self._mapped_cache_sc[(ref_ch, mdl_ch)] = (n_union, n_intersection)
+ return (n_union, n_intersection)
+
+ def _SCScores(self, ch1, ch2):
+ ref_int_res = self.cent1.interface_residues[ch1]
+ mdl_int_res = self.cent2.interface_residues[ch2]
+ aln = self.alns[(ch1, ch2)]
+ mapped_ref_int_res = set()
+ mapped_mdl_int_res = set()
+ for r_idx in ref_int_res:
+ mapped_ref_int_res.add(aln.GetPos(0, r_idx))
+ for r_idx in mdl_int_res:
+ mapped_mdl_int_res.add(aln.GetPos(1, r_idx))
+ return(len(mapped_ref_int_res.union(mapped_mdl_int_res)),
+ len(mapped_ref_int_res.intersection(mapped_mdl_int_res)))
+
+# specify public interface
+__all__ = ('ContactEntity', 'ContactScorerResultICS', 'ContactScorerResultIPS', 'ContactScorer')
diff --git a/modules/mol/alg/pymod/export_biounit.cc b/modules/mol/alg/pymod/export_biounit.cc
new file mode 100644
index 0000000000000000000000000000000000000000..1b1e6b354b66d8f0b3e0673086bb1d94fe8a3f52
--- /dev/null
+++ b/modules/mol/alg/pymod/export_biounit.cc
@@ -0,0 +1,86 @@
+//------------------------------------------------------------------------------
+// This file is part of the OpenStructure project <www.openstructure.org>
+//
+// Copyright (C) 2008-2023 by the OpenStructure authors
+//
+// This library is free software; you can redistribute it and/or modify it under
+// the terms of the GNU Lesser General Public License as published by the Free
+// Software Foundation; either version 3.0 of the License, or (at your option)
+// any later version.
+// This library is distributed in the hope that it will be useful, but WITHOUT
+// ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS
+// FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more
+// details.
+//
+// You should have received a copy of the GNU Lesser General Public License
+// along with this library; if not, write to the Free Software Foundation, Inc.,
+// 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA
+//------------------------------------------------------------------------------
+
+#include <boost/python.hpp>
+using namespace boost::python;
+
+#include <ost/mol/alg/biounit.hh>
+
+namespace{
+
+ PyObject* wrap_to_bytes(ost::mol::alg::BUInfo& bu) {
+ String str = bu.ToString();
+ return PyBytes_FromStringAndSize(str.c_str(), str.size());
+ }
+
+ ost::mol::alg::BUInfo wrap_from_bytes(boost::python::object obj) {
+ String str(PyBytes_AsString(obj.ptr()), PyBytes_Size(obj.ptr()));
+ return ost::mol::alg::BUInfo::FromString(str);
+ }
+
+ list wrap_get_au_chains(const ost::mol::alg::BUInfo& info) {
+ list return_list;
+ const std::vector<std::vector<String> >& au_chains = info.GetAUChains();
+ for(uint i = 0; i < au_chains.size(); ++i) {
+ list tmp;
+ for(uint j = 0; j < au_chains[i].size(); ++j) {
+ tmp.append(au_chains[i][j]);
+ }
+ return_list.append(tmp);
+ }
+ return return_list;
+ }
+
+ list wrap_get_transformations(const ost::mol::alg::BUInfo& info) {
+ list return_list;
+ const std::vector<std::vector<geom::Mat4> >& tfs = info.GetTransformations();
+ for(uint i = 0; i < tfs.size(); ++i) {
+ list tmp;
+ for(uint j = 0; j < tfs[i].size(); ++j) {
+ tmp.append(tfs[i][j]);
+ }
+ return_list.append(tmp);
+ }
+ return return_list;
+ }
+
+ ost::mol::EntityHandle wrap_CreateBU_one(const ost::mol::EntityHandle& asu,
+ const ost::io::MMCifInfoBioUnit& bu) {
+ return ost::mol::alg::CreateBU(asu, bu);
+ }
+
+ ost::mol::EntityHandle wrap_CreateBU_two(const ost::mol::EntityHandle& asu,
+ const ost::mol::alg::BUInfo& bu) {
+ return ost::mol::alg::CreateBU(asu, bu);
+ }
+
+} // anon ns
+
+void export_biounit() {
+
+ class_<ost::mol::alg::BUInfo>("BUInfo", init<const ost::io::MMCifInfoBioUnit&>())
+ .def("FromBytes", &wrap_from_bytes).staticmethod("FromBytes")
+ .def("ToBytes", &wrap_to_bytes)
+ .def("GetAUChains", &wrap_get_au_chains)
+ .def("GetTransformations", &wrap_get_transformations)
+ ;
+
+ def("CreateBU", &wrap_CreateBU_one);
+ def("CreateBU", &wrap_CreateBU_two);
+}
diff --git a/modules/mol/alg/pymod/ligand_scoring.py b/modules/mol/alg/pymod/ligand_scoring.py
index 4b1c57d4096c1d67a620b90f5b638c0b0fe2410e..2a670f694bddb028d860c3222b5e9230cbb42452 100644
--- a/modules/mol/alg/pymod/ligand_scoring.py
+++ b/modules/mol/alg/pymod/ligand_scoring.py
@@ -1,6 +1,7 @@
import warnings
import numpy as np
+import numpy.ma as np_ma
import networkx
from ost import mol
@@ -29,6 +30,13 @@ class LigandScorer:
onto the model, symmetry-correction, and finally assignment (mapping)
of model and target ligands, as described in (Manuscript in preparation).
+ The binding site is defined based on a radius around the target ligand
+ in the reference structure only. It only contains protein and nucleic
+ acid chains that pass the criteria for the
+ :class:`chain mapping <ost.mol.alg.chain_mapping>`. This means ignoring
+ other ligands, waters, short polymers as well as any incorrectly connected
+ chains that may be in proximity.
+
Results are available as matrices (`(lddt_pli|rmsd)_matrix`), where every
target-model score is reported in a matrix; as `(lddt_pli|rmsd)` where
a model-target assignment has been determined (see below) and reported in
@@ -48,7 +56,7 @@ class LigandScorer:
Note that this global chain mapping currently ignores non polymer entities
such as small ligands, and may result in overly pessimistic scores.
- By defaults, target-model ligand assignments are computed independently
+ By default, target-model ligand assignments are computed independently
for the RMSD and lDDT-PLI scores. For RMSD, each model ligand is uniquely
assigned to a target ligand, starting from the "best" possible mapping
(lowest RMSD) and using each target and model ligand in a single
@@ -57,6 +65,21 @@ class LigandScorer:
broken by lowest RMSD. Setting `rmsd_assignment=True` forces a single
ligand assignment, based on RMSD only. Ties are broken arbitrarily.
+ By default, only exact matches between target and model ligands are
+ considered. This is a problem when the target only contains a subset
+ of the expected atoms (for instance if atoms are missing in an
+ experimental structure, which often happens in the PDB). With
+ `substructure_match=True`, complete model ligands can be scored against
+ partial target ligands. One problem with this approach is that it is
+ very easy to find good matches to small, irrelevant ligands like EDO, CO2
+ or GOL. To counter that, the assignment algorithm considers the coverage,
+ expressed as the fraction of atoms of the model ligand atoms covered in the
+ target. Higher coverage matches are prioritized, but a match with a better
+ score will be preferred if it falls within a window of `coverage_delta`
+ (by default 0.2) of a worse-scoring match. As a result, for instance,
+ with a delta of 0.2, a low-score match with coverage 0.96 would be
+ preferred to a high-score match with coverage 0.90.
+
Assumptions:
The class generally assumes that the
@@ -71,7 +94,7 @@ class LigandScorer:
scoring. :ref:`Molck <molck>` should be used with extra
care, as many of the options (such as `rm_non_std` or `map_nonstd_res`) can
cause ligands to be removed from the structure. If cleanup with Molck is
- needed, ligands should be kept and passed separately. Non-ligand residues
+ needed, ligands should be kept aside and passed separately. Non-ligand residues
should be valid compounds with atom names following the naming conventions
of the component dictionary. Non-standard residues are acceptable, and if
the model contains a standard residue at that position, only atoms with
@@ -186,9 +209,11 @@ class LigandScorer:
:type chain_mapper: :class:`ost.mol.alg.chain_mapping.ChainMapper`
:param substructure_match: Set this to True to allow partial target ligand.
:type substructure_match: :class:`bool`
- :param radius: Inclusion radius for the binding site. Any residue with
- atoms within this distance of the ligand will be included
- in the binding site.
+ :param coverage_delta: the coverage delta for partial ligand assignment.
+ :type coverage_delta: :class:`float`
+ :param radius: Inclusion radius for the binding site. Residues with
+ atoms within this distance of the ligand will be considered
+ for inclusion in the binding site.
:type radius: :class:`float`
:param lddt_pli_radius: lDDT inclusion radius for lDDT-PLI.
:type lddt_pli_radius: :class:`float`
@@ -221,15 +246,21 @@ class LigandScorer:
mapping solution space is enumerated to find the
the optimum. A heuristic is used otherwise.
:type n_max_naive: :class:`int`
+ :param unassigned: If True, unassigned model ligands are reported in
+ the output together with assigned ligands, with a score
+ of None, and reason for not being assigned in the
+ \*_details matrix. Defaults to False.
+ :type unassigned: :class:`bool`
"""
def __init__(self, model, target, model_ligands=None, target_ligands=None,
resnum_alignments=False, check_resnames=True,
rename_ligand_chain=False,
chain_mapper=None, substructure_match=False,
+ coverage_delta=0.2,
radius=4.0, lddt_pli_radius=6.0, lddt_lp_radius=10.0,
binding_sites_topn=100000, global_chain_mapping=False,
rmsd_assignment=False, n_max_naive=12,
- custom_mapping=None):
+ custom_mapping=None, unassigned=False):
if isinstance(model, mol.EntityView):
self.model = mol.CreateEntityFromView(model, False)
@@ -253,7 +284,7 @@ class LigandScorer:
target_ligands,
rename_ligand_chain)
if len(self.target_ligands) == 0:
- raise ValueError("No ligands in the target")
+ LogWarning("No ligands in the target")
# Extract ligands from model
if model_ligands is None:
@@ -263,7 +294,9 @@ class LigandScorer:
model_ligands,
rename_ligand_chain)
if len(self.model_ligands) == 0:
- raise ValueError("No ligands in the model")
+ LogWarning("No ligands in the model")
+ if len(self.target_ligands) == 0:
+ raise ValueError("No ligand in the model and in the target")
self._chain_mapper = chain_mapper
self.resnum_alignments = resnum_alignments
@@ -277,6 +310,8 @@ class LigandScorer:
self.global_chain_mapping = global_chain_mapping
self.rmsd_assignment = rmsd_assignment
self.n_max_naive = n_max_naive
+ self.unassigned = unassigned
+ self.coverage_delta = coverage_delta
# scoring matrices
self._rmsd_matrix = None
@@ -294,6 +329,22 @@ class LigandScorer:
self._binding_sites = {}
self.__model_mapping = None
+ # Bookkeeping of unassigned ligands
+ self._unassigned_target_ligands = None
+ self._unassigned_model_ligands = None
+ self._unassigned_target_ligands_reason = {}
+ self._unassigned_target_ligand_short = None
+ self._unassigned_model_ligand_short = None
+ self._unassigned_target_ligand_descriptions = None
+ self._unassigned_model_ligand_descriptions = None
+ # Keep track of symmetries/isomorphisms (regardless of scoring)
+ # 0.0: no isomorphism
+ # 1.0: isomorphic
+ # np.nan: not assessed yet - that's why we can't use a boolean
+ self._assignment_isomorphisms = None
+ # Keep track of match coverage (only in case there was a score)
+ self._assignment_match_coverage = None
+
if custom_mapping is not None:
self._set_custom_mapping(custom_mapping)
@@ -372,8 +423,8 @@ class LigandScorer:
next_chain_num = 1
new_editor = None
- def _copy_residue(handle, rename_chain):
- """ Copy the residue handle into the new chain.
+ def _copy_residue(residue, rename_chain):
+ """ Copy the residue into the new chain.
Return the new residue handle."""
nonlocal next_chain_num, new_editor
@@ -381,17 +432,17 @@ class LigandScorer:
if new_editor is None:
new_editor = new_entity.EditXCS()
- new_chain = new_entity.FindChain(handle.chain.name)
+ new_chain = new_entity.FindChain(residue.chain.name)
if not new_chain.IsValid():
- new_chain = new_editor.InsertChain(handle.chain.name)
+ new_chain = new_editor.InsertChain(residue.chain.name)
else:
# Does a residue with the same name already exist?
- already_exists = new_chain.FindResidue(handle.number).IsValid()
+ already_exists = new_chain.FindResidue(residue.number).IsValid()
if already_exists:
if rename_chain:
chain_ext = 2 # Extend the chain name by this
while True:
- new_chain_name = handle.chain.name + "_" + str(chain_ext)
+ new_chain_name = residue.chain.name + "_" + str(chain_ext)
new_chain = new_entity.FindChain(new_chain_name)
if new_chain.IsValid():
chain_ext += 1
@@ -400,15 +451,21 @@ class LigandScorer:
new_chain = new_editor.InsertChain(new_chain_name)
break
LogScript("Moved ligand residue %s to new chain %s" % (
- handle.qualified_name, new_chain.name))
+ residue.qualified_name, new_chain.name))
else:
msg = "A residue number %s already exists in chain %s" % (
- handle.number, handle.chain.name)
+ residue.number, residue.chain.name)
raise RuntimeError(msg)
# Add the residue with its original residue number
- new_res = new_editor.AppendResidue(new_chain, handle, deep=True)
- for old_atom in handle.atoms:
+ new_res = new_editor.AppendResidue(new_chain, residue.name, residue.number)
+ # Add atoms
+ for old_atom in residue.atoms:
+ new_editor.InsertAtom(new_res, old_atom.name, old_atom.pos,
+ element=old_atom.element, occupancy=old_atom.occupancy,
+ b_factor=old_atom.b_factor, is_hetatm=old_atom.is_hetatom)
+ # Add bonds
+ for old_atom in residue.atoms:
for old_bond in old_atom.bonds:
new_first = new_res.FindAtom(old_bond.first.name)
new_second = new_res.FindAtom(old_bond.second.name)
@@ -417,13 +474,17 @@ class LigandScorer:
def _process_ligand_residue(res, rename_chain):
"""Copy or fetch the residue. Return the residue handle."""
+ new_res = None
if res.entity.handle == old_entity.handle:
- # Residue is already in copied entity. We only need to grab it
+ # Residue is part of the old_entity handle.
+ # However, it may not be in the copied one, for instance it may have been a view
+ # We try to grab it first, otherwise we copy it
new_res = new_entity.FindResidue(res.chain.name, res.number)
+ if new_res and new_res.valid:
LogVerbose("Ligand residue %s already in entity" % res.handle.qualified_name)
else:
# Residue is not part of the entity, need to copy it first
- new_res = _copy_residue(res.handle, rename_chain)
+ new_res = _copy_residue(res, rename_chain)
LogVerbose("Copied ligand residue %s" % res.handle.qualified_name)
new_res.SetIsLigand(True)
return new_res
@@ -446,7 +507,10 @@ class LigandScorer:
def _get_binding_sites(self, ligand):
"""Find representations of the binding site of *ligand* in the model.
- Ignore other ligands and waters that may be in proximity.
+ Only consider protein and nucleic acid chains that pass the criteria
+ for the :class:`ost.mol.alg.chain_mapping`. This means ignoring other
+ ligands, waters, short polymers as well as any incorrectly connected
+ chain that may be in proximity.
:param ligand: Defines the binding site to identify.
:type ligand: :class:`~ost.mol.ResidueHandle`
@@ -455,37 +519,65 @@ class LigandScorer:
# create view of reference binding site
ref_residues_hashes = set() # helper to keep track of added residues
+ ignored_residue_hashes = {ligand.hash_code}
for ligand_at in ligand.atoms:
close_atoms = self.target.FindWithin(ligand_at.GetPos(), self.radius)
for close_at in close_atoms:
- # Skip other ligands and waters.
- # This assumes that .IsLigand() is properly set on the entity's
- # residues.
+ # Skip any residue not in the chain mapping target
ref_res = close_at.GetResidue()
- if not (ref_res.is_ligand or
- ref_res.chem_type == mol.ChemType.WATERS):
- h = ref_res.handle.GetHashCode()
- if h not in ref_residues_hashes:
+ h = ref_res.handle.GetHashCode()
+ if h not in ref_residues_hashes and \
+ h not in ignored_residue_hashes:
+ if self.chain_mapper.target.ViewForHandle(ref_res).IsValid():
+ h = ref_res.handle.GetHashCode()
ref_residues_hashes.add(h)
+ elif ref_res.is_ligand:
+ LogWarning("Ignoring ligand %s in binding site of %s" % (
+ ref_res.qualified_name, ligand.qualified_name))
+ ignored_residue_hashes.add(h)
+ elif ref_res.chem_type == mol.ChemType.WATERS:
+ pass # That's ok, no need to warn
+ else:
+ LogWarning("Ignoring residue %s in binding site of %s" % (
+ ref_res.qualified_name, ligand.qualified_name))
+ ignored_residue_hashes.add(h)
+
+ if ref_residues_hashes:
+ # reason for doing that separately is to guarantee same ordering of
+ # residues as in underlying entity. (Reorder by ResNum seems only
+ # available on ChainHandles)
+ ref_bs = self.target.CreateEmptyView()
+ for ch in self.target.chains:
+ for r in ch.residues:
+ if r.handle.GetHashCode() in ref_residues_hashes:
+ ref_bs.AddResidue(r, mol.ViewAddFlag.INCLUDE_ALL)
+ if len(ref_bs.residues) == 0:
+ raise RuntimeError("Failed to add proximity residues to "
+ "the reference binding site entity")
+
+ # Find the representations
+ if self.global_chain_mapping:
+ self._binding_sites[ligand.hash_code] = self.chain_mapper.GetRepr(
+ ref_bs, self.model, inclusion_radius=self.lddt_lp_radius,
+ global_mapping = self._model_mapping)
+ else:
+ self._binding_sites[ligand.hash_code] = self.chain_mapper.GetRepr(
+ ref_bs, self.model, inclusion_radius=self.lddt_lp_radius,
+ topn=self.binding_sites_topn)
+
+ # Flag empty representation
+ if not self._binding_sites[ligand.hash_code]:
+ self._unassigned_target_ligands_reason[ligand] = (
+ "model_representation",
+ "No representation of the reference binding site was "
+ "found in the model")
+
+ else: # if ref_residues_hashes
+ # Flag missing binding site
+ self._unassigned_target_ligands_reason[ligand] = ("binding_site",
+ "No residue in proximity of the target ligand")
+ self._binding_sites[ligand.hash_code] = []
- # reason for doing that separately is to guarantee same ordering of
- # residues as in underlying entity. (Reorder by ResNum seems only
- # available on ChainHandles)
- ref_bs = self.target.CreateEmptyView()
- for ch in self.target.chains:
- for r in ch.residues:
- if r.handle.GetHashCode() in ref_residues_hashes:
- ref_bs.AddResidue(r, mol.ViewAddFlag.INCLUDE_ALL)
-
- # Find the representations
- if self.global_chain_mapping:
- self._binding_sites[ligand.hash_code] = self.chain_mapper.GetRepr(
- ref_bs, self.model, inclusion_radius=self.lddt_lp_radius,
- global_mapping = self._model_mapping)
- else:
- self._binding_sites[ligand.hash_code] = self.chain_mapper.GetRepr(
- ref_bs, self.model, inclusion_radius=self.lddt_lp_radius,
- topn=self.binding_sites_topn)
return self._binding_sites[ligand.hash_code]
@staticmethod
@@ -548,14 +640,15 @@ class LigandScorer:
(len(self.target_ligands), len(self.model_ligands)), dtype=dict)
lddt_pli_full_matrix = np.empty(
(len(self.target_ligands), len(self.model_ligands)), dtype=dict)
+ self._assignment_isomorphisms = np.full(
+ (len(self.target_ligands), len(self.model_ligands)), fill_value=np.nan)
+ self._assignment_match_coverage = np.zeros(
+ (len(self.target_ligands), len(self.model_ligands)))
+
for target_i, target_ligand in enumerate(self.target_ligands):
LogVerbose("Analyzing target ligand %s" % target_ligand)
for binding_site in self._get_binding_sites(target_ligand):
- if len(binding_site.substructure.residues) == 0:
- LogWarning("No residue in proximity of target ligand "
- "%s" % str(target_ligand))
- continue # next binding site
LogVerbose("Found binding site with chain mapping %s" % (binding_site.GetFlatChainMapping()))
ref_bs_ent = self._build_binding_site_entity(
@@ -584,9 +677,16 @@ class LigandScorer:
# Ligands are different - skip
LogVerbose("No symmetry between %s and %s" % (
str(model_ligand), str(target_ligand)))
+ self._assignment_isomorphisms[target_i, model_i] = 0
+ continue
+ except DisconnectedGraphError:
+ # Disconnected graph is handled elsewhere
continue
substructure_match = len(symmetries[0][0]) != len(
model_ligand.atoms)
+ coverage = len(symmetries[0][0]) / len(model_ligand.atoms)
+ self._assignment_match_coverage[target_i, model_i] = coverage
+ self._assignment_isomorphisms[target_i, model_i] = 1
rmsd = SCRMSD(model_ligand, target_ligand,
transformation=binding_site.transform,
@@ -608,8 +708,12 @@ class LigandScorer:
"chain_mapping": binding_site.GetFlatChainMapping(),
"transform": binding_site.transform,
"substructure_match": substructure_match,
+ "coverage": coverage,
"inconsistent_residues": binding_site.inconsistent_residues,
}
+ if self.unassigned:
+ rmsd_full_matrix[target_i, model_i][
+ "unassigned"] = False
LogDebug("Saved RMSD")
mdl_bs_ent = self._build_binding_site_entity(
@@ -669,15 +773,19 @@ class LigandScorer:
"chain_mapping": binding_site.GetFlatChainMapping(),
"transform": binding_site.transform,
"substructure_match": substructure_match,
+ "coverage": coverage,
"inconsistent_residues": binding_site.inconsistent_residues,
}
+ if self.unassigned:
+ lddt_pli_full_matrix[target_i, model_i][
+ "unassigned"] = False
LogDebug("Saved lDDT-PLI")
self._rmsd_full_matrix = rmsd_full_matrix
self._lddt_pli_full_matrix = lddt_pli_full_matrix
@staticmethod
- def _find_ligand_assignment(mat1, mat2=None):
+ def _find_ligand_assignment(mat1, mat2=None, coverage=None, coverage_delta=None):
""" Find the ligand assignment based on mat1. If mat2 is provided, it
will be used to break ties in mat1. If mat2 is not provided, ties will
be resolved by taking the first match arbitrarily.
@@ -691,42 +799,84 @@ class LigandScorer:
mat2 = np.copy(mat1)
mat2[~np.isnan(mat2)] = np.inf
else:
- mat2 = np.copy(mat1)
+ mat2 = np.copy(mat2)
+ if coverage is None:
+ coverage = np.copy(mat1)
+ coverage[:] = 1 # Assume full coverage by default
+ else:
+ coverage = np.copy(coverage)
+
assignments = []
- min_mat1 = LigandScorer._nanmin_nowarn(mat1)
- while not np.isnan(min_mat1):
- best_mat1 = np.argwhere(mat1 == min_mat1)
+ if 0 in mat1.shape:
+ # No model or target ligand
+ LogDebug("No model or target ligand, returning no assignment.")
+ return assignments
+
+ def _get_best_match(mat1_val, coverage_val):
+ """ Extract the row/column indices of the prediction matching the
+ given values."""
+ mat1_match_idx = np.argwhere((mat1 == mat1_val) & (coverage >= coverage_val))
# Multiple "best" - use mat2 to disambiguate
- if len(best_mat1) > 1:
+ if len(mat1_match_idx) > 1:
# Get the values of mat2 at these positions
- best_mat2_match = [mat2[tuple(x)] for x in best_mat1]
+ best_mat2_match = [mat2[tuple(x)] for x in mat1_match_idx]
# Find the index of the best mat2
# Note: argmin returns the first value which is min.
best_mat2_idx = np.array(best_mat2_match).argmin()
# Now get the original indices
- max_i_trg, max_i_mdl = best_mat1[best_mat2_idx]
+ return mat1_match_idx[best_mat2_idx]
else:
- max_i_trg, max_i_mdl = best_mat1[0]
-
- # Disable row and column
- mat1[max_i_trg, :] = np.nan
- mat1[:, max_i_mdl] = np.nan
- mat2[max_i_trg, :] = np.nan
- mat2[:, max_i_mdl] = np.nan
-
- # Save
- assignments.append((max_i_trg, max_i_mdl))
-
- # Recompute min
- min_mat1 = LigandScorer._nanmin_nowarn(mat1)
+ return mat1_match_idx[0]
+
+ # First only consider top coverage matches.
+ min_coverage = np.max(coverage)
+ while min_coverage > 0:
+ LogVerbose("Looking for matches with coverage >= %s" % min_coverage)
+ min_mat1 = LigandScorer._nanmin_nowarn(mat1, coverage < min_coverage)
+ while not np.isnan(min_mat1):
+ max_i_trg, max_i_mdl = _get_best_match(min_mat1, min_coverage)
+
+ # Would we have a match for this model ligand with higher score
+ # but lower coverage?
+ alternative_matches = (mat1[:, max_i_mdl] < min_mat1) & (
+ coverage[:, max_i_mdl] > (min_coverage - coverage_delta))
+ if np.any(alternative_matches):
+ # Get the scores of these matches
+ LogVerbose("Found match with lower coverage but better score")
+ min_mat1 = np.min(mat1[alternative_matches])
+ max_i_trg, max_i_mdl = _get_best_match(min_mat1, min_coverage - coverage_delta)
+
+ # Disable row and column
+ mat1[max_i_trg, :] = np.nan
+ mat1[:, max_i_mdl] = np.nan
+ mat2[max_i_trg, :] = np.nan
+ mat2[:, max_i_mdl] = np.nan
+ coverage[max_i_trg, :] = -np.inf
+ coverage[:, max_i_mdl] = -np.inf
+
+ # Save
+ assignments.append((max_i_trg, max_i_mdl))
+
+ # Recompute min
+ min_mat1 = LigandScorer._nanmin_nowarn(mat1, coverage < min_coverage)
+ # Recompute min_coverage
+ min_coverage = np.max(coverage)
return assignments
@staticmethod
- def _nanmin_nowarn(array):
+ def _nanmin_nowarn(array, mask):
"""Compute np.nanmin but ignore the RuntimeWarning."""
+ masked_array = np_ma.masked_array(array, mask=mask)
with warnings.catch_warnings(): # RuntimeWarning: All-NaN slice encountered
warnings.simplefilter("ignore")
- return np.nanmin(array)
+ min = np.nanmin(masked_array, )
+ if np_ma.is_masked(min):
+ return np.nan # Everything was masked
+ else:
+ return min
+
+
+
@staticmethod
def _reverse_lddt(lddt):
@@ -752,6 +902,10 @@ class LigandScorer:
"rmsd")
self._rmsd = mat_tuple[0]
self._rmsd_details = mat_tuple[1]
+ # Ignore unassigned ligands - they are dealt with in lddt_pli.
+ # So the following lines should stay commented out:
+ # self._unassigned_target_ligands = mat_tuple[2]
+ # self._unassigned_model_ligands = mat_tuple[3]
def _assign_matrices(self, mat1, mat2, data, main_key):
"""
@@ -780,11 +934,17 @@ class LigandScorer:
:return: a tuple with 2 dictionaries of matrices containing the main
data, and details, respectively.
"""
- assignments = self._find_ligand_assignment(mat1, mat2)
+ assignments = self._find_ligand_assignment(mat1, mat2,
+ self._assignment_match_coverage,
+ self.coverage_delta)
out_main = {}
out_details = {}
+ assigned_trg = [False] * len(self.target_ligands)
+ assigned_mdl = [False] * len(self.model_ligands)
for assignment in assignments:
trg_idx, mdl_idx = assignment
+ assigned_mdl[mdl_idx] = True
+ assigned_trg[trg_idx] = True
mdl_lig = self.model_ligands[mdl_idx]
mdl_cname = mdl_lig.chain.name
mdl_resnum = mdl_lig.number
@@ -795,7 +955,56 @@ class LigandScorer:
trg_idx, mdl_idx][main_key]
out_details[mdl_cname][mdl_resnum] = data[
trg_idx, mdl_idx]
- return out_main, out_details
+
+
+ unassigned_trg, unassigned_mdl = self._assign_unassigned(
+ assigned_trg, assigned_mdl, [out_main], [out_details], [main_key])
+ return out_main, out_details, unassigned_trg, unassigned_mdl
+
+ def _assign_unassigned(self, assigned_trg, assigned_mdl,
+ out_main, out_details, main_key):
+ unassigned_trg = {}
+ unassigned_mdl = {}
+
+ unassigned_trg_idx = [i for i, x in enumerate(assigned_trg) if not x]
+ unassigned_mdl_idx = [i for i, x in enumerate(assigned_mdl) if not x]
+
+ for mdl_idx in unassigned_mdl_idx:
+ mdl_lig = self.model_ligands[mdl_idx]
+ reason = self._find_unassigned_model_ligand_reason(mdl_lig, check=False)
+ mdl_cname = mdl_lig.chain.name
+ mdl_resnum = mdl_lig.number
+ if mdl_cname not in unassigned_mdl:
+ unassigned_mdl[mdl_cname] = {}
+ unassigned_mdl[mdl_cname][mdl_resnum] = reason
+ if self.unassigned:
+ for i, _ in enumerate(out_main):
+ if mdl_cname not in out_main[i]:
+ out_main[i][mdl_cname] = {}
+ out_details[i][mdl_cname] = {}
+ out_main[i][mdl_cname][mdl_resnum] = None
+ out_details[i][mdl_cname][mdl_resnum] = {
+ "unassigned": True,
+ "reason_short": reason[0],
+ "reason_long": reason[1],
+ main_key[i]: None,
+ }
+ LogInfo("Model ligand %s is unassigned: %s" % (
+ mdl_lig.qualified_name, reason[1]))
+
+ for trg_idx in unassigned_trg_idx:
+ trg_lig = self.target_ligands[trg_idx]
+ reason = self._find_unassigned_target_ligand_reason(trg_lig, check=False)
+ trg_cname = trg_lig.chain.name
+ trg_resnum = trg_lig.number
+ if trg_cname not in unassigned_trg:
+ unassigned_trg[trg_cname] = {}
+ unassigned_trg[trg_cname][trg_resnum] = reason
+ LogInfo("Target ligand %s is unassigned: %s" % (
+ trg_lig.qualified_name, reason[1]))
+
+ return unassigned_trg, unassigned_mdl
+
def _assign_matrix(self, mat, data1, main_key1, data2, main_key2):
"""
@@ -824,13 +1033,19 @@ class LigandScorer:
:return: a tuple with 4 dictionaries of matrices containing the main
data1, details1, main data2 and details2, respectively.
"""
- assignments = self._find_ligand_assignment(mat)
+ assignments = self._find_ligand_assignment(mat,
+ coverage=self._assignment_match_coverage,
+ coverage_delta=self.coverage_delta)
out_main1 = {}
out_details1 = {}
out_main2 = {}
out_details2 = {}
+ assigned_trg = [False] * len(self.target_ligands)
+ assigned_mdl = [False] * len(self.model_ligands)
for assignment in assignments:
trg_idx, mdl_idx = assignment
+ assigned_mdl[mdl_idx] = True
+ assigned_trg[trg_idx] = True
mdl_lig = self.model_ligands[mdl_idx]
mdl_cname = mdl_lig.chain.name
mdl_resnum = mdl_lig.number
@@ -842,23 +1057,22 @@ class LigandScorer:
trg_idx, mdl_idx][main_key1]
out_details1[mdl_cname][mdl_resnum] = data1[
trg_idx, mdl_idx]
- out_main1[mdl_cname][mdl_resnum] = data2[
- trg_idx, mdl_idx][main_key2]
- out_details1[mdl_cname][mdl_resnum] = data2[
- trg_idx, mdl_idx]
# Data2
if mdl_cname not in out_main2:
out_main2[mdl_cname] = {}
out_details2[mdl_cname] = {}
- out_main2[mdl_cname][mdl_resnum] = data1[
- trg_idx, mdl_idx][main_key1]
- out_details2[mdl_cname][mdl_resnum] = data1[
- trg_idx, mdl_idx]
out_main2[mdl_cname][mdl_resnum] = data2[
trg_idx, mdl_idx][main_key2]
out_details2[mdl_cname][mdl_resnum] = data2[
trg_idx, mdl_idx]
- return out_main1, out_details1, out_main2, out_details2
+
+ unassigned_trg, unassigned_mdl = self._assign_unassigned(
+ assigned_trg, assigned_mdl,
+ [out_main1, out_main2], [out_details1, out_details2],
+ [main_key1, main_key2])
+
+ return out_main1, out_details1, out_main2, out_details2, \
+ unassigned_trg, unassigned_mdl
def _assign_ligands_lddt_pli(self):
""" Assign ligands based on lDDT-PLI.
@@ -873,6 +1087,8 @@ class LigandScorer:
"lddt_pli")
self._lddt_pli = mat_tuple[0]
self._lddt_pli_details = mat_tuple[1]
+ self._unassigned_target_ligands = mat_tuple[2]
+ self._unassigned_model_ligands = mat_tuple[3]
def _assign_ligands_rmsd_only(self):
"""Assign (map) ligands between model and target based on RMSD only.
@@ -889,6 +1105,8 @@ class LigandScorer:
self._rmsd_details = mat_tuple[1]
self._lddt_pli = mat_tuple[2]
self._lddt_pli_details = mat_tuple[3]
+ self._unassigned_target_ligands = mat_tuple[4]
+ self._unassigned_model_ligands = mat_tuple[5]
@property
def rmsd_matrix(self):
@@ -936,11 +1154,31 @@ class LigandScorer:
i, j]["lddt_pli"]
return self._lddt_pli_matrix
+ @property
+ def coverage_matrix(self):
+ """ Get the matrix of model ligand atom coverage in the target.
+
+ Target ligands are in rows, model ligands in columns.
+
+ A value of 0 indicates that there was no isomorphism between the model
+ and target ligands. If `substructure_match=False`, only full match
+ isomorphisms are considered, and therefore only values of 1.0 and 0.0
+ are reported.
+
+ :rtype: :class:`~numpy.ndarray`
+ """
+ if self._assignment_match_coverage is None:
+ self._compute_scores()
+ return self._assignment_match_coverage
+
@property
def rmsd(self):
"""Get a dictionary of RMSD score values, keyed by model ligand
(chain name, :class:`~ost.mol.ResNum`).
+ If the scoring object was instantiated with `unassigned=True`, some
+ scores may be `None`.
+
:rtype: :class:`dict`
"""
if self._rmsd is None:
@@ -955,7 +1193,8 @@ class LigandScorer:
"""Get a dictionary of RMSD score details (dictionaries), keyed by
model ligand (chain name, :class:`~ost.mol.ResNum`).
- Each sub-dictionary contains the following information:
+ The value is a dictionary. For ligands that were assigned (mapped) to
+ the target, the dictionary contain the following information:
* `rmsd`: the RMSD score value.
* `lddt_lp`: the lDDT score of the ligand pocket (lDDT-LP).
@@ -978,6 +1217,9 @@ class LigandScorer:
(substructure) match. A value of `True` indicates that the target
ligand covers only part of the model, while `False` indicates a
perfect match.
+ * `coverage`: the fraction of model atoms covered by the assigned
+ target ligand, in the interval (0, 1]. If `substructure_match`
+ is `False`, this will always be 1.
* `inconsistent_residues`: a list of tuples of mapped residues views
(:class:`~ost.mol.ResidueView`) with residue names that differ
between the reference and the model, respectively.
@@ -985,6 +1227,19 @@ class LigandScorer:
if `check_resnames=True`.
Note: more binding site mappings may be explored during scoring,
but only inconsistencies in the selected mapping are reported.
+ * `unassigned`: only if the scorer was instantiated with
+ `unassigned=True`: `False`
+
+ If the scoring object was instantiated with `unassigned=True`, in
+ addition the unassigned ligands will be reported with a score of `None`
+ and the following information:
+
+ * `unassigned`: `True`,
+ * `reason_short`: a short token of the reason, see
+ :attr:`unassigned_model_ligands` for details and meaning.
+ * `reason_long`: a human-readable text of the reason, see
+ :attr:`unassigned_model_ligands` for details and meaning.
+ * `rmsd`: `None`
:rtype: :class:`dict`
"""
@@ -1000,6 +1255,9 @@ class LigandScorer:
"""Get a dictionary of lDDT-PLI score values, keyed by model ligand
(chain name, :class:`~ost.mol.ResNum`).
+ If the scoring object was instantiated with `unassigned=True`, some
+ scores may be `None`.
+
:rtype: :class:`dict`
"""
if self._lddt_pli is None:
@@ -1053,6 +1311,19 @@ class LigandScorer:
if `check_resnames=True`.
Note: more binding site mappings may be explored during scoring,
but only inconsistencies in the selected mapping are reported.
+ * `unassigned`: only if the scorer was instantiated with
+ `unassigned=True`: `False`
+
+ If the scoring object was instantiated with `unassigned=True`, in
+ addition the unmapped ligands will be reported with a score of `None`
+ and the following information:
+
+ * `unassigned`: `True`,
+ * `reason_short`: a short token of the reason, see
+ :attr:`unassigned_model_ligands` for details and meaning.
+ * `reason_long`: a human-readable text of the reason, see
+ :attr:`unassigned_model_ligands` for details and meaning.
+ * `lddt_pli`: `None`
:rtype: :class:`dict`
"""
@@ -1063,6 +1334,124 @@ class LigandScorer:
self._assign_ligands_lddt_pli()
return self._lddt_pli_details
+ @property
+ def unassigned_target_ligands(self):
+ """Get a dictionary of target ligands not assigned to any model ligand,
+ keyed by target ligand (chain name, :class:`~ost.mol.ResNum`).
+
+ The assignment for the lDDT-PLI score is used (and is controlled
+ by the `rmsd_assignment` argument).
+
+ Each item contains a string from a controlled dictionary
+ about the reason for the absence of assignment.
+ A human-readable description can be obtained from the
+ :attr:`unassigned_target_ligand_descriptions` property.
+
+ Currently, the following reasons are reported:
+
+ * `no_ligand`: there was no ligand in the model.
+ * `disconnected`: the ligand graph was disconnected.
+ * `binding_site`: no residues were in proximity of the ligand.
+ * `model_representation`: no representation of the reference binding
+ site was found in the model. (I.e. the binding site was not modeled.
+ Remember: the binding site is defined in the target structure,
+ the position of the model ligand itself is ignored at this point.)
+ * `identity`: the ligand was not found in the model (by graph
+ isomorphism). Check your ligand connectivity, and enable the
+ `substructure_match` option if the target ligand is incomplete.
+ * `stoichiometry`: there was a possible assignment in the model, but
+ the model ligand was already assigned to a different target ligand.
+ This indicates different stoichiometries.
+
+ Some of these reasons can be overlapping, but a single reason will be
+ reported.
+
+ :rtype: :class:`dict`
+ """
+ if self._unassigned_target_ligand_short is None:
+ if self.rmsd_assignment:
+ self._assign_ligands_rmsd_only()
+ else:
+ self._assign_ligands_lddt_pli()
+ self._unassigned_target_ligand_short = {}
+ self._unassigned_target_ligand_descriptions = {}
+ for cname, res in self._unassigned_target_ligands.items():
+ self._unassigned_target_ligand_short[cname] = {}
+ for resnum, val in res.items():
+ self._unassigned_target_ligand_short[cname][resnum] = val[0]
+ self._unassigned_target_ligand_descriptions[val[0]] = val[1]
+ return self._unassigned_target_ligand_short
+
+ @property
+ def unassigned_target_ligand_descriptions(self):
+ """Get a human-readable description of why target ligands were
+ unassigned, as a dictionary keyed by the controlled dictionary
+ from :attr:`unassigned_target_ligands`.
+ """
+ if self._unassigned_target_ligand_descriptions is None:
+ _ = self.unassigned_target_ligands # assigned there
+ return self._unassigned_target_ligand_descriptions
+
+ @property
+ def unassigned_model_ligands(self):
+ """Get a dictionary of model ligands not assigned to any target ligand,
+ keyed by model ligand (chain name, :class:`~ost.mol.ResNum`).
+
+ The assignment for the lDDT-PLI score is used (and is controlled
+ by the `rmsd_assignment` argument).
+
+ Each item contains a string from a controlled dictionary
+ about the reason for the absence of assignment.
+ A human-readable description can be obtained from the
+ :attr:`unassigned_model_ligand_descriptions` property.
+ Currently, the following reasons are reported:
+
+ * `no_ligand`: there was no ligand in the target.
+ * `disconnected`: the ligand graph is disconnected.
+ * `binding_site`: a potential assignment was found in the target, but
+ there were no polymer residues in proximity of the ligand in the
+ target.
+ * `model_representation`: a potential assignment was found in the target,
+ but no representation of the binding site was found in the model.
+ (I.e. the binding site was not modeled. Remember: the binding site
+ is defined in the target structure, the position of the model ligand
+ itself is ignored at this point.)
+ * `identity`: the ligand was not found in the target (by graph
+ isomorphism). Check your ligand connectivity, and enable the
+ `substructure_match` option if the target ligand is incomplete.
+ * `stoichiometry`: there was a possible assignment in the target, but
+ the model target was already assigned to a different model ligand.
+ This indicates different stoichiometries.
+
+ Some of these reasons can be overlapping, but a single reason will be
+ reported.
+
+ :rtype: :class:`dict`
+ """
+ if self._unassigned_model_ligand_short is None:
+ if self.rmsd_assignment:
+ self._assign_ligands_rmsd_only()
+ else:
+ self._assign_ligands_lddt_pli()
+ self._unassigned_model_ligand_short = {}
+ self._unassigned_model_ligand_descriptions = {}
+ for cname, res in self._unassigned_model_ligands.items():
+ self._unassigned_model_ligand_short[cname] = {}
+ for resnum, val in res.items():
+ self._unassigned_model_ligand_short[cname][resnum] = val[0]
+ self._unassigned_model_ligand_descriptions[val[0]] = val[1]
+ return self._unassigned_model_ligand_short
+
+ @property
+ def unassigned_model_ligand_descriptions(self):
+ """Get a human-readable description of why model ligands were
+ unassigned, as a dictionary keyed by the controlled dictionary
+ from :attr:`unassigned_model_ligands`.
+ """
+ if self._unassigned_model_ligand_descriptions is None:
+ _ = self.unassigned_model_ligands # assigned there
+ return self._unassigned_model_ligand_descriptions
+
def _set_custom_mapping(self, mapping):
""" sets self.__model_mapping with a full blown MappingResult object
@@ -1157,6 +1546,130 @@ class LigandScorer:
chem_mapping,
final_mapping, alns)
+ def _find_unassigned_model_ligand_reason(self, ligand, assignment="lddt_pli", check=True):
+ # Is this a model ligand?
+ try:
+ ligand_idx = self.model_ligands.index(ligand)
+ except ValueError:
+ # Raise with a better error message
+ raise ValueError("Ligand %s is not in self.model_ligands" % ligand)
+
+ # Ensure we are unassigned
+ if check:
+ details = getattr(self, assignment + "_details")
+ if ligand.chain.name in details and ligand.number in details[ligand.chain.name]:
+ ligand_details = details[ligand.chain.name][ligand.number]
+ if not ("unassigned" in ligand_details and ligand_details["unassigned"]):
+ raise RuntimeError("Ligand %s is mapped to %s" % (ligand, ligand_details["target_ligand"]))
+
+ # Were there any ligands in the target?
+ if len(self.target_ligands) == 0:
+ return ("no_ligand", "No ligand in the target")
+
+ # Is the ligand disconnected?
+ graph = _ResidueToGraph(ligand)
+ if not networkx.is_connected(graph):
+ return ("disconnected", "Ligand graph is disconnected")
+
+ # Do we have isomorphisms with the target?
+ for trg_lig_idx, assigned in enumerate(self._assignment_isomorphisms[:, ligand_idx]):
+ if np.isnan(assigned):
+ try:
+ _ComputeSymmetries(
+ self.model_ligands[ligand_idx],
+ self.target_ligands[trg_lig_idx],
+ substructure_match=self.substructure_match,
+ by_atom_index=True,
+ return_symmetries=False)
+ except (NoSymmetryError, DisconnectedGraphError):
+ assigned = 0.
+ else:
+ assigned = 1.
+ self._assignment_isomorphisms[trg_lig_idx,ligand_idx] = assigned
+ if assigned == 1.:
+ # Could have been assigned
+ # So what's up with this target ligand?
+ assignment_matrix = getattr(self, assignment + "_matrix")
+ all_nan = np.all(np.isnan(assignment_matrix[:, ligand_idx]))
+ if all_nan:
+ # The assignment matrix is all nans so we have a problem
+ # with the binding site or the representation
+ trg_ligand = self.target_ligands[trg_lig_idx]
+ return self._unassigned_target_ligands_reason[trg_ligand]
+ else:
+ # Ligand was already assigned
+ return ("stoichiometry",
+ "Ligand was already assigned to an other "
+ "model ligand (different stoichiometry)")
+
+ # Could not be assigned to any ligand - must be different
+ if self.substructure_match:
+ iso = "subgraph isomorphism"
+ else:
+ iso = "full graph isomorphism"
+ return ("identity", "Ligand was not found in the target (by %s)" % iso)
+
+ def _find_unassigned_target_ligand_reason(self, ligand, assignment="lddt_pli", check=True):
+ # Is this a target ligand?
+ try:
+ ligand_idx = self.target_ligands.index(ligand)
+ except ValueError:
+ # Raise with a better error message
+ raise ValueError("Ligand %s is not in self.target_ligands" % ligand)
+
+ # Ensure we are unassigned
+ if check:
+ details = getattr(self, assignment + "_details")
+ for cname, chain_ligands in details.items():
+ for rnum, details in chain_ligands.items():
+ if "unassigned" in details and details["unassigned"]:
+ continue
+ if details['target_ligand'] == ligand:
+ raise RuntimeError("Ligand %s is mapped to %s.%s" % (
+ ligand, cname, rnum))
+
+ # Were there any ligands in the model?
+ if len(self.model_ligands) == 0:
+ return ("no_ligand", "No ligand in the model")
+
+ # Is the ligand disconnected?
+ graph = _ResidueToGraph(ligand)
+ if not networkx.is_connected(graph):
+ return ("disconnected", "Ligand graph is disconnected")
+
+ # Is it because there was no valid binding site or no representation?
+ if ligand in self._unassigned_target_ligands_reason:
+ return self._unassigned_target_ligands_reason[ligand]
+ # Or because no symmetry?
+ for model_lig_idx, assigned in enumerate(
+ self._assignment_isomorphisms[ligand_idx, :]):
+ if np.isnan(assigned):
+ try:
+ _ComputeSymmetries(
+ self.model_ligands[model_lig_idx],
+ self.target_ligands[ligand_idx],
+ substructure_match=self.substructure_match,
+ by_atom_index=True,
+ return_symmetries=False)
+ except (NoSymmetryError, DisconnectedGraphError):
+ assigned = 0.
+ else:
+ assigned = 1.
+ self._assignment_isomorphisms[ligand_idx,model_lig_idx] = assigned
+ if assigned:
+ # Could have been assigned but was assigned to a different ligand
+ return ("stoichiometry",
+ "Ligand was already assigned to an other "
+ "target ligand (different stoichiometry)")
+
+ # Could not be assigned to any ligand - must be different
+ if self.substructure_match:
+ iso = "subgraph isomorphism"
+ else:
+ iso = "full graph isomorphism"
+ return ("identity", "Ligand was not found in the model (by %s)" % iso)
+
+
def _ResidueToGraph(residue, by_atom_index=False):
"""Return a NetworkX graph representation of the residue.
@@ -1212,7 +1725,8 @@ def SCRMSD(model_ligand, target_ligand, transformation=geom.Mat4(),
ligand.
:type substructure_match: :class:`bool`
:rtype: :class:`float`
- :raises: :class:`NoSymmetryError` when no symmetry can be found.
+ :raises: :class:`NoSymmetryError` when no symmetry can be found,
+ :class:`DisconnectedGraphError` when ligand graph is disconnected.
"""
symmetries = _ComputeSymmetries(model_ligand, target_ligand,
@@ -1253,7 +1767,7 @@ def SCRMSD(model_ligand, target_ligand, transformation=geom.Mat4(),
def _ComputeSymmetries(model_ligand, target_ligand, substructure_match=False,
- by_atom_index=False):
+ by_atom_index=False, return_symmetries=True):
"""Return a list of symmetries (isomorphisms) of the model onto the target
residues.
@@ -1271,6 +1785,12 @@ def _ComputeSymmetries(model_ligand, target_ligand, substructure_match=False,
Otherwise, if False, the symmetries refer to atom
names.
:type by_atom_index: :class:`bool`
+ :type return_symmetries: If Truthy, return the mappings, otherwise simply
+ return True if a mapping is found (and raise if
+ no mapping is found). This is useful to quickly
+ find out if a mapping exist without the expensive
+ step to find all the mappings.
+ :type return_symmetries: :class:`bool`
:raises: :class:`NoSymmetryError` when no symmetry can be found.
"""
@@ -1280,9 +1800,9 @@ def _ComputeSymmetries(model_ligand, target_ligand, substructure_match=False,
target_graph = _ResidueToGraph(target_ligand, by_atom_index=by_atom_index)
if not networkx.is_connected(model_graph):
- raise RuntimeError("Disconnected graph for model ligand %s" % model_ligand)
+ raise DisconnectedGraphError("Disconnected graph for model ligand %s" % model_ligand)
if not networkx.is_connected(target_graph):
- raise RuntimeError("Disconnected graph for target ligand %s" % target_ligand)
+ raise DisconnectedGraphError("Disconnected graph for target ligand %s" % target_ligand)
# Note the argument order (model, target) which differs from spyrmsd.
# This is because a subgraph of model is isomorphic to target - but not the opposite
@@ -1292,12 +1812,16 @@ def _ComputeSymmetries(model_ligand, target_ligand, substructure_match=False,
model_graph, target_graph, node_match=lambda x, y:
x["element"] == y["element"])
if gm.is_isomorphic():
+ if not return_symmetries:
+ return True
symmetries = [
(list(isomorphism.values()), list(isomorphism.keys()))
for isomorphism in gm.isomorphisms_iter()]
assert len(symmetries) > 0
LogDebug("Found %s isomorphic mappings (symmetries)" % len(symmetries))
elif gm.subgraph_is_isomorphic() and substructure_match:
+ if not return_symmetries:
+ return True
symmetries = [(list(isomorphism.values()), list(isomorphism.keys())) for isomorphism in
gm.subgraph_isomorphisms_iter()]
assert len(symmetries) > 0
@@ -1322,5 +1846,10 @@ class NoSymmetryError(Exception):
"""
pass
+class DisconnectedGraphError(Exception):
+ """Exception to be raised when the ligand graph is disconnected.
+ """
+ pass
+
-__all__ = ["LigandScorer", "SCRMSD", "NoSymmetryError"]
+__all__ = ["LigandScorer", "SCRMSD", "NoSymmetryError", "DisconnectedGraphError"]
diff --git a/modules/mol/alg/pymod/qsscore.py b/modules/mol/alg/pymod/qsscore.py
index e7d8a0b563afc85555780924d3e728cac3c18ded..9b95f56fbf6c4802fa110b044f183c826e3a7ed1 100644
--- a/modules/mol/alg/pymod/qsscore.py
+++ b/modules/mol/alg/pymod/qsscore.py
@@ -29,6 +29,10 @@ class QSEntity:
self._sequence = dict()
self._pos = dict()
self._pair_dist = dict()
+ # min and max xyz for elements in pos used for fast collision
+ # detection
+ self._min_pos = dict()
+ self._max_pos = dict()
@property
def view(self):
@@ -69,11 +73,12 @@ class QSEntity:
:type: :class:`list` of :class:`tuples`
"""
- if self._interacting_chains is None:
+ if self._interacting_chains is None:
self._interacting_chains = list()
for x in itertools.combinations(self.chain_names, 2):
- if np.count_nonzero(self.PairDist(x[0], x[1]) < self.contact_d):
- self._interacting_chains.append(x)
+ if self.PotentialInteraction(x[0], x[1]):
+ if np.count_nonzero(self.PairDist(x[0], x[1]) < self.contact_d):
+ self._interacting_chains.append(x)
return self._interacting_chains
def GetChain(self, chain_name):
@@ -134,6 +139,52 @@ class QSEntity:
'euclidean')
return self._pair_dist[key]
+ def GetMinPos(self, chain_name):
+ """ Get min x,y,z cooridnates for given chain
+
+ Based on positions that are extracted with GetPos
+
+ :param chain_name: Chain in :attr:`~view`
+ :type chain_name: :class:`str`
+ """
+ if chain_name not in self._min_pos:
+ self._min_pos[chain_name] = self.GetPos(chain_name).min(0)
+ return self._min_pos[chain_name]
+
+ def GetMaxPos(self, chain_name):
+ """ Get max x,y,z cooridnates for given chain
+
+ Based on positions that are extracted with GetPos
+
+ :param chain_name: Chain in :attr:`~view`
+ :type chain_name: :class:`str`
+ """
+ if chain_name not in self._max_pos:
+ self._max_pos[chain_name] = self.GetPos(chain_name).max(0)
+ return self._max_pos[chain_name]
+
+ def PotentialInteraction(self, chain_name_one, chain_name_two):
+ """ Returns True if chains potentially interact
+
+ Based on crude collision detection. There is no guarantee
+ that they actually interact if True is returned. However,
+ if False is returned, they don't interact for sure.
+
+ :param chain_name_one: Chain in :attr:`~view`
+ :type chain_name_one: class:`str`
+ :param chain_name_two: Chain in :attr:`~view`
+ :type chain_name_two: class:`str`
+ """
+ min_one = self.GetMinPos(chain_name_one)
+ max_one = self.GetMaxPos(chain_name_one)
+ min_two = self.GetMinPos(chain_name_two)
+ max_two = self.GetMaxPos(chain_name_two)
+ if np.max(min_one - max_two) > self.contact_d:
+ return False
+ if np.max(min_two - max_one) > self.contact_d:
+ return False
+ return True
+
class QSScorerResult:
"""
Holds data relevant for QS-score computation. Formulas for QS scores:
@@ -518,22 +569,48 @@ class QSScorer:
contact_d = self.qsent1.contact_d
mapped_idx_grid_1 = np.ix_(mapped_indices_1_1, mapped_indices_2_1)
mapped_idx_grid_2 = np.ix_(mapped_indices_1_2, mapped_indices_2_2)
- mapped_d1_contacts = d1[mapped_idx_grid_1] < contact_d
- mapped_d2_contacts = d2[mapped_idx_grid_2] < contact_d
- assert(mapped_d1_contacts.shape == mapped_d2_contacts.shape)
- shared_mask = np.logical_and(mapped_d1_contacts, mapped_d2_contacts)
- shared_mask_d1 = np.full(d1.shape, False, dtype=bool)
- shared_mask_d1[mapped_idx_grid_1] = shared_mask
- shared_mask_d2 = np.full(d2.shape, False, dtype=bool)
- shared_mask_d2[mapped_idx_grid_2] = shared_mask
-
- # get mapped but nonshared masks
- mapped_nonshared_mask_d1 = np.full(d1.shape, False, dtype=bool)
- mapped_nonshared_mask_d1[mapped_idx_grid_1] = \
- np.logical_and(np.logical_not(shared_mask), mapped_d1_contacts)
- mapped_nonshared_mask_d2 = np.full(d2.shape, False, dtype=bool)
- mapped_nonshared_mask_d2[mapped_idx_grid_2] = \
- np.logical_and(np.logical_not(shared_mask), mapped_d2_contacts)
+
+ if mapped_idx_grid_1[0].shape[0] == 0 or mapped_idx_grid_2[0].shape[0] == 0:
+ # dealing with special cases where we have no mapped residues
+ # we only avoid errors here when using maped_idx_grid_x for indexing
+ # but run the rest of the algorithm anyways which produces some
+ # computational overhead. Thats OK, as this should occur rarely
+ shared_mask_d1 = np.full(d1.shape, False, dtype=bool)
+ shared_mask_d2 = np.full(d2.shape, False, dtype=bool)
+ mapped_nonshared_mask_d1 = np.full(d1.shape, False, dtype=bool)
+ mapped_nonshared_mask_d2 = np.full(d2.shape, False, dtype=bool)
+ if mapped_idx_grid_1[0].shape[0] == 0:
+ # mapped_idx_grid_1 has not a single mapped residue which raises
+ # an error when calling something like d1[mapped_idx_grid_1]
+ mapped_d1_contacts = np.full(d1.shape, False, dtype=bool)
+ else:
+ mapped_d1_contacts = d1[mapped_idx_grid_1] < contact_d
+ mapped_nonshared_mask_d1[mapped_idx_grid_1] = mapped_d1_contacts
+
+ if mapped_idx_grid_2[0].shape[0] == 0:
+ # mapped_idx_grid_2 has not a single mapped residue which raises
+ # an error when calling something like d2[mapped_idx_grid_2]
+ mapped_d2_contacts = np.full(d2.shape, False, dtype=bool)
+ else:
+ mapped_d2_contacts = d2[mapped_idx_grid_2] < contact_d
+ mapped_nonshared_mask_d2[mapped_idx_grid_2] = mapped_d2_contacts
+ shared_mask = np.full(mapped_d1_contacts.shape, False, dtype=bool)
+ else:
+ mapped_d1_contacts = d1[mapped_idx_grid_1] < contact_d
+ mapped_d2_contacts = d2[mapped_idx_grid_2] < contact_d
+ shared_mask = np.logical_and(mapped_d1_contacts, mapped_d2_contacts)
+ shared_mask_d1 = np.full(d1.shape, False, dtype=bool)
+ shared_mask_d1[mapped_idx_grid_1] = shared_mask
+ shared_mask_d2 = np.full(d2.shape, False, dtype=bool)
+ shared_mask_d2[mapped_idx_grid_2] = shared_mask
+
+ # get mapped but nonshared masks
+ mapped_nonshared_mask_d1 = np.full(d1.shape, False, dtype=bool)
+ mapped_nonshared_mask_d1[mapped_idx_grid_1] = \
+ np.logical_and(np.logical_not(shared_mask), mapped_d1_contacts)
+ mapped_nonshared_mask_d2 = np.full(d2.shape, False, dtype=bool)
+ mapped_nonshared_mask_d2[mapped_idx_grid_2] = \
+ np.logical_and(np.logical_not(shared_mask), mapped_d2_contacts)
# contributions from shared contacts
shared_d1 = d1[shared_mask_d1]
diff --git a/modules/mol/alg/pymod/scoring.py b/modules/mol/alg/pymod/scoring.py
index 3ccecfd23860e862eb9818d327baca2d683ced26..e3fd114cec900ce8025bee6fd3932c2209f8a6ec 100644
--- a/modules/mol/alg/pymod/scoring.py
+++ b/modules/mol/alg/pymod/scoring.py
@@ -12,6 +12,7 @@ from ost.mol.alg import stereochemistry
from ost.mol.alg import dockq
from ost.mol.alg.lddt import lDDTScorer
from ost.mol.alg.qsscore import QSScorer
+from ost.mol.alg.contact_score import ContactScorer
from ost.mol.alg import Molck, MolckSettings
from ost import bindings
from ost.bindings import cadscore
@@ -128,26 +129,37 @@ class Scorer:
:param lddt_no_stereochecks: Whether to compute lDDT without stereochemistry
checks
:type lddt_no_stereochecks: :class:`bool`
- :param n_max_naive: Parameter for chain mapping. If *model* and *target*
- have less or equal that number of chains, the full
+ :param n_max_naive: Parameter for chain mapping. If the number of possible
+ mappings is <= *n_max_naive*, the full
mapping solution space is enumerated to find the
- the optimum. A heuristic is used otherwise.
+ the optimum. A heuristic is used otherwise. The default
+ of 40320 corresponds to an octamer (8! = 40320).
+ A structure with stoichiometry A6B2 would be
+ 6!*2! = 1440 etc.
:type n_max_naive: :class:`int`
+ :param oum: Override USalign Mapping. Inject mapping of :class:`Scorer`
+ object into USalign to compute TM-score. Experimental feature
+ with limitations.
+ :type oum: :class:`bool`
"""
def __init__(self, model, target, resnum_alignments=False,
molck_settings = None, cad_score_exec = None,
custom_mapping=None, usalign_exec = None,
- lddt_no_stereochecks=False, n_max_naive=12):
+ lddt_no_stereochecks=False, n_max_naive=40320,
+ oum=False):
- if isinstance(model, mol.EntityView):
- model = mol.CreateEntityFromView(model, False)
+ self._target_orig = target
+ self._model_orig = model
+
+ if isinstance(self._model_orig, mol.EntityView):
+ self._model = mol.CreateEntityFromView(self._model_orig, False)
else:
- model = model.Copy()
+ self._model = self._model_orig.Copy()
- if isinstance(target, mol.EntityView):
- target = mol.CreateEntityFromView(target, False)
+ if isinstance(self._target_orig, mol.EntityView):
+ self._target = mol.CreateEntityFromView(self._target_orig, False)
else:
- target = target.Copy()
+ self._target = self._target_orig.Copy()
if molck_settings is None:
molck_settings = MolckSettings(rm_unk_atoms=True,
@@ -158,10 +170,10 @@ class Scorer:
colored=False,
map_nonstd_res=True,
assign_elem=True)
- Molck(model, conop.GetDefaultLib(), molck_settings)
- Molck(target, conop.GetDefaultLib(), molck_settings)
- self._model = model.Select("peptide=True or nucleotide=True")
- self._target = target.Select("peptide=True or nucleotide=True")
+ Molck(self._model, conop.GetDefaultLib(), molck_settings)
+ Molck(self._target, conop.GetDefaultLib(), molck_settings)
+ self._model = self._model.Select("peptide=True or nucleotide=True")
+ self._target = self._target.Select("peptide=True or nucleotide=True")
# catch models which have empty chain names
for ch in self._model.chains:
@@ -201,11 +213,20 @@ class Scorer:
"must be strictly increasing if "
"resnum_alignments are enabled")
+ if usalign_exec is not None:
+ if not os.path.exists(usalign_exec):
+ raise RuntimeError(f"USalign exec ({usalign_exec}) "
+ f"not found")
+ if not os.access(usalign_exec, os.X_OK):
+ raise RuntimeError(f"USalign exec ({usalign_exec}) "
+ f"is not executable")
+
self.resnum_alignments = resnum_alignments
self.cad_score_exec = cad_score_exec
self.usalign_exec = usalign_exec
self.lddt_no_stereochecks = lddt_no_stereochecks
self.n_max_naive = n_max_naive
+ self.oum = oum
# lazily evaluated attributes
self._stereochecked_model = None
@@ -222,11 +243,13 @@ class Scorer:
self._target_interface_residues = None
self._aln = None
self._stereochecked_aln = None
+ self._pepnuc_aln = None
# lazily constructed scorer objects
self._lddt_scorer = None
self._bb_lddt_scorer = None
self._qs_scorer = None
+ self._contact_scorer = None
# lazily computed scores
self._lddt = None
@@ -236,18 +259,37 @@ class Scorer:
self._qs_global = None
self._qs_best = None
- self._interface_qs_global = None
- self._interface_qs_best = None
-
- self._interfaces = None
+ self._qs_target_interfaces = None
+ self._qs_model_interfaces = None
+ self._qs_interfaces = None
+ self._per_interface_qs_global = None
+ self._per_interface_qs_best = None
+
+ self._contact_target_interfaces = None
+ self._contact_model_interfaces = None
self._native_contacts = None
self._model_contacts = None
+ self._ics_precision = None
+ self._ics_recall = None
+ self._ics = None
+ self._per_interface_ics_precision = None
+ self._per_interface_ics_recall = None
+ self._per_interface_ics = None
+ self._ips_precision = None
+ self._ips_recall = None
+ self._ips = None
+ self._per_interface_ics_precision = None
+ self._per_interface_ics_recall = None
+ self._per_interface_ics = None
+
+ self._dockq_target_interfaces = None
+ self._dockq_interfaces = None
self._fnat = None
self._fnonnat = None
self._irmsd = None
self._lrmsd = None
- self._nonmapped_interfaces = None
- self._nonmapped_interfaces_contacts = None
+ self._nnat = None
+ self._nmdl = None
self._dockq_scores = None
self._dockq_ave = None
self._dockq_wave = None
@@ -283,6 +325,14 @@ class Scorer:
"""
return self._model
+ @property
+ def model_orig(self):
+ """ The original model passed at object construction
+
+ :type: :class:`ost.mol.EntityHandle`/:class:`ost.mol.EntityView`
+ """
+ return self._model_orig
+
@property
def target(self):
""" Target with Molck cleanup
@@ -291,6 +341,14 @@ class Scorer:
"""
return self._target
+ @property
+ def target_orig(self):
+ """ The original target passed at object construction
+
+ :type: :class:`ost.mol.EntityHandle`/:class:`ost.mol.EntityView`
+ """
+ return self._target_orig
+
@property
def aln(self):
""" Alignments of :attr:`model`/:attr:`target` chains
@@ -310,12 +368,26 @@ class Scorer:
The alignments may differ, as stereochecks potentially remove residues
- :type: :class:``
+ :type: :class:`list` of :class:`ost.seq.AlignmentHandle`
"""
if self._stereochecked_aln is None:
self._compute_stereochecked_aln()
return self._stereochecked_aln
+ @property
+ def pepnuc_aln(self):
+ """ Alignments of :attr:`model_orig`/:attr:`target_orig` chains
+
+ Selects for peptide and nucleotide residues before sequence
+ extraction. Includes residues that would be removed by molck in
+ structure preprocessing.
+
+ :type: :class:`list` of :class:`ost.seq.AlignmentHandle`
+ """
+ if self._pepnuc_aln is None:
+ self._compute_pepnuc_aln()
+ return self._pepnuc_aln
+
@property
def stereochecked_model(self):
""" View of :attr:`~model` that has stereochemistry checks applied
@@ -496,6 +568,13 @@ class Scorer:
self._qs_scorer = QSScorer.FromMappingResult(self.mapping)
return self._qs_scorer
+ @property
+ def contact_scorer(self):
+ if self._contact_scorer is None:
+ self._contact_scorer = ContactScorer.FromMappingResult(self.mapping)
+ return self._contact_scorer
+
+
@property
def lddt(self):
""" Global lDDT score in range [0.0, 1.0]
@@ -584,101 +663,381 @@ class Scorer:
return self._qs_best
@property
- def interfaces(self):
- """ Interfaces with nonzero :attr:`native_contacts`
+ def qs_target_interfaces(self):
+ """ Interfaces in :attr:`~target` with non-zero contribution to
+ :attr:`~qs_global`/:attr:`~qs_best`
+
+ Chain names are lexicographically sorted.
+
+ :type: :class:`list` of :class:`tuple` with 2 elements each:
+ (trg_ch1, trg_ch2)
+ """
+ if self._qs_target_interfaces is None:
+ self._qs_target_interfaces = self.qs_scorer.qsent1.interacting_chains
+ self._qs_target_interfaces = \
+ [(min(x[0],x[1]), max(x[0],x[1])) for x in self._qs_target_interfaces]
+ return self._qs_target_interfaces
+
+ @property
+ def qs_model_interfaces(self):
+ """ Interfaces in :attr:`~model` with non-zero contribution to
+ :attr:`~qs_global`/:attr:`~qs_best`
+
+ Chain names are lexicographically sorted.
+
+ :type: :class:`list` of :class:`tuple` with 2 elements each:
+ (mdl_ch1, mdl_ch2)
+ """
+ if self._qs_model_interfaces is None:
+ self._qs_model_interfaces = self.qs_scorer.qsent2.interacting_chains
+ self._qs_model_interfaces = \
+ [(min(x[0],x[1]), max(x[0],x[1])) for x in self._qs_model_interfaces]
+
+ return self._qs_model_interfaces
+
+ @property
+ def qs_interfaces(self):
+ """ Interfaces in :attr:`~qs_target_interfaces` that can be mapped
+ to :attr:`~model`.
+
+ Target chain names are lexicographically sorted.
:type: :class:`list` of :class:`tuple` with 4 elements each:
(trg_ch1, trg_ch2, mdl_ch1, mdl_ch2)
"""
- if self._interfaces is None:
- self._compute_per_interface_scores()
- return self._interfaces
-
+ if self._qs_interfaces is None:
+ self._qs_interfaces = list()
+ flat_mapping = self.mapping.GetFlatMapping()
+ for i in self.qs_target_interfaces:
+ if i[0] in flat_mapping and i[1] in flat_mapping:
+ self._qs_interfaces.append((i[0], i[1],
+ flat_mapping[i[0]],
+ flat_mapping[i[1]]))
+ return self._qs_interfaces
+
@property
- def interface_qs_global(self):
- """ QS-score for each interface in :attr:`interfaces`
+ def per_interface_qs_global(self):
+ """ QS-score for each interface in :attr:`qs_interfaces`
:type: :class:`list` of :class:`float`
"""
- if self._interface_qs_global is None:
- self._compute_per_interface_scores()
- return self._interface_qs_global
+ if self._per_interface_qs_global is None:
+ self._compute_per_interface_qs_scores()
+ return self._per_interface_qs_global
@property
- def interface_qs_best(self):
- """ QS-score for each interface in :attr:`interfaces`
+ def per_interface_qs_best(self):
+ """ QS-score for each interface in :attr:`qs_interfaces`
Only computed on aligned residues
:type: :class:`list` of :class:`float`
"""
- if self._interface_qs_best is None:
- self._compute_per_interface_scores()
- return self._interface_qs_best
+ if self._per_interface_qs_best is None:
+ self._compute_per_interface_qs_scores()
+ return self._per_interface_qs_best
@property
def native_contacts(self):
- """ N native contacts for interfaces in :attr:`~interfaces`
+ """ Native contacts
A contact is a pair or residues from distinct chains that have
- a minimal heavy atom distance < 5A
+ a minimal heavy atom distance < 5A. Contacts are specified as
+ :class:`tuple` with two strings in format:
+ <cname>.<rnum>.<ins_code>
- :type: :class:`list` of :class:`int`
+ :type: :class:`list` of :class:`tuple`
"""
if self._native_contacts is None:
- self._compute_per_interface_scores()
+ self._native_contacts = self.contact_scorer.cent1.hr_contacts
return self._native_contacts
@property
def model_contacts(self):
- """ N model contacts for interfaces in :attr:`~interfaces`
-
- A contact is a pair or residues from distinct chains that have
- a minimal heavy atom distance < 5A
-
- :type: :class:`list` of :class:`int`
+ """ Same for model
"""
if self._model_contacts is None:
- self._compute_per_interface_scores()
+ self._model_contacts = self.contact_scorer.cent2.hr_contacts
return self._model_contacts
+ @property
+ def contact_target_interfaces(self):
+ """ Interfaces in :class:`target` which have at least one contact
+
+ Contact as defined in :attr:`~native_contacts`,
+ chain names are lexicographically sorted.
+
+ :type: :class:`list` of :class:`tuple` with 2 elements each
+ (trg_ch1, trg_ch2)
+ """
+ if self._contact_target_interfaces is None:
+ tmp = self.contact_scorer.cent1.interacting_chains
+ tmp = [(min(x[0],x[1]), max(x[0],x[1])) for x in tmp]
+ self._contact_target_interfaces = tmp
+ return self._contact_target_interfaces
+
+ @property
+ def contact_model_interfaces(self):
+ """ Interfaces in :class:`model` which have at least one contact
+
+ Contact as defined in :attr:`~native_contacts`,
+ chain names are lexicographically sorted.
+
+ :type: :class:`list` of :class:`tuple` with 2 elements each
+ (mdl_ch1, mdl_ch2)
+ """
+ if self._contact_model_interfaces is None:
+ tmp = self.contact_scorer.cent2.interacting_chains
+ tmp = [(min(x[0],x[1]), max(x[0],x[1])) for x in tmp]
+ self._contact_model_interfaces = tmp
+ return self._contact_model_interfaces
+
+ @property
+ def ics_precision(self):
+ """ Fraction of model contacts that are also present in target
+
+ :type: :class:`float`
+ """
+ if self._ics_precision is None:
+ self._compute_ics_scores()
+ return self._ics_precision
+
+ @property
+ def ics_recall(self):
+ """ Fraction of target contacts that are correctly reproduced in model
+
+ :type: :class:`float`
+ """
+ if self._ics_recall is None:
+ self._compute_ics_scores()
+ return self._ics_recall
+
+ @property
+ def ics(self):
+ """ ICS (Interface Contact Similarity) score
+
+ Combination of :attr:`~ics_precision` and :attr:`~ics_recall`
+ using the F1-measure
+
+ :type: :class:`float`
+ """
+ if self._ics is None:
+ self._compute_ics_scores()
+ return self._ics
+
+ @property
+ def per_interface_ics_precision(self):
+ """ Per-interface ICS precision
+
+ :attr:`~ics_precision` for each interface in
+ :attr:`~contact_target_interfaces`
+
+ :type: :class:`list` of :class:`float`
+ """
+ if self._per_interface_ics_precision is None:
+ self._compute_ics_scores()
+ return self._per_interface_ics_precision
+
+
+ @property
+ def per_interface_ics_recall(self):
+ """ Per-interface ICS recall
+
+ :attr:`~ics_recall` for each interface in
+ :attr:`~contact_target_interfaces`
+
+ :type: :class:`list` of :class:`float`
+ """
+ if self._per_interface_ics_recall is None:
+ self._compute_ics_scores()
+ return self._per_interface_ics_recall
+
+ @property
+ def per_interface_ics(self):
+ """ Per-interface ICS (Interface Contact Similarity) score
+
+ :attr:`~ics` for each interface in
+ :attr:`~contact_target_interfaces`
+
+ :type: :class:`float`
+ """
+
+ if self._per_interface_ics is None:
+ self._compute_ics_scores()
+ return self._per_interface_ics
+
+
+ @property
+ def ips_precision(self):
+ """ Fraction of model interface residues that are also interface
+ residues in target
+
+ :type: :class:`float`
+ """
+ if self._ips_precision is None:
+ self._compute_ips_scores()
+ return self._ips_precision
+
+ @property
+ def ips_recall(self):
+ """ Fraction of target interface residues that are also interface
+ residues in model
+
+ :type: :class:`float`
+ """
+ if self._ips_recall is None:
+ self._compute_ips_scores()
+ return self._ips_recall
+
+ @property
+ def ips(self):
+ """ IPS (Interface Patch Similarity) score
+
+ Jaccard coefficient of interface residues in target and their mapped
+ counterparts in model
+
+ :type: :class:`float`
+ """
+ if self._ips is None:
+ self._compute_ips_scores()
+ return self._ips
+
+ @property
+ def per_interface_ips_precision(self):
+ """ Per-interface IPS precision
+
+ :attr:`~ips_precision` for each interface in
+ :attr:`~contact_target_interfaces`
+
+ :type: :class:`list` of :class:`float`
+ """
+ if self._per_interface_ips_precision is None:
+ self._compute_ips_scores()
+ return self._per_interface_ips_precision
+
+
+ @property
+ def per_interface_ips_recall(self):
+ """ Per-interface IPS recall
+
+ :attr:`~ips_recall` for each interface in
+ :attr:`~contact_target_interfaces`
+
+ :type: :class:`list` of :class:`float`
+ """
+ if self._per_interface_ics_recall is None:
+ self._compute_ips_scores()
+ return self._per_interface_ips_recall
+
+ @property
+ def per_interface_ips(self):
+ """ Per-interface IPS (Interface Patch Similarity) score
+
+ :attr:`~ips` for each interface in
+ :attr:`~contact_target_interfaces`
+
+ :type: :class:`list` of :class:`float`
+ """
+
+ if self._per_interface_ips is None:
+ self._compute_ips_scores()
+ return self._per_interface_ips
+
+ @property
+ def dockq_target_interfaces(self):
+ """ Interfaces in :attr:`target` that are relevant for DockQ
+
+ In principle a subset of :attr:`~contact_target_interfaces` that only
+ contains peptide sequences. Chain names are lexicographically sorted.
+
+ :type: :class:`list` of :class:`tuple` with 2 elements each:
+ (trg_ch1, trg_ch2)
+ """
+ if self._dockq_target_interfaces is None:
+ self._dockq_target_interfaces = list()
+ pep_seqs = set([s.GetName() for s in self.chain_mapper.polypep_seqs])
+ for interface in self.contact_target_interfaces:
+ if interface[0] in pep_seqs and interface[1] in pep_seqs:
+ self._dockq_target_interfaces.append(interface)
+ return self._dockq_target_interfaces
+
+ @property
+ def dockq_interfaces(self):
+ """ Interfaces in :attr:`dockq_target_interfaces` that can be mapped
+ to model
+
+ Target chain names are lexicographically sorted
+
+ :type: :class:`list` of :class:`tuple` with 4 elements each:
+ (trg_ch1, trg_ch2, mdl_ch1, mdl_ch2)
+ """
+ if self._dockq_interfaces is None:
+ self._dockq_interfaces = list()
+ flat_mapping = self.mapping.GetFlatMapping()
+ for i in self.dockq_target_interfaces:
+ if i[0] in flat_mapping and i[1] in flat_mapping:
+ self._dockq_interfaces.append((i[0], i[1],
+ flat_mapping[i[0]],
+ flat_mapping[i[1]]))
+ return self._dockq_interfaces
+
@property
def dockq_scores(self):
- """ DockQ scores for interfaces in :attr:`~interfaces`
+ """ DockQ scores for interfaces in :attr:`~dockq_interfaces`
:class:`list` of :class:`float`
"""
if self._dockq_scores is None:
- self._compute_per_interface_scores()
+ self._compute_dockq_scores()
return self._dockq_scores
@property
def fnat(self):
- """ fnat scores for interfaces in :attr:`~interfaces`
+ """ fnat scores for interfaces in :attr:`~dockq_interfaces`
fnat: Fraction of native contacts that are also present in model
:class:`list` of :class:`float`
"""
if self._fnat is None:
- self._compute_per_interface_scores()
+ self._compute_dockq_scores()
return self._fnat
+ @property
+ def nnat(self):
+ """ N native contacts for interfaces in :attr:`~dockq_interfaces`
+
+ :class:`list` of :class:`int`
+ """
+ if self._nnat is None:
+ self._compute_dockq_scores()
+ return self._nnat
+
+ @property
+ def nmdl(self):
+ """ N model contacts for interfaces in :attr:`~dockq_interfaces`
+
+ :class:`list` of :class:`int`
+ """
+ if self._nmdl is None:
+ self._compute_dockq_scores()
+ return self._nmdl
+
@property
def fnonnat(self):
- """ fnonnat scores for interfaces in :attr:`~interfaces`
+ """ fnonnat scores for interfaces in :attr:`~dockq_interfaces`
fnat: Fraction of model contacts that are not present in target
:class:`list` of :class:`float`
"""
if self._fnonnat is None:
- self._compute_per_interface_scores()
+ self._compute_dockq_scores()
return self._fnonnat
@property
def irmsd(self):
- """ irmsd scores for interfaces in :attr:`~interfaces`
+ """ irmsd scores for interfaces in :attr:`~dockq_interfaces`
irmsd: RMSD of interface (RMSD computed on N, CA, C, O atoms) which
consists of each residue that has at least one heavy atom within 10A of
@@ -687,12 +1046,12 @@ class Scorer:
:class:`list` of :class:`float`
"""
if self._irmsd is None:
- self._compute_per_interface_scores()
+ self._compute_dockq_scores()
return self._irmsd
@property
def lrmsd(self):
- """ lrmsd scores for interfaces in :attr:`~interfaces`
+ """ lrmsd scores for interfaces in :attr:`~dockq_interfaces`
lrmsd: The interfaces are superposed based on the receptor (rigid
min RMSD superposition) and RMSD for the ligand is reported.
@@ -703,31 +1062,8 @@ class Scorer:
:class:`list` of :class:`float`
"""
if self._lrmsd is None:
- self._compute_per_interface_scores()
+ self._compute_dockq_scores()
return self._lrmsd
-
- @property
- def nonmapped_interfaces(self):
- """ Interfaces present in target that are not mapped
-
- At least one of the chains is not present in target
-
- :type: :class:`list` of :class:`tuple` with two elements each:
- (trg_ch1, trg_ch2)
- """
- if self._nonmapped_interfaces is None:
- self._compute_per_interface_scores()
- return self._nonmapped_interfaces
-
- @property
- def nonmapped_interfaces_contacts(self):
- """ Number of native contacts in :attr:`~nonmapped_interfaces`
-
- :type: :class:`list` of :class:`int`
- """
- if self._nonmapped_interfaces_contacts is None:
- self._compute_per_interface_scores()
- return self._nonmapped_interfaces_contacts
@property
def dockq_ave(self):
@@ -740,42 +1076,42 @@ class Scorer:
:type: :class:`float`
"""
if self._dockq_ave is None:
- self._compute_per_interface_scores()
+ self._compute_dockq_scores()
return self._dockq_ave
@property
def dockq_wave(self):
- """ Same as :attr:`dockq_ave`, weighted by :attr:`native_contacts`
+ """ Same as :attr:`dockq_ave`, weighted by native contacts
:type: :class:`float`
"""
if self._dockq_wave is None:
- self._compute_per_interface_scores()
+ self._compute_dockq_scores()
return self._dockq_wave
@property
def dockq_ave_full(self):
""" Same as :attr:`~dockq_ave` but penalizing for missing interfaces
- Interfaces in :attr:`nonmapped_interfaces` are added as 0.0
+ Interfaces that are not covered in model are added as 0.0
in average computation.
:type: :class:`float`
"""
if self._dockq_ave_full is None:
- self._compute_per_interface_scores()
+ self._compute_dockq_scores()
return self._dockq_ave_full
@property
def dockq_wave_full(self):
""" Same as :attr:`~dockq_ave_full`, but weighted
- Interfaces in :attr:`nonmapped_interfaces` are added as 0.0 in
+ Interfaces that are not covered in model are added as 0.0 in
average computations and the respective weights are derived from
- :attr:`~nonmapped_interfaces_contacts`
+ number of contacts in respective target interface.
"""
if self._dockq_wave_full is None:
- self._compute_per_interface_scores()
+ self._compute_dockq_scores()
return self._dockq_wave_full
@property
@@ -1034,6 +1370,12 @@ class Scorer:
alns[-1].AttachView(1, mdl_seqs[mdl_ch].GetAttachedView())
return alns
+ def _compute_pepnuc_aln(self):
+ query = "peptide=true or nucleotide=true"
+ pep_nuc_target = self.target_orig.Select(query)
+ pep_nuc_model = self.model_orig.Select(query)
+ self._pepnuc_aln = self._aln_helper(pep_nuc_target, pep_nuc_model)
+
def _compute_aln(self):
self._aln = self._aln_helper(self.target, self.model)
@@ -1168,88 +1510,134 @@ class Scorer:
self._qs_global = qs_score_result.QS_global
self._qs_best = qs_score_result.QS_best
- def _compute_per_interface_scores(self):
- # list of [trg_ch1, trg_ch2, mdl_ch1, mdl_ch2]
- self._interfaces = list()
- # lists with respective values for these interfaces
- self._native_contacts = list()
- self._model_contacts = list()
- self._interface_qs_global = list()
- self._interface_qs_best = list()
+ def _compute_per_interface_qs_scores(self):
+ self._per_interface_qs_global = list()
+ self._per_interface_qs_best = list()
+
+ for interface in self.qs_interfaces:
+ trg_ch1 = interface[0]
+ trg_ch2 = interface[1]
+ mdl_ch1 = interface[2]
+ mdl_ch2 = interface[3]
+ qs_res = self.qs_scorer.ScoreInterface(trg_ch1, trg_ch2,
+ mdl_ch1, mdl_ch2)
+ self._per_interface_qs_best.append(qs_res.QS_best)
+ self._per_interface_qs_global.append(qs_res.QS_global)
+
+ def _compute_ics_scores(self):
+ contact_scorer_res = self.contact_scorer.ScoreICS(self.mapping.mapping)
+ self._ics_precision = contact_scorer_res.precision
+ self._ics_recall = contact_scorer_res.recall
+ self._ics = contact_scorer_res.ics
+ self._per_interface_ics_precision = list()
+ self._per_interface_ics_recall = list()
+ self._per_interface_ics = list()
+ flat_mapping = self.mapping.GetFlatMapping()
+ for trg_int in self.contact_target_interfaces:
+ trg_ch1 = trg_int[0]
+ trg_ch2 = trg_int[1]
+ if trg_ch1 in flat_mapping and trg_ch2 in flat_mapping:
+ mdl_ch1 = flat_mapping[trg_ch1]
+ mdl_ch2 = flat_mapping[trg_ch2]
+ res = self.contact_scorer.ScoreICSInterface(trg_ch1, trg_ch2,
+ mdl_ch1, mdl_ch2)
+ self._per_interface_ics_precision.append(res.precision)
+ self._per_interface_ics_recall.append(res.recall)
+ self._per_interface_ics.append(res.ics)
+ else:
+ self._per_interface_ics_precision.append(None)
+ self._per_interface_ics_recall.append(None)
+ self._per_interface_ics.append(None)
+
+ def _compute_ips_scores(self):
+ contact_scorer_res = self.contact_scorer.ScoreIPS(self.mapping.mapping)
+ self._ips_precision = contact_scorer_res.precision
+ self._ips_recall = contact_scorer_res.recall
+ self._ips = contact_scorer_res.ips
+
+ self._per_interface_ips_precision = list()
+ self._per_interface_ips_recall = list()
+ self._per_interface_ips = list()
+ flat_mapping = self.mapping.GetFlatMapping()
+ for trg_int in self.contact_target_interfaces:
+ trg_ch1 = trg_int[0]
+ trg_ch2 = trg_int[1]
+ if trg_ch1 in flat_mapping and trg_ch2 in flat_mapping:
+ mdl_ch1 = flat_mapping[trg_ch1]
+ mdl_ch2 = flat_mapping[trg_ch2]
+ res = self.contact_scorer.ScoreIPSInterface(trg_ch1, trg_ch2,
+ mdl_ch1, mdl_ch2)
+ self._per_interface_ips_precision.append(res.precision)
+ self._per_interface_ips_recall.append(res.recall)
+ self._per_interface_ips.append(res.ips)
+ else:
+ self._per_interface_ips_precision.append(None)
+ self._per_interface_ips_recall.append(None)
+ self._per_interface_ips.append(None)
+
+ def _compute_dockq_scores(self):
+ # lists with values in contact_target_interfaces
self._dockq_scores = list()
self._fnat = list()
self._fnonnat = list()
self._irmsd = list()
self._lrmsd = list()
-
- # list of interfaces which are present in target but not mapped, i.e.
- # not present in mdl
- self._nonmapped_interfaces = list()
- self._nonmapped_interfaces_contacts = list()
-
- nonmapped_interface_counts = list()
-
- flat_mapping = self.mapping.GetFlatMapping()
- pep_seqs = set([s.GetName() for s in self.chain_mapper.polypep_seqs])
+ self._nnat = list()
+ self._nmdl = list()
dockq_alns = dict()
for aln in self.aln:
- trg_ch = aln.GetSequence(0).name
- if trg_ch in pep_seqs:
- mdl_ch = aln.GetSequence(1).name
- dockq_alns[(trg_ch, mdl_ch)] = aln
-
- for trg_int in self.qs_scorer.qsent1.interacting_chains:
- trg_ch1 = trg_int[0]
- trg_ch2 = trg_int[1]
- if trg_ch1 in pep_seqs and trg_ch2 in pep_seqs:
- if trg_ch1 in flat_mapping and trg_ch2 in flat_mapping:
- mdl_ch1 = flat_mapping[trg_ch1]
- mdl_ch2 = flat_mapping[trg_ch2]
- aln1 = dockq_alns[(trg_ch1, mdl_ch1)]
- aln2 = dockq_alns[(trg_ch2, mdl_ch2)]
- res = dockq.DockQ(self.model, self.target, mdl_ch1, mdl_ch2,
- trg_ch1, trg_ch2, ch1_aln=aln1,
- ch2_aln=aln2)
- if res["nnat"] > 0:
- self._interfaces.append((trg_ch1, trg_ch2,
- mdl_ch1, mdl_ch2))
- self._native_contacts.append(res["nnat"])
- self._model_contacts.append(res["nmdl"])
- self._fnat.append(res["fnat"])
- self._fnonnat.append(res["fnonnat"])
- self._irmsd.append(res["irmsd"])
- self._lrmsd.append(res["lrmsd"])
- self._dockq_scores.append(res["DockQ"])
- qs_res = self.qs_scorer.ScoreInterface(trg_ch1, trg_ch2,
- mdl_ch1, mdl_ch2)
- self._interface_qs_best.append(qs_res.QS_best)
- self._interface_qs_global.append(qs_res.QS_global)
- else:
- # interface which is not covered by mdl... let's run DockQ
- # with trg as trg/mdl in order to get the native contacts
- # out
- # no need to pass alns as the residue numbers match for sure
- res = dockq.DockQ(self.target, self.target,
- trg_ch1, trg_ch2, trg_ch1, trg_ch2)
- nnat = res["nnat"]
- if nnat > 0:
- self._nonmapped_interfaces.append((trg_ch1, trg_ch2))
- self._nonmapped_interfaces_contacts.append(nnat)
-
+ trg_s = aln.GetSequence(0)
+ mdl_s = aln.GetSequence(1)
+ dockq_alns[(trg_s.GetName(), mdl_s.GetName())] = aln
+
+ for interface in self.dockq_interfaces:
+ trg_ch1 = interface[0]
+ trg_ch2 = interface[1]
+ mdl_ch1 = interface[2]
+ mdl_ch2 = interface[3]
+ aln1 = dockq_alns[(trg_ch1, mdl_ch1)]
+ aln2 = dockq_alns[(trg_ch2, mdl_ch2)]
+ res = dockq.DockQ(self.model, self.target, mdl_ch1, mdl_ch2,
+ trg_ch1, trg_ch2, ch1_aln=aln1,
+ ch2_aln=aln2)
+ self._fnat.append(res["fnat"])
+ self._fnonnat.append(res["fnonnat"])
+ self._irmsd.append(res["irmsd"])
+ self._lrmsd.append(res["lrmsd"])
+ self._dockq_scores.append(res["DockQ"])
+ self._nnat.append(res["nnat"])
+ self._nmdl.append(res["nmdl"])
+
+ # keep track of native counts in target interfaces which are
+ # not covered in model in order to compute
+ # dockq_ave_full/dockq_wave_full in the end
+ not_covered_counts = list()
+ proc_trg_interfaces = set([(x[0], x[1]) for x in self.dockq_interfaces])
+ for interface in self.dockq_target_interfaces:
+ if interface not in proc_trg_interfaces:
+ # let's run DockQ with trg as trg/mdl in order to get the native
+ # contacts out - no need to pass alns as the residue numbers
+ # match for sure
+ trg_ch1 = interface[0]
+ trg_ch2 = interface[1]
+ res = dockq.DockQ(self.target, self.target,
+ trg_ch1, trg_ch2, trg_ch1, trg_ch2)
+ not_covered_counts.apend(res["nnat"])
+
# there are 4 types of combined scores
# - simple average
# - average weighted by native_contacts
- # - the two above including nonmapped_interfaces => set DockQ to 0.0
- scores = np.array(self._dockq_scores)
- weights = np.array(self._native_contacts)
+ # - the two above including nonmapped_contact_interfaces => set DockQ to 0.0
+ scores = np.array([self._dockq_scores])
+ weights = np.array([self._nnat])
if len(scores) > 0:
self._dockq_ave = np.mean(scores)
else:
self._dockq_ave = 0.0
self._dockq_wave = np.sum(np.multiply(weights/np.sum(weights), scores))
- scores = np.append(scores, [0.0]*len(self._nonmapped_interfaces))
- weights = np.append(weights, self._nonmapped_interfaces_contacts)
+ scores = np.append(scores, [0.0]*len(not_covered_counts))
+ weights = np.append(weights, not_covered_counts)
if len(scores) > 0:
self._dockq_ave_full = np.mean(scores)
else:
@@ -1707,17 +2095,22 @@ class Scorer:
def _compute_tmscore(self):
res = None
- if self.usalign_exec is not None:
- if not os.path.exists(self.usalign_exec):
- raise RuntimeError(f"USalign exec ({self.usalign_exec}) "
- f"not found")
- if not os.access(self.usalign_exec, os.X_OK):
- raise RuntimeError(f"USalign exec ({self.usalign_exec}) "
- f"is not executable")
- res = tmtools.USAlign(self.model, self.target,
- usalign = self.usalign_exec)
+ if self.usalign_exec is None:
+ if self.oum:
+ flat_mapping = self.mapping.GetFlatMapping()
+ res = res = bindings.WrappedMMAlign(self.model, self.target,
+ mapping=flat_mapping)
+ else:
+ res = bindings.WrappedMMAlign(self.model, self.target)
else:
- res = bindings.WrappedMMAlign(self.model, self.target)
+ if self.oum:
+ flat_mapping = self.mapping.GetFlatMapping()
+ res = tmtools.USAlign(self.model, self.target,
+ usalign = self.usalign_exec,
+ custom_chain_mapping = flat_mapping)
+ else:
+ res = tmtools.USAlign(self.model, self.target,
+ usalign = self.usalign_exec)
self._tm_score = res.tm_score
self._usalign_mapping = dict()
diff --git a/modules/mol/alg/pymod/stereochemistry.py b/modules/mol/alg/pymod/stereochemistry.py
index b3708648bf26a4e331f683e9fe7309196450f72c..b6aa98a58406036ede61eb3a072d5982fd0b50f7 100644
--- a/modules/mol/alg/pymod/stereochemistry.py
+++ b/modules/mol/alg/pymod/stereochemistry.py
@@ -365,7 +365,7 @@ class ClashInfo:
self.dist = dist
self.tolerated_dist = tolerated_dist
- def ToJSON(self):
+ def ToJSON(self, decimals = 3):
""" Return JSON serializable dict
Atoms are represented by a string in format:
@@ -373,8 +373,8 @@ class ClashInfo:
"""
return {"a1": _AtomToQualifiedName(self.a1),
"a2": _AtomToQualifiedName(self.a2),
- "dist": self.dist,
- "tolerated_dist": self.tolerated_dist}
+ "dist": round(self.dist, decimals),
+ "tolerated_dist": round(self.tolerated_dist, decimals)}
class BondViolationInfo:
@@ -395,7 +395,7 @@ class BondViolationInfo:
self.exp_length = exp_length
self.std = std
- def ToJSON(self):
+ def ToJSON(self, decimals = 3):
""" Return JSON serializable dict
Atoms are represented by a string in format:
@@ -403,9 +403,9 @@ class BondViolationInfo:
"""
return {"a1": _AtomToQualifiedName(self.a1),
"a2": _AtomToQualifiedName(self.a2),
- "length": self.length,
- "exp_length": self.exp_length,
- "std": self.std}
+ "length": round(self.length, decimals),
+ "exp_length": round(self.exp_length, decimals),
+ "std": round(self.std, decimals)}
class AngleViolationInfo:
@@ -428,7 +428,7 @@ class AngleViolationInfo:
self.exp_angle = exp_angle
self.std = std
- def ToJSON(self):
+ def ToJSON(self, decimals = 3):
""" Return JSON serializable dict
Atoms are represented by a string in format:
@@ -437,9 +437,9 @@ class AngleViolationInfo:
return {"a1": _AtomToQualifiedName(self.a1),
"a2": _AtomToQualifiedName(self.a2),
"a3": _AtomToQualifiedName(self.a3),
- "angle": self.angle,
- "exp_angle": self.exp_angle,
- "std": self.std}
+ "angle": round(self.angle, decimals),
+ "exp_angle": round(self.exp_angle, decimals),
+ "std": round(self.std, decimals)}
def GetClashes(ent, vdw_radii = None, tolerance = 1.5, disulfid_dist = 2.03,
diff --git a/modules/mol/alg/pymod/structure_analysis.py b/modules/mol/alg/pymod/structure_analysis.py
index 2103b14a71aa4ebd0be528df66d3fe21d6782313..387102c06a1f34632272e4f461b419f9b6129ab6 100644
--- a/modules/mol/alg/pymod/structure_analysis.py
+++ b/modules/mol/alg/pymod/structure_analysis.py
@@ -71,7 +71,7 @@ def GetMinDistBetwCenterOfMassAndView(sele1,sele2):
:type sele1: :class:`~ost.mol.EntityView`
:type sele2: :class:`~ost.mol.EntityView`
- :return: distance (\ :class:`float`\ )
+ :return: distance (\\ :class:`float`\\ )
"""
if not sele1.IsValid() and sele2.IsValid():
print('invalid view')
@@ -155,7 +155,7 @@ def CalculateHelixAxis(sele1):
def CalculateDistanceDifferenceMatrix(sele1,sele2):
"""
- This function calculates the pairwise distance differences between two selections (\ :class:`~ost.mol.EntityView`\ ).
+ This function calculates the pairwise distance differences between two selections (\\ :class:`~ost.mol.EntityView`\\ ).
The two selections should have the same number of atoms
It returns an NxN DistanceDifferenceMatrix M (where N is the number of atoms in sele1)
where M[i,j]=||(sele2.atoms[i].pos-sele2.atoms[j].pos)||-||(sele1.atoms[i].pos-sele1.atoms[j].pos)||
diff --git a/modules/mol/alg/pymod/trajectory_analysis.py b/modules/mol/alg/pymod/trajectory_analysis.py
index 9ff4b341ef55ebde0d3a8c966df2292793a3fa95..bbb354d35fd2e6a8b266c83bcc999689418092d4 100644
--- a/modules/mol/alg/pymod/trajectory_analysis.py
+++ b/modules/mol/alg/pymod/trajectory_analysis.py
@@ -70,8 +70,8 @@ def RMSD_Matrix_From_Traj(t,sele,first=0,last=-1,align=True,align_sele=None):
:type first: :class:`int`
:type last: :class:`int`
- :return: Returns a numpy N\ :subscript:`frames`\ xN\ :subscript:`frames` matrix,
- where N\ :subscript:`frames` is the number of frames.
+ :return: Returns a numpy N\\ :subscript:`frames`\\ xN\\ :subscript:`frames` matrix,
+ where N\\ :subscript:`frames` is the number of frames.
"""
if not align_sele:align_sele=sele
try:
@@ -98,8 +98,8 @@ def PairwiseDistancesFromTraj(t,sele,first=0,last=-1,seq_sep=1):
"""
This function calculates the distances between any pair of atoms in **sele**
with sequence separation larger than **seq_sep** from a trajectory **t**.
- It return a matrix containing one line for each atom pair and N\ :subscript:`frames` columns, where
- N\ :subscript:`frames` is the number of frames in the trajectory.
+ It return a matrix containing one line for each atom pair and N\\ :subscript:`frames` columns, where
+ N\\ :subscript:`frames` is the number of frames in the trajectory.
:param t: the trajectory
:param sele: the selection used to determine the atom pairs
@@ -112,7 +112,7 @@ def PairwiseDistancesFromTraj(t,sele,first=0,last=-1,seq_sep=1):
:type last: :class:`int`
:type seq_sep: :class:`int`
- :return: a numpy N\ :subscript:`pairs`\ xN\ :subscript:`frames` matrix.
+ :return: a numpy N\\ :subscript:`pairs`\\ xN\\ :subscript:`frames` matrix.
"""
try:
import numpy as npy
@@ -139,10 +139,10 @@ def PairwiseDistancesFromTraj(t,sele,first=0,last=-1,seq_sep=1):
def DistanceMatrixFromPairwiseDistances(distances,p=2):
"""
- This function calculates an distance matrix M(N\ :subscript:`frames`\ xN\ :subscript:`frames`\ ) from
- the pairwise distances matrix D(N\ :subscript:`pairs`\ xN\ :subscript:`frames`\ ), where
- N\ :subscript:`frames` is the number of frames in the trajectory
- and N\ :subscript:`pairs` the number of atom pairs.
+ This function calculates an distance matrix M(N\\ :subscript:`frames`\\ xN\\ :subscript:`frames`\\ ) from
+ the pairwise distances matrix D(N\\ :subscript:`pairs`\\ xN\\ :subscript:`frames`\\ ), where
+ N\\ :subscript:`frames` is the number of frames in the trajectory
+ and N\\ :subscript:`pairs` the number of atom pairs.
M[i,j] is the distance between frame i and frame j
calculated as a p-norm of the differences in distances
from the two frames (distance-RMSD for p=2).
@@ -151,7 +151,7 @@ def DistanceMatrixFromPairwiseDistances(distances,p=2):
:py:func:`~mol.alg.trajectory_analysis.PairwiseDistancesFromTraj`
:param p: exponent used for the p-norm.
- :return: a numpy N\ :subscript:`frames`\ xN\ :subscript:`frames` matrix, where N\ :subscript:`frames`
+ :return: a numpy N\\ :subscript:`frames`\\ xN\\ :subscript:`frames` matrix, where N\\ :subscript:`frames`
is the number of frames.
"""
try:
@@ -196,7 +196,7 @@ def DistRMSDFromTraj(t,sele,ref_sele,radius=7.0,average=False,seq_sep=4,first=0,
:type last: :class:`int`
:type seq_sep: :class:`int`
- :return: a numpy vecor dist_rmsd(N\ :subscript:`frames`).
+ :return: a numpy vecor dist_rmsd(N\\ :subscript:`frames`).
"""
if not sele.GetAtomCount()==ref_sele.GetAtomCount():
print('Not same number of atoms in the two views')
@@ -243,7 +243,7 @@ def AverageDistanceMatrixFromTraj(t,sele,first=0,last=-1):
:type first: :class:`int`
:type last: :class:`int`
- :return: a numpy N\ :subscript:`pairs`\ xN\ :subscript:`pairs` matrix, where N\ :subscript:`pairs`
+ :return: a numpy N\\ :subscript:`pairs`\\ xN\\ :subscript:`pairs` matrix, where N\\ :subscript:`pairs`
is the number of atom pairs in **sele**.
"""
try:
diff --git a/modules/mol/alg/pymod/wrap_mol_alg.cc b/modules/mol/alg/pymod/wrap_mol_alg.cc
index e1b80398615764e98b67b912ae0e75758b24c136..295bea2bb84a0a3beb7784e26a9ae4efd81a9089 100644
--- a/modules/mol/alg/pymod/wrap_mol_alg.cc
+++ b/modules/mol/alg/pymod/wrap_mol_alg.cc
@@ -50,6 +50,7 @@ void export_sec_struct();
void export_sec_struct_segments();
void export_find_membrane();
void export_entity_to_density();
+void export_biounit();
namespace {
@@ -321,6 +322,7 @@ BOOST_PYTHON_MODULE(_ost_mol_alg)
export_sec_struct_segments();
export_find_membrane();
export_entity_to_density();
+ export_biounit();
def("LocalDistDiffTest", lddt_a, (arg("sequence_separation")=0,arg("local_lddt_property_string")=""));
def("LocalDistDiffTest", lddt_c, (arg("local_lddt_property_string")=""));
diff --git a/modules/mol/alg/src/CMakeLists.txt b/modules/mol/alg/src/CMakeLists.txt
index c90616ba298908dcc12d798291ba0a1770306328..49f58f50e27c0f7eeb29feafac4d4523b5cfb753 100644
--- a/modules/mol/alg/src/CMakeLists.txt
+++ b/modules/mol/alg/src/CMakeLists.txt
@@ -24,6 +24,7 @@ set(OST_MOL_ALG_HEADERS
molck.hh
find_membrane.hh
entity_to_density.hh
+ biounit.hh
)
set(OST_MOL_ALG_SOURCES
@@ -51,6 +52,7 @@ set(OST_MOL_ALG_SOURCES
molck.cc
find_membrane.cc
entity_to_density.cc
+ biounit.cc
)
set(MOL_ALG_DEPS ost_mol ost_seq ost_img ost_img_alg ost_seq_alg ost_conop)
diff --git a/modules/mol/alg/src/biounit.cc b/modules/mol/alg/src/biounit.cc
new file mode 100644
index 0000000000000000000000000000000000000000..74efb52994ba41c3246641859b00128b85c79ba3
--- /dev/null
+++ b/modules/mol/alg/src/biounit.cc
@@ -0,0 +1,354 @@
+//------------------------------------------------------------------------------
+// This file is part of the OpenStructure project <www.openstructure.org>
+//
+// Copyright (C) 2008-2023 by the OpenStructure authors
+//
+// This library is free software; you can redistribute it and/or modify it under
+// the terms of the GNU Lesser General Public License as published by the Free
+// Software Foundation; either version 3.0 of the License, or (at your option)
+// any later version.
+// This library is distributed in the hope that it will be useful, but WITHOUT
+// ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS
+// FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more
+// details.
+//
+// You should have received a copy of the GNU Lesser General Public License
+// along with this library; if not, write to the Free Software Foundation, Inc.,
+// 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA
+//------------------------------------------------------------------------------
+
+#include <ost/mol/alg/biounit.hh>
+#include <ost/mol/entity_view.hh>
+
+namespace{
+
+// dump and load vectors with various types of integers
+template<typename T>
+void LoadIntVec(std::istream& stream, std::vector<T>& vec) {
+ uint32_t size;
+ stream.read(reinterpret_cast<char*>(&size), sizeof(uint32_t));
+ vec.resize(size);
+ stream.read(reinterpret_cast<char*>(&vec[0]), size*sizeof(T));
+}
+
+template<typename T>
+void DumpIntVec(std::ostream& stream, const std::vector<T>& vec) {
+ uint32_t size = vec.size();
+ stream.write(reinterpret_cast<char*>(&size), sizeof(uint32_t));
+ stream.write(reinterpret_cast<const char*>(&vec[0]), size*sizeof(T));
+}
+
+// dump and load strings
+void Load(std::istream& stream, String& str) {
+ uint32_t size;
+ stream.read(reinterpret_cast<char*>(&size), sizeof(uint32_t));
+ str.resize(size);
+ stream.read(&str[0], size);
+}
+
+void Dump(std::ostream& stream, const String& str) {
+ uint32_t size = str.size();
+ stream.write(reinterpret_cast<char*>(&size), sizeof(uint32_t));
+ stream.write(&str[0], size);
+}
+
+// dump and load vectors with strings
+void Load(std::istream& stream, std::vector<String>& vec) {
+ std::vector<uint8_t> string_sizes;
+ String str;
+ LoadIntVec(stream, string_sizes);
+ Load(stream, str);
+ vec.resize(string_sizes.size());
+ int idx = 0;
+ for(uint i = 0; i < string_sizes.size(); ++i) {
+ vec[i] = str.substr(idx, string_sizes[i]);
+ idx += string_sizes[i];
+ }
+}
+
+void Dump(std::ostream& stream, const std::vector<String>& vec) {
+ String total_string;
+ std::vector<uint8_t> string_sizes;
+ for(auto it = vec.begin(); it != vec.end(); ++it) {
+ if(it->size() > std::numeric_limits<uint8_t>::max()) {
+ std::stringstream ss;
+ ss << "Max string size that can be encoded is ";
+ ss << std::numeric_limits<uint8_t>::max() << " cannot encode "<< *it;
+ }
+ string_sizes.push_back(it->size());
+ total_string += *it;
+ }
+ DumpIntVec(stream, string_sizes);
+ Dump(stream, total_string);
+}
+
+// dump and load vectors with Mat4
+void Load(std::istream& stream, std::vector<geom::Mat4>& vec) {
+ uint32_t size;
+ stream.read(reinterpret_cast<char*>(&size), sizeof(uint32_t));
+ vec.resize(size);
+ for(uint i = 0; i < size; ++i) {
+ stream.read(reinterpret_cast<char*>(vec[i].Data()),16*sizeof(Real));
+ }
+}
+
+void Dump(std::ostream& stream, const std::vector<geom::Mat4>& vec) {
+ uint32_t size = vec.size();
+ stream.write(reinterpret_cast<char*>(&size), sizeof(uint32_t));
+ for(uint i = 0; i < size; ++i) {
+ stream.write(reinterpret_cast<const char*>(vec[i].Data()), 16*sizeof(Real));
+ }
+}
+
+} // anon ns
+
+
+namespace ost{ namespace mol{ namespace alg{
+
+BUInfo::BUInfo(const ost::io::MMCifInfoBioUnit& bu) {
+
+ // translate MMCifInfoBioUnit objects into simpler data structures
+ au_chains = bu.GetChainList();
+
+ const std::vector<std::pair<int, int> >& bu_ch_intvl = bu.GetChainIntervalList();
+ for(auto it = bu_ch_intvl.begin(); it != bu_ch_intvl.end(); ++it) {
+ chain_intvl.push_back(it->first);
+ chain_intvl.push_back(it->second);
+ }
+
+ const std::vector<std::vector<ost::io::MMCifInfoTransOpPtr> >& bu_op_list = bu.GetOperations();
+ for(auto i = bu_op_list.begin(); i != bu_op_list.end(); ++i) {
+ std::vector<geom::Mat4> mat_list;
+ for(auto j = i->begin(); j != i->end(); ++j) {
+ geom::Mat4 m;
+ m.PasteRotation((*j)->GetMatrix());
+ m.PasteTranslation((*j)->GetVector());
+ mat_list.push_back(m);
+ }
+ operations.push_back(mat_list);
+ }
+
+ const std::vector<std::pair<int, int> >& bu_op_intvl = bu.GetOperationsIntervalList();
+ for(auto it = bu_op_intvl.begin(); it != bu_op_intvl.end(); ++it) {
+ op_intvl.push_back(it->first);
+ op_intvl.push_back(it->second);
+ }
+}
+
+void BUInfo::ToStream(std::ostream& stream) const {
+ Dump(stream, au_chains);
+ DumpIntVec(stream, chain_intvl);
+ uint32_t size = operations.size();
+ stream.write(reinterpret_cast<char*>(&size), sizeof(uint32_t));
+ for(auto it = operations.begin(); it != operations.end(); ++it) {
+ Dump(stream, *it);
+ }
+ DumpIntVec(stream, op_intvl);
+}
+
+BUInfo BUInfo::FromStream(std::istream& stream) {
+ BUInfo info;
+ Load(stream, info.au_chains);
+ LoadIntVec(stream, info.chain_intvl);
+ uint32_t size = 0;
+ stream.read(reinterpret_cast<char*>(&size), sizeof(uint32_t));
+ info.operations.resize(size);
+ for(uint i = 0; i < size; ++i) {
+ Load(stream, info.operations[i]);
+ }
+ LoadIntVec(stream, info.op_intvl);
+ return info;
+}
+
+BUInfo BUInfo::FromString(const String& s) {
+ std::istringstream in_stream(s);
+ BUInfo info = BUInfo::FromStream(in_stream);
+ return info;
+}
+
+String BUInfo::ToString() const {
+ std::ostringstream out_stream;
+ this->ToStream(out_stream);
+ return out_stream.str();
+}
+
+const std::vector<std::vector<String> >& BUInfo::GetAUChains() const {
+ if(au_chains_.empty()) {
+ this->_InitTransforms();
+ }
+ return au_chains_;
+}
+
+const std::vector<std::vector<geom::Mat4> >& BUInfo::GetTransformations() const {
+ if(transforms_.empty()) {
+ this->_InitTransforms();
+ }
+ return transforms_;
+}
+
+void BUInfo::_InitTransforms() const {
+ int n_intervals = chain_intvl.size() / 2;
+ for(int intvl_idx = 0; intvl_idx < n_intervals; ++intvl_idx) {
+ // extract relevant chain names from asu
+ ////////////////////////////////////////
+ std::vector<String> chain_names;
+ int chain_start = chain_intvl[2*intvl_idx];
+ int chain_end = chain_intvl[2*intvl_idx+1];
+ for(int ch_idx = chain_start; ch_idx < chain_end; ++ch_idx) {
+ chain_names.push_back(au_chains[ch_idx]);
+ }
+ au_chains_.push_back(chain_names);
+ // extract operations that will be applied to those chains
+ //////////////////////////////////////////////////////////
+ std::vector<geom::Mat4> transforms;
+ int op_start = op_intvl[2*intvl_idx];
+ int op_end = op_intvl[2*intvl_idx+1];
+ if(op_end > op_start) {
+ for(auto it = operations[op_start].begin();
+ it != operations[op_start].end(); ++it) {
+ transforms.push_back(*it);
+ }
+ ++op_start;
+ while(op_start < op_end) {
+ std::vector<geom::Mat4> tmp_transforms;
+ for(auto i = operations[op_start].begin();
+ i != operations[op_start].end(); ++i) {
+ for(auto j = transforms.begin(); j != transforms.end(); ++j) {
+ tmp_transforms.push_back((*j)*(*i));
+ }
+ }
+ transforms = tmp_transforms;
+ ++op_start;
+ }
+ }
+ transforms_.push_back(transforms);
+ }
+}
+
+ost::mol::EntityHandle CreateBU(const ost::mol::EntityHandle& asu,
+ const ost::io::MMCifInfoBioUnit& bu) {
+ BUInfo bu_info(bu);
+ return CreateBU(asu, bu_info);
+}
+
+ost::mol::EntityHandle CreateBU(const ost::mol::EntityHandle& asu,
+ const BUInfo& bu_info) {
+ ost::mol::EntityHandle ent = ost::mol::CreateEntity();
+ ent.SetName(asu.GetName());
+ ost::mol::XCSEditor ed = ent.EditXCS(mol::BUFFERED_EDIT);
+
+ // For chain naming. First copy with transformation: 2.<au_cname>, second
+ // 3.<au_cname> etc.
+ std::map<String, int> chain_counter;
+
+ // The name 1.<au_cname> is reserved for that particular AU chain with
+ // identity transform, i.e. the copy of the actual AU chain. We need to keep
+ // track of this as there can only be one.
+ std::set<String> au_chain_copies;
+
+ const std::vector<std::vector<String> >& au_chains = bu_info.GetAUChains();
+ const std::vector<std::vector<geom::Mat4> >& transforms =
+ bu_info.GetTransformations();
+
+ for(uint chain_intvl = 0; chain_intvl < au_chains.size(); ++chain_intvl) {
+ if(au_chains[chain_intvl].empty()) continue;
+ // derive all bonds related to that chain_intvl
+ // potentially also interchain bonds
+ std::stringstream query_ss;
+ query_ss << "cname=" << au_chains[chain_intvl][0];
+ for(uint i = 1; i < au_chains[chain_intvl].size(); ++i) {
+ query_ss << ',' << au_chains[chain_intvl][i];
+ }
+ ost::mol::EntityView asu_view = asu.Select(query_ss.str());
+ const ost::mol::BondHandleList& bond_list = asu_view.GetBondList();
+
+ // process all transformations
+ for(uint t_idx = 0; t_idx < transforms[chain_intvl].size(); ++t_idx) {
+ const geom::Mat4& m = transforms[chain_intvl][t_idx];
+
+ // check if m is identity matrix => no transformation applied
+ bool is_identity = true;
+ geom::Mat4 identity_matrix = geom::Mat4::Identity();
+ const Real* m_data = m.Data();
+ const Real* identity_data = identity_matrix.Data();
+ for(int i = 0; i < 16; ++i) {
+ if(std::abs(m_data[i] - identity_data[i]) > 1e-5) {
+ is_identity = false;
+ break;
+ }
+ }
+
+ // key: au_at.GetHashCode, value: bu_at
+ // required for bond buildup in the end
+ std::map<long, AtomHandle> atom_mapper;
+ for(uint c_idx = 0; c_idx < au_chains[chain_intvl].size(); ++c_idx) {
+ String au_cname = au_chains[chain_intvl][c_idx];
+
+ std::stringstream bu_cname_ss;
+ if(is_identity) {
+ if(au_chain_copies.find(au_cname) != au_chain_copies.end()) {
+ std::stringstream err;
+ err<<"Try to insert copy of AU chain "<<au_cname<<" with identity ";
+ err<<"transform, i.e. copy the raw coordinates. This has already ";
+ err<<"been done for this AU chain and there can only be one.";
+ throw ost::Error(err.str());
+ }
+ bu_cname_ss << "1." << au_cname; // 1.<au_cname> reserved for AU chain
+ // without transformation
+ au_chain_copies.insert(au_cname);
+ } else {
+ if(chain_counter.find(au_cname) == chain_counter.end()) {
+ chain_counter[au_cname] = 2;
+ }
+ bu_cname_ss << chain_counter[au_cname] << '.' << au_cname;
+ chain_counter[au_cname] += 1;
+ }
+ ost::mol::ChainHandle asu_ch = asu.FindChain(au_cname);
+ if(!asu_ch.IsValid()) {
+ std::stringstream ss;
+ ss << "Cannot construct biounit with asu chain "<<au_cname;
+ ss << ". Specified interval only has: " <<au_chains[chain_intvl][0];
+ for(uint i = 1; i < au_chains[chain_intvl].size(); ++i) {
+ ss << ',' << au_chains[chain_intvl][i];
+ }
+ throw ost::Error(ss.str());
+ }
+ ost::mol::ChainHandle bu_ch = ed.InsertChain(bu_cname_ss.str());
+ ed.SetChainType(bu_ch, asu_ch.GetType());
+ ost::mol::ResidueHandleList au_res_list = asu_ch.GetResidueList();
+ for(auto res_it = au_res_list.begin();
+ res_it != au_res_list.end(); ++res_it) {
+ ost::mol::ResidueHandle bu_res = ed.AppendResidue(bu_ch,
+ res_it->GetName(), res_it->GetNumber());
+ bu_res.SetOneLetterCode(res_it->GetOneLetterCode());
+ bu_res.SetSecStructure(res_it->GetSecStructure());
+ bu_res.SetChemClass(res_it->GetChemClass());
+ bu_res.SetChemType(res_it->GetChemType());
+ bu_res.SetIsProtein(res_it->IsProtein());
+ bu_res.SetIsLigand(res_it->IsLigand());
+ ost::mol::AtomHandleList au_at_list = res_it->GetAtomList();
+ for(auto at_it = au_at_list.begin(); at_it != au_at_list.end(); ++at_it) {
+ geom::Vec3 bu_at_pos = geom::Vec3(m*geom::Vec4(at_it->GetPos()));
+ ost::mol::AtomHandle bu_at = ed.InsertAtom(bu_res, at_it->GetName(),
+ bu_at_pos,
+ at_it->GetElement(),
+ at_it->GetOccupancy(),
+ at_it->GetBFactor(),
+ at_it->IsHetAtom());
+ atom_mapper[at_it->GetHashCode()] = bu_at;
+ }
+ }
+ }
+
+ // connect
+ for(auto it = bond_list.begin(); it != bond_list.end(); ++it) {
+ ed.Connect(atom_mapper[it->GetFirst().GetHashCode()],
+ atom_mapper[it->GetSecond().GetHashCode()]);
+ }
+
+ }
+ }
+ return ent;
+}
+
+}}} // ns
diff --git a/modules/mol/alg/src/biounit.hh b/modules/mol/alg/src/biounit.hh
new file mode 100644
index 0000000000000000000000000000000000000000..3af0483e19bb5fa5afe816d93ebdd8a919613861
--- /dev/null
+++ b/modules/mol/alg/src/biounit.hh
@@ -0,0 +1,66 @@
+//------------------------------------------------------------------------------
+// This file is part of the OpenStructure project <www.openstructure.org>
+//
+// Copyright (C) 2008-2023 by the OpenStructure authors
+//
+// This library is free software; you can redistribute it and/or modify it under
+// the terms of the GNU Lesser General Public License as published by the Free
+// Software Foundation; either version 3.0 of the License, or (at your option)
+// any later version.
+// This library is distributed in the hope that it will be useful, but WITHOUT
+// ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS
+// FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more
+// details.
+//
+// You should have received a copy of the GNU Lesser General Public License
+// along with this library; if not, write to the Free Software Foundation, Inc.,
+// 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA
+//------------------------------------------------------------------------------
+#ifndef OST_MOL_ALG_BIOUNIT_HH
+#define OST_MOL_ALG_BIOUNIT_HH
+
+#include <ost/mol/entity_handle.hh>
+#include <ost/io/mmcif_info.hh>
+
+namespace ost { namespace mol { namespace alg {
+
+struct BUInfo {
+
+ BUInfo() { };
+
+ BUInfo(const ost::io::MMCifInfoBioUnit& bu);
+
+ void ToStream(std::ostream& stream) const;
+
+ static BUInfo FromStream(std::istream& stream);
+
+ String ToString() const;
+
+ static BUInfo FromString(const String& s);
+
+ const std::vector<std::vector<String> >& GetAUChains() const;
+
+ const std::vector<std::vector<geom::Mat4> >& GetTransformations() const;
+
+ void _InitTransforms() const;
+
+ std::vector<String> au_chains;
+ std::vector<int> chain_intvl;
+ std::vector<std::vector<geom::Mat4> > operations;
+ std::vector<int> op_intvl;
+
+private:
+ mutable std::vector<std::vector<String> > au_chains_;
+ mutable std::vector<std::vector<geom::Mat4> > transforms_;
+};
+
+ost::mol::EntityHandle CreateBU(const ost::mol::EntityHandle& asu,
+ const ost::io::MMCifInfoBioUnit& bu);
+
+
+ost::mol::EntityHandle CreateBU(const ost::mol::EntityHandle& asu,
+ const BUInfo& bu_info);
+
+}}} // ns
+
+#endif // OST_MOL_ALG_BIOUNIT_HH
diff --git a/modules/mol/alg/tests/CMakeLists.txt b/modules/mol/alg/tests/CMakeLists.txt
index fb23115cf4403e55471fb6a92bc5ce7a8d48f3b2..268d09c8153ad1b2d5fe756981416e5373e4b0dd 100644
--- a/modules/mol/alg/tests/CMakeLists.txt
+++ b/modules/mol/alg/tests/CMakeLists.txt
@@ -11,6 +11,8 @@ set(OST_MOL_ALG_UNIT_TESTS
test_lddt.py
test_qsscore.py
test_stereochemistry.py
+ test_contact_score.py
+ test_biounit.py
)
if (COMPOUND_LIB)
diff --git a/modules/mol/alg/tests/test_biounit.py b/modules/mol/alg/tests/test_biounit.py
new file mode 100644
index 0000000000000000000000000000000000000000..3ca6aced5707830247ffcc9f8dcd986935cf20b6
--- /dev/null
+++ b/modules/mol/alg/tests/test_biounit.py
@@ -0,0 +1,104 @@
+import unittest, os, sys
+import ost
+from ost import io, geom, mol
+from ost.mol.alg import BUInfo
+
+class TestBioUnit(unittest.TestCase):
+
+ def test_bu(self):
+ ent, seqres, info = io.LoadMMCIF("testfiles/1out.cif.gz",
+ seqres=True,
+ info=True)
+
+ # Create BUInfo from MMCifInfoBioUnit
+ biounits = info.GetBioUnits()
+ self.assertEqual(len(biounits), 1)
+ bu_info = BUInfo(biounits[0])
+
+ # directly use the dump and load mechanism
+ # IF ANY UNIT TEST FAILS, DISABLE THE FOLLOWING TWO LINES
+ # TO EXCLUDE THE POSSIBILITY OF ISSUES IN BUINFO IO FUNCTIONALITY
+ bytes_str = bu_info.ToBytes()
+ bu_info = BUInfo.FromBytes(bytes_str)
+
+ # check whether properties in BUInfo object are correctly set
+ asu_chains = bu_info.GetAUChains()
+ self.assertEqual(asu_chains, [["A", "B", "C", "D", "E", "F"]])
+ transformations = bu_info.GetTransformations()
+ self.assertEqual(len(transformations), 1)
+ self.assertEqual(len(transformations[0]), 2)
+ self.assertEqual(transformations[0][0], geom.Mat4()) # identity
+
+ # reconstruct biounit
+ bu = mol.alg.CreateBU(ent, bu_info)
+ self.assertEqual([ch.GetName() for ch in bu.chains],
+ ["1.A", "1.B", "1.C", "1.D", "1.E", "1.F",
+ "2.A", "2.B", "2.C", "2.D", "2.E", "2.F"])
+
+ # extract copies of original assymetric units from biounit
+ for ch in bu.chains:
+ ch.SetIntProp("asu_copy_idx", int(ch.GetName().split('.')[0]))
+ asu_copy_one = bu.Select("gcasu_copy_idx=1")
+ asu_copy_two = bu.Select("gcasu_copy_idx=2")
+
+ # compare bonds - well, this tests whether bonds have been correctly
+ # transferred. BUT: we can be pretty sure that all atoms/residues/chains
+ # have been transferred too when explicitely checking the bonds.
+ asu_bonds = ent.GetBondList()
+ asu_bonds_desc = list()
+ for b in asu_bonds:
+ at_one = b.GetFirst()
+ at_one_cname = at_one.GetChain().GetName()
+ at_one_rname = at_one.GetResidue().GetName()
+ at_one_rnum = at_one.GetResidue().GetNumber().GetNum()
+ at_one_name = at_one.GetName()
+ at_one_desc = f"{at_one_cname}.{at_one_rname}.{at_one_rnum}.{at_one_name}"
+ at_two = b.GetSecond()
+ at_two_cname = at_two.GetChain().GetName()
+ at_two_rname = at_two.GetResidue().GetName()
+ at_two_rnum = at_two.GetResidue().GetNumber().GetNum()
+ at_two_name = at_two.GetName()
+ at_two_desc = f"{at_two_cname}.{at_two_rname}.{at_two_rnum}.{at_two_name}"
+ asu_bonds_desc.append((at_one_desc, at_two_desc))
+
+ asu_copy_one_bonds = asu_copy_one.GetBondList()
+ asu_copy_one_bonds_desc = list()
+ for b in asu_copy_one_bonds:
+ at_one = b.GetFirst()
+ at_one_cname = at_one.GetChain().GetName().split('.')[1]
+ at_one_rname = at_one.GetResidue().GetName()
+ at_one_rnum = at_one.GetResidue().GetNumber().GetNum()
+ at_one_name = at_one.GetName()
+ at_one_desc = f"{at_one_cname}.{at_one_rname}.{at_one_rnum}.{at_one_name}"
+ at_two = b.GetSecond()
+ at_two_cname = at_two.GetChain().GetName().split('.')[1]
+ at_two_rname = at_two.GetResidue().GetName()
+ at_two_rnum = at_two.GetResidue().GetNumber().GetNum()
+ at_two_name = at_two.GetName()
+ at_two_desc = f"{at_two_cname}.{at_two_rname}.{at_two_rnum}.{at_two_name}"
+ asu_copy_one_bonds_desc.append((at_one_desc, at_two_desc))
+
+ asu_copy_two_bonds = asu_copy_two.GetBondList()
+ asu_copy_two_bonds_desc = list()
+ for b in asu_copy_two_bonds:
+ at_one = b.GetFirst()
+ at_one_cname = at_one.GetChain().GetName().split('.')[1]
+ at_one_rname = at_one.GetResidue().GetName()
+ at_one_rnum = at_one.GetResidue().GetNumber().GetNum()
+ at_one_name = at_one.GetName()
+ at_one_desc = f"{at_one_cname}.{at_one_rname}.{at_one_rnum}.{at_one_name}"
+ at_two = b.GetSecond()
+ at_two_cname = at_two.GetChain().GetName().split('.')[1]
+ at_two_rname = at_two.GetResidue().GetName()
+ at_two_rnum = at_two.GetResidue().GetNumber().GetNum()
+ at_two_name = at_two.GetName()
+ at_two_desc = f"{at_two_cname}.{at_two_rname}.{at_two_rnum}.{at_two_name}"
+ asu_copy_two_bonds_desc.append((at_one_desc, at_two_desc))
+
+ self.assertEqual(sorted(asu_bonds_desc), sorted(asu_copy_one_bonds_desc))
+ self.assertEqual(sorted(asu_bonds_desc), sorted(asu_copy_two_bonds_desc))
+
+
+if __name__ == "__main__":
+ from ost import testutils
+ testutils.RunTests()
diff --git a/modules/mol/alg/tests/test_chain_mapping.py b/modules/mol/alg/tests/test_chain_mapping.py
index 3d4ccbde250a3f9e2f4b39e7b4b9a5010a18645f..e26ad858d36432ff8b170701b719f6760e43cc1e 100644
--- a/modules/mol/alg/tests/test_chain_mapping.py
+++ b/modules/mol/alg/tests/test_chain_mapping.py
@@ -289,17 +289,20 @@ class TestChainMapper(unittest.TestCase):
greedy_rigid_res = mapper.GetRigidMapping(mdl, strategy="greedy_iterative_rmsd")
self.assertEqual(greedy_rigid_res.mapping, [['X', 'Y'],[None],['Z']])
+ # the default chain mapping
+ default_res = mapper.GetMapping(mdl)
+
# test flat mapping functionality of MappingResult
- flat_map = greedy_rigid_res.GetFlatMapping()
+ flat_map = default_res.GetFlatMapping()
self.assertEqual(len(flat_map), 3)
- self.assertEqual(flat_map[greedy_rigid_res.chem_groups[0][0]], 'X')
- self.assertEqual(flat_map[greedy_rigid_res.chem_groups[0][1]], 'Y')
- self.assertEqual(flat_map[greedy_rigid_res.chem_groups[2][0]], 'Z')
- flat_map = greedy_rigid_res.GetFlatMapping(mdl_as_key=True)
+ self.assertEqual(flat_map[default_res.chem_groups[0][0]], 'X')
+ self.assertEqual(flat_map[default_res.chem_groups[0][1]], 'Y')
+ self.assertEqual(flat_map[default_res.chem_groups[2][0]], 'Z')
+ flat_map = default_res.GetFlatMapping(mdl_as_key=True)
self.assertEqual(len(flat_map), 3)
- self.assertEqual(greedy_rigid_res.chem_groups[0][0], flat_map['X'])
- self.assertEqual(greedy_rigid_res.chem_groups[0][1], flat_map['Y'])
- self.assertEqual(greedy_rigid_res.chem_groups[2][0], flat_map['Z'])
+ self.assertEqual(default_res.chem_groups[0][0], flat_map['X'])
+ self.assertEqual(default_res.chem_groups[0][1], flat_map['Y'])
+ self.assertEqual(default_res.chem_groups[2][0], flat_map['Z'])
# test Align function of ChainMapper
_, mdl_polypep_seqs, mdl_polynuc_seqs = mapper.ProcessStructure(mdl)
diff --git a/modules/mol/alg/tests/test_contact_score.py b/modules/mol/alg/tests/test_contact_score.py
new file mode 100644
index 0000000000000000000000000000000000000000..1a3a53e529d4ec4d090f82d74417cbde426ddae4
--- /dev/null
+++ b/modules/mol/alg/tests/test_contact_score.py
@@ -0,0 +1,78 @@
+import unittest, os, sys
+import ost
+from ost import conop
+from ost import io, mol, seq, settings
+# check if we can import: fails if numpy or scipy not available
+try:
+ import numpy as np
+ from ost.mol.alg.contact_score import *
+ from ost.mol.alg.chain_mapping import *
+except ImportError:
+ print("Failed to import contact_score.py. Happens when numpy or scipy "\
+ "missing. Ignoring contact_score.py tests.")
+ sys.exit(0)
+
+def _LoadFile(file_name):
+ """Helper to avoid repeating input path over and over."""
+ return io.LoadPDB(os.path.join('testfiles', file_name))
+
+class TestContactScore(unittest.TestCase):
+ def test_ContactEntity(self):
+ self.maxDiff = None
+ ent = _LoadFile("3l1p.1.pdb")
+ cent = ContactEntity(ent)
+ self.assertEqual(cent.GetChain("A").GetName(), "A")
+ self.assertEqual(cent.GetChain("B").GetName(), "B")
+ self.assertEqual(cent.GetChain("C").GetName(), "C")
+ self.assertEqual(cent.GetChain("D").GetName(), "D")
+ self.assertRaises(Exception, cent.GetChain, "E")
+ self.assertEqual(cent.chain_names, ["A", "B", "C", "D"])
+ self.assertEqual(cent.GetSequence("A"), "DMKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTISRFEALQLSLKNMSKLRPLLEKWVEEADNNENLQEISKSVQARKRKRTSIENRVRWSLETMFLKSPKPSLQQITHIANQLGLEKDVVRVWFSNRRQKGKR")
+ self.assertEqual(cent.GetSequence("B"), "KALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTISRFEALQLSLKNMSKLRPLLEKWVEEADNNENLQEISKSQARKRKRTSIENRVRWSLETMFLKSPKPSLQQITHIANQLGLEKDVVRVWFSNRRQKGKRS")
+ self.assertEqual(cent.GetSequence("C"), "TCCACATTTGAAAGGCAAATGGA")
+ self.assertEqual(cent.GetSequence("D"), "ATCCATTTGCCTTTCAAATGTGG")
+ self.assertEqual(cent.contact_mode, "aa")
+ self.assertEqual(cent.contact_d, 5.0)
+ self.assertEqual(cent.interacting_chains, [('A', 'B'), ('A', 'D'),
+ ('A', 'C'), ('B', 'C'),
+ ('B', 'D'), ('C', 'D')])
+ exp_contacts = sorted(list(cent.contacts[('A', 'C')]))
+ self.assertEqual(exp_contacts, [(40, 9), (41, 8), (41, 9), (42, 8),
+ (42, 9), (42, 10), (43, 12), (44, 9),
+ (44, 10), (44, 11), (45, 8), (45, 9),
+ (48, 8), (48, 9), (54, 8), (55, 6),
+ (55, 7), (57, 7), (58, 7), (58, 8),
+ (62, 8), (91, 8), (91, 9), (91, 10),
+ (93, 8), (93, 9), (93, 10), (95, 10),
+ (95, 11), (113, 2), (113, 3), (115, 2),
+ (134, 1), (139, 5), (141, 2), (141, 3),
+ (142, 4), (142, 5), (142, 6), (145, 4)])
+
+ def test_ContactScorer(self):
+ target = _LoadFile("3l1p.1.pdb")
+ model = _LoadFile("3l1p.1_model.pdb")
+
+ # we need to derive a chain mapping prior to scoring
+ mapper = ChainMapper(target)
+ res = mapper.GetRigidMapping(model, strategy="greedy_iterative_rmsd")
+ contact_scorer = ContactScorer.FromMappingResult(res)
+ score_result = contact_scorer.ScoreICS(res.mapping)
+ self.assertAlmostEqual(score_result.precision, 0.583, places=2)
+ self.assertAlmostEqual(score_result.recall, 0.288, places=2)
+ self.assertAlmostEqual(score_result.ics, 0.386, places=2)
+
+ score_result = contact_scorer.ScoreIPS(res.mapping)
+ self.assertAlmostEqual(score_result.precision, 0.779, places=2)
+ self.assertAlmostEqual(score_result.recall, 0.493, places=2)
+ self.assertAlmostEqual(score_result.ips, 0.432, places=2)
+
+if __name__ == "__main__":
+ from ost import testutils
+ if testutils.DefaultCompoundLibIsSet():
+ testutils.RunTests()
+ else:
+ print('No compound lib available. Ignoring contact_score.py tests.')
+
+
+
+
diff --git a/modules/mol/alg/tests/test_ligand_scoring.py b/modules/mol/alg/tests/test_ligand_scoring.py
index 2cd83eca03817052e318cec9de8d7419f046e748..b4051f27ec1b81dd0fa11927972a0a8c27a20e51 100644
--- a/modules/mol/alg/tests/test_ligand_scoring.py
+++ b/modules/mol/alg/tests/test_ligand_scoring.py
@@ -3,6 +3,7 @@ from functools import lru_cache
import numpy as np
+import ost
from ost import io, mol, geom
# check if we can import: fails if numpy or scipy not available
try:
@@ -50,10 +51,10 @@ class TestLigandScoring(unittest.TestCase):
sc = LigandScorer(mdl, trg, None, None)
- assert len(sc.target_ligands) == 7
- assert len(sc.model_ligands) == 1
- assert len([r for r in sc.target.residues if r.is_ligand]) == 7
- assert len([r for r in sc.model.residues if r.is_ligand]) == 1
+ self.assertEqual(len(sc.target_ligands), 7)
+ self.assertEqual(len(sc.model_ligands), 1)
+ self.assertEqual(len([r for r in sc.target.residues if r.is_ligand]), 7)
+ self.assertEqual(len([r for r in sc.model.residues if r.is_ligand]), 1)
def test_init_given_ligands(self):
"""Test that we can instantiate the scorer with ligands contained in
@@ -67,29 +68,29 @@ class TestLigandScoring(unittest.TestCase):
mdl_lig = [mdl.Select("rname=G3D")]
sc = LigandScorer(mdl, trg, mdl_lig, trg_lig)
- assert len(sc.target_ligands) == 4
- assert len(sc.model_ligands) == 1
+ self.assertEqual(len(sc.target_ligands), 4)
+ self.assertEqual(len(sc.model_ligands), 1)
# IsLigand flag should still be set even on not selected ligands
- assert len([r for r in sc.target.residues if r.is_ligand]) == 7
- assert len([r for r in sc.model.residues if r.is_ligand]) == 1
+ self.assertEqual(len([r for r in sc.target.residues if r.is_ligand]), 7)
+ self.assertEqual(len([r for r in sc.model.residues if r.is_ligand]), 1)
# Ensure the residues are not copied
- assert len(sc.target.Select("rname=MG").residues) == 2
- assert len(sc.target.Select("rname=G3D").residues) == 2
- assert len(sc.model.Select("rname=G3D").residues) == 1
+ self.assertEqual(len(sc.target.Select("rname=MG").residues), 2)
+ self.assertEqual(len(sc.target.Select("rname=G3D").residues), 2)
+ self.assertEqual(len(sc.model.Select("rname=G3D").residues), 1)
# Pass residue handles
trg_lig = [trg.FindResidue("F", 1), trg.FindResidue("H", 1)]
mdl_lig = [mdl.FindResidue("L_2", 1)]
sc = LigandScorer(mdl, trg, mdl_lig, trg_lig)
- assert len(sc.target_ligands) == 2
- assert len(sc.model_ligands) == 1
+ self.assertEqual(len(sc.target_ligands), 2)
+ self.assertEqual(len(sc.model_ligands), 1)
# Ensure the residues are not copied
- assert len(sc.target.Select("rname=ZN").residues) == 1
- assert len(sc.target.Select("rname=G3D").residues) == 2
- assert len(sc.model.Select("rname=G3D").residues) == 1
+ self.assertEqual(len(sc.target.Select("rname=ZN").residues), 1)
+ self.assertEqual(len(sc.target.Select("rname=G3D").residues), 2)
+ self.assertEqual(len(sc.model.Select("rname=G3D").residues), 1)
def test_init_sdf_ligands(self):
"""Test that we can instantiate the scorer with ligands from separate SDF files.
@@ -115,11 +116,11 @@ class TestLigandScoring(unittest.TestCase):
# Pass entities
sc = LigandScorer(mdl, trg, mdl_ligs, trg_ligs)
- assert len(sc.target_ligands) == 7
- assert len(sc.model_ligands) == 1
+ self.assertEqual(len(sc.target_ligands), 7)
+ self.assertEqual(len(sc.model_ligands), 1)
# Ensure we set the is_ligand flag
- assert len([r for r in sc.target.residues if r.is_ligand]) == 7
- assert len([r for r in sc.model.residues if r.is_ligand]) == 1
+ self.assertEqual(len([r for r in sc.target.residues if r.is_ligand]), 7)
+ self.assertEqual(len([r for r in sc.model.residues if r.is_ligand]), 1)
# Pass residues
mdl_ligs_res = [mdl_ligs[0].residues[0]]
@@ -127,8 +128,8 @@ class TestLigandScoring(unittest.TestCase):
sc = LigandScorer(mdl, trg, mdl_ligs_res, trg_ligs_res)
- assert len(sc.target_ligands) == 7
- assert len(sc.model_ligands) == 1
+ self.assertEqual(len(sc.target_ligands), 7)
+ self.assertEqual(len(sc.model_ligands), 1)
def test_init_reject_duplicate_ligands(self):
"""Test that we reject input if multiple ligands with the same chain
@@ -158,16 +159,16 @@ class TestLigandScoring(unittest.TestCase):
mdl_lig = _LoadEntity("P84080_model_02_ligand_0.sdf")
graph = ligand_scoring._ResidueToGraph(mdl_lig.residues[0])
- assert len(graph.edges) == 34
- assert len(graph.nodes) == 32
+ self.assertEqual(len(graph.edges), 34)
+ self.assertEqual(len(graph.nodes), 32)
# Check an arbitrary node
- assert [a for a in graph.adj["14"].keys()] == ["13", "29"]
+ self.assertEqual([a for a in graph.adj["14"].keys()], ["13", "29"])
graph = ligand_scoring._ResidueToGraph(mdl_lig.residues[0], by_atom_index=True)
- assert len(graph.edges) == 34
- assert len(graph.nodes) == 32
+ self.assertEqual(len(graph.edges), 34)
+ self.assertEqual(len(graph.nodes), 32)
# Check an arbitrary node
- assert [a for a in graph.adj[13].keys()] == [12, 28]
+ self.assertEqual([a for a in graph.adj[13].keys()], [12, 28])
def test__ComputeSymmetries(self):
"""Test that _ComputeSymmetries works.
@@ -182,31 +183,33 @@ class TestLigandScoring(unittest.TestCase):
mdl_g3d = mdl.FindResidue("L_2", 1)
sym = ligand_scoring._ComputeSymmetries(mdl_g3d, trg_g3d1)
- assert len(sym) == 72
+ self.assertEqual(len(sym), 72)
sym = ligand_scoring._ComputeSymmetries(mdl_g3d, trg_g3d1, by_atom_index=True)
- assert len(sym) == 72
+ self.assertEqual(len(sym), 72)
# Test that we can match ions read from SDF
sdf_lig = _LoadEntity("1r8q_ligand_0.sdf")
sym = ligand_scoring._ComputeSymmetries(trg_mg1, sdf_lig.residues[0], by_atom_index=True)
- assert len(sym) == 1
+ self.assertEqual(len(sym), 1)
# Test that it works with views and only consider atoms in the view
# Skip PA, PB and O[1-3]A and O[1-3]B in target and model
# We assume atom index are fixed and won't change
- trg_g3d1_sub = trg_g3d1.Select("aindex>6019").residues[0]
- mdl_g3d_sub = mdl_g3d.Select("aindex>1447").residues[0]
+ trg_g3d1_sub_ent = trg_g3d1.Select("aindex>6019")
+ trg_g3d1_sub = trg_g3d1_sub_ent.residues[0]
+ mdl_g3d_sub_ent = mdl_g3d.Select("aindex>1447")
+ mdl_g3d_sub = mdl_g3d_sub_ent.residues[0]
sym = ligand_scoring._ComputeSymmetries(mdl_g3d_sub, trg_g3d1_sub)
- assert len(sym) == 6
+ self.assertEqual(len(sym), 6)
sym = ligand_scoring._ComputeSymmetries(mdl_g3d_sub, trg_g3d1_sub, by_atom_index=True)
- assert len(sym) == 6
+ self.assertEqual(len(sym), 6)
# Substructure matches
sym = ligand_scoring._ComputeSymmetries(mdl_g3d, trg_g3d1_sub, substructure_match=True)
- assert len(sym) == 6
+ self.assertEqual(len(sym), 6)
# Missing atoms only allowed in target, not in model
with self.assertRaises(NoSymmetryError):
@@ -269,7 +272,7 @@ class TestLigandScoring(unittest.TestCase):
sc._compute_scores()
# Check RMSD
- assert sc.rmsd_matrix.shape == (7, 1)
+ self.assertEqual(sc.rmsd_matrix.shape, (7, 1))
np.testing.assert_almost_equal(sc.rmsd_matrix, np.array(
[[np.nan],
[0.04244993],
@@ -369,24 +372,23 @@ class TestLigandScoring(unittest.TestCase):
# Local by default
sc = LigandScorer(mdl, trg, None, None)
- assert sc.rmsd_details["L_2"][1]["chain_mapping"] == {'A': 'A'}
- assert sc.lddt_pli_details["L_2"][1]["chain_mapping"] == {'C': 'A'}
+ self.assertEqual(sc.rmsd_details["L_2"][1]["chain_mapping"], {'A': 'A'})
+ self.assertEqual(sc.lddt_pli_details["L_2"][1]["chain_mapping"], {'C': 'A'})
# Global
sc = LigandScorer(mdl, trg, None, None, global_chain_mapping=True)
- assert sc.rmsd_details["L_2"][1]["chain_mapping"] == {'C': 'A'}
- assert sc.lddt_pli_details["L_2"][1]["chain_mapping"] == {'C': 'A'}
+ self.assertEqual(sc.rmsd_details["L_2"][1]["chain_mapping"], {'C': 'A'})
+ self.assertEqual(sc.lddt_pli_details["L_2"][1]["chain_mapping"], {'C': 'A'})
# Custom
sc = LigandScorer(mdl, trg, None, None, global_chain_mapping=True, custom_mapping={'A': 'A'})
- assert sc.rmsd_details["L_2"][1]["chain_mapping"] == {'A': 'A'}
- assert sc.lddt_pli_details["L_2"][1]["chain_mapping"] == {'A': 'A'}
+ self.assertEqual(sc.rmsd_details["L_2"][1]["chain_mapping"], {'A': 'A'})
+ self.assertEqual(sc.lddt_pli_details["L_2"][1]["chain_mapping"], {'A': 'A'})
# Custom only active with global chain mapping
sc = LigandScorer(mdl, trg, None, None, global_chain_mapping=False, custom_mapping={'A': 'A'})
- assert sc.rmsd_details["L_2"][1]["chain_mapping"] == {'A': 'A'}
- assert sc.lddt_pli_details["L_2"][1]["chain_mapping"] == {'C': 'A'}
-
+ self.assertEqual(sc.rmsd_details["L_2"][1]["chain_mapping"], {'A': 'A'})
+ self.assertEqual(sc.lddt_pli_details["L_2"][1]["chain_mapping"], {'C': 'A'})
def test_rmsd_assignment(self):
"""Test that the RMSD-based assignment works.
@@ -405,7 +407,254 @@ class TestLigandScoring(unittest.TestCase):
# RMSD assignment forces the same assignment
sc = LigandScorer(mdl, trg, None, None, rmsd_assignment=True)
- assert sc.rmsd_details["L_2"][1]["target_ligand"] == sc.lddt_pli_details["L_2"][1]["target_ligand"]
+ self.assertEqual(sc.rmsd_details["L_2"][1]["target_ligand"], sc.lddt_pli_details["L_2"][1]["target_ligand"])
+
+ def test_ignore_binding_site(self):
+ """Test that we ignore non polymer stuff in the binding site.
+ NOTE: we should consider changing this behavior in the future and take
+ other ligands, peptides and short oligomers into account for superposition.
+ When that's the case this test should be adapter
+ """
+ trg = _LoadMMCIF("1SSP.cif.gz")
+ sc = LigandScorer(trg, trg, None, None)
+ expected_bs_ref_res = ['C.GLY62', 'C.GLN63', 'C.ASP64', 'C.PRO65', 'C.TYR66', 'C.CYS76', 'C.PHE77', 'C.ASN123', 'C.HIS187']
+ ost.PushVerbosityLevel(ost.LogLevel.Error)
+ self.assertEqual([str(r) for r in sc.rmsd_details["D"][1]["bs_ref_res"]], expected_bs_ref_res)
+ ost.PopVerbosityLevel()
+
+ def test_unassigned_reasons(self):
+ """Test reasons for being unassigned."""
+ trg = _LoadMMCIF("1r8q.cif.gz")
+ mdl = _LoadMMCIF("P84080_model_02.cif.gz")
+
+ def _AppendResidueWithBonds(ed, chain, old_res):
+ new_res = ed.AppendResidue(chain, old_res.name)
+ for old_atom in old_res.atoms:
+ ed.InsertAtom(new_res, old_atom.name, old_atom.pos, old_atom.element,
+ old_atom.occupancy, old_atom.b_factor, old_atom.is_hetatom)
+ for old_bond in old_atom.bonds:
+ new_first = new_res.FindAtom(old_bond.first.name)
+ new_second = new_res.FindAtom(old_bond.second.name)
+ ed.Connect(new_first, new_second)
+ return new_res
+
+ # Add interesting ligands to model and target
+ mdl_ed = mdl.EditXCS()
+ trg_ed = trg.EditXCS()
+
+ # Add ZN: representation in the model (chain missing in model)
+ new_chain = mdl_ed.InsertChain("L_ZN")
+ mdl_ed.SetChainType(new_chain, mol.ChainType.CHAINTYPE_NON_POLY)
+ new_res = _AppendResidueWithBonds(mdl_ed, new_chain, trg.Select("rname=ZN").residues[0].handle)
+ new_res.is_ligand = True
+
+ # Add NA: not in contact with target
+ new_chain = trg_ed.InsertChain("L_NA")
+ trg_ed.SetChainType(new_chain, mol.ChainType.CHAINTYPE_NON_POLY)
+ new_res = trg_ed.AppendResidue(new_chain, "NA")
+ new_atom = trg_ed.InsertAtom(new_res, "NA", geom.Vec3(100, 100, 100), "NA")
+ new_res.is_ligand = True
+ new_chain = mdl_ed.InsertChain("L_NA")
+ mdl_ed.SetChainType(new_chain, mol.ChainType.CHAINTYPE_NON_POLY)
+ new_res = mdl_ed.AppendResidue(new_chain, "NA")
+ new_atom = mdl_ed.InsertAtom(new_res, "NA", geom.Vec3(100, 100, 100), "NA")
+ new_res.is_ligand = True
+
+ # Add OXY: no symmetry/ not identical -
+ new_chain = mdl_ed.InsertChain("L_OXY")
+ mdl_ed.SetChainType(new_chain, mol.ChainType.CHAINTYPE_NON_POLY)
+ new_res = mdl_ed.AppendResidue(new_chain, "OXY")
+ new_atom1 = mdl_ed.InsertAtom(new_res, "O1", geom.Vec3(0, 0, 0), "O")
+ new_atom2 = mdl_ed.InsertAtom(new_res, "O2", geom.Vec3(1, 1, 1), "O")
+ mdl_ed.Connect(new_atom1, new_atom2)
+ new_res.is_ligand = True
+
+ # Add CMO: disconnected
+ new_chain = mdl_ed.InsertChain("L_CMO")
+ mdl_ed.SetChainType(new_chain, mol.ChainType.CHAINTYPE_NON_POLY)
+ new_res = mdl_ed.AppendResidue(new_chain, "CMO")
+ new_atom1 = mdl_ed.InsertAtom(new_res, "O", geom.Vec3(0, 0, 0), "O")
+ new_atom2 = mdl_ed.InsertAtom(new_res, "C", geom.Vec3(1, 1, 1), "O")
+ new_res.is_ligand = True
+ new_chain = trg_ed.InsertChain("L_CMO")
+ trg_ed.SetChainType(new_chain, mol.ChainType.CHAINTYPE_NON_POLY)
+ new_res = trg_ed.AppendResidue(new_chain, "CMO")
+ new_atom1 = trg_ed.InsertAtom(new_res, "O", geom.Vec3(0, 0, 0), "O")
+ new_atom2 = trg_ed.InsertAtom(new_res, "C", geom.Vec3(1, 1, 1), "O")
+ new_res.is_ligand = True
+
+ # Add 3 MG in model: assignment/stoichiometry
+ mg_pos = [
+ mdl.geometric_center,
+ mdl.geometric_center + 1,
+ mdl.geometric_center + 100
+ ]
+ for i in range(3):
+ new_chain = mdl_ed.InsertChain("L_MG_%d" % i)
+ mdl_ed.SetChainType(new_chain, mol.ChainType.CHAINTYPE_NON_POLY)
+ new_res = mdl_ed.AppendResidue(new_chain, "MG")
+ new_atom = mdl_ed.InsertAtom(new_res, "MG", mg_pos[i], "MG")
+ new_res.is_ligand = True
+
+ mdl_ed.UpdateICS()
+ trg_ed.UpdateICS()
+
+ sc = LigandScorer(mdl, trg, None, None, unassigned=True)
+
+ # Check unassigned targets
+ # NA: not in contact with target
+ trg_na = sc.target.FindResidue("L_NA", 1)
+ self.assertEqual(sc.unassigned_target_ligands["L_NA"][1], "binding_site")
+ # ZN: no representation
+ trg_zn = sc.target.FindResidue("H", 1)
+ self.assertEqual(sc.unassigned_target_ligands["H"][1], "model_representation")
+ # AFB: not identical to anything in the model
+ trg_afb = sc.target.FindResidue("G", 1)
+ self.assertEqual(sc.unassigned_target_ligands["G"][1], "identity")
+ # F.G3D1: J.G3D1 assigned instead
+ trg_fg3d1 = sc.target.FindResidue("F", 1)
+ self.assertEqual(sc.unassigned_target_ligands["F"][1], "stoichiometry")
+ # CMO: disconnected
+ trg_cmo1 = sc.target.FindResidue("L_CMO", 1)
+ self.assertEqual(sc.unassigned_target_ligands["L_CMO"][1], "disconnected")
+ # J.G3D1: assigned to L_2.G3D1 => error
+ trg_jg3d1 = sc.target.FindResidue("J", 1)
+ with self.assertRaises(RuntimeError):
+ sc._find_unassigned_target_ligand_reason(trg_jg3d1)
+ self.assertNotIn("J", sc.unassigned_target_ligands)
+ # Raises with an invalid ligand
+ with self.assertRaises(ValueError):
+ sc._find_unassigned_target_ligand_reason(sc.model_ligands[0])
+
+ # Check unassigned models
+ # OXY: not identical to anything in the model
+ mdl_oxy = sc.model.FindResidue("L_OXY", 1)
+ self.assertEqual(sc.unassigned_model_ligands["L_OXY"][1], "identity")
+ self.assertIsNone(sc.lddt_pli["L_OXY"][1])
+ # NA: not in contact with target
+ mdl_na = sc.model.FindResidue("L_NA", 1)
+ self.assertEqual(sc.unassigned_model_ligands["L_NA"][1], "binding_site")
+ self.assertIsNone(sc.lddt_pli["L_NA"][1])
+ # ZN: no representation
+ mdl_zn = sc.model.FindResidue("L_ZN", 1)
+ self.assertEqual(sc.unassigned_model_ligands["L_ZN"][1], "model_representation")
+ self.assertIsNone(sc.lddt_pli["L_ZN"][1])
+ # MG in L_MG_2 has stupid coordinates and is not assigned
+ mdl_mg_2 = sc.model.FindResidue("L_MG_2", 1)
+ self.assertEqual(sc.unassigned_model_ligands["L_MG_2"][1], "stoichiometry")
+ self.assertIsNone(sc.lddt_pli["L_MG_2"][1])
+ # MG in L_MG_0: assigned to I.MG1 => error
+ mdl_mg_0 = sc.model.FindResidue("L_MG_0", 1)
+ with self.assertRaises(RuntimeError):
+ sc._find_unassigned_model_ligand_reason(mdl_mg_0)
+ self.assertNotIn("L_MG_0", sc.unassigned_model_ligands)
+ # CMO: disconnected
+ mdl_cmo1 = sc.model.FindResidue("L_CMO", 1)
+ self.assertEqual(sc.unassigned_model_ligands["L_CMO"][1], "disconnected")
+ # Raises with an invalid ligand
+ with self.assertRaises(ValueError):
+ sc._find_unassigned_model_ligand_reason(sc.target_ligands[0])
+
+ # Should work with rmsd_assignment too
+ sc = LigandScorer(mdl, trg, None, None, unassigned=True,
+ rmsd_assignment=True)
+ self.assertEqual(sc.unassigned_model_ligands, {
+ 'L_ZN': {1: 'model_representation'},
+ 'L_NA': {1: 'binding_site'},
+ 'L_OXY': {1: 'identity'},
+ 'L_MG_2': {1: 'stoichiometry'},
+ "L_CMO": {1: 'disconnected'}
+ })
+ self.assertEqual(sc.unassigned_target_ligands, {
+ 'G': {1: 'identity'},
+ 'H': {1: 'model_representation'},
+ 'J': {1: 'stoichiometry'},
+ 'K': {1: 'identity'},
+ 'L_NA': {1: 'binding_site'},
+ "L_CMO": {1: 'disconnected'}
+ })
+ self.assertIsNone(sc.lddt_pli["L_OXY"][1])
+
+ # With missing ligands
+ sc = LigandScorer(mdl.Select("cname=A"), trg, None, None)
+ self.assertEqual(sc.unassigned_target_ligands["E"][1], 'no_ligand')
+
+ sc = LigandScorer(mdl, trg.Select("cname=A"), None, None)
+ self.assertEqual(sc.unassigned_model_ligands["L_2"][1], 'no_ligand')
+
+ sc = LigandScorer(mdl.Select("cname=A"), trg, None, None,
+ unassigned=True, rmsd_assignment=True)
+ self.assertEqual(sc.unassigned_target_ligands["E"][1], 'no_ligand')
+
+ sc = LigandScorer(mdl, trg.Select("cname=A"), None, None,
+ unassigned=True, rmsd_assignment=True)
+ self.assertEqual(sc.unassigned_model_ligands["L_2"][1], 'no_ligand')
+
+ # However not everything must be missing
+ with self.assertRaises(ValueError):
+ sc = LigandScorer(mdl.Select("cname=A"), trg.Select("cname=A"), None, None,
+ unassigned=True, rmsd_assignment=True)
+
+
+ def test_substructure_match(self):
+ """Test that substructure_match=True works."""
+ trg = _LoadMMCIF("1r8q.cif.gz")
+ mdl = _LoadMMCIF("P84080_model_02.cif.gz")
+
+ trg_g3d1 = trg.FindResidue("F", 1)
+ mdl_g3d = mdl.FindResidue("L_2", 1)
+
+ # Skip PA, PB and O[1-3]A and O[1-3]B in target and model
+ # ie 8 / 32 atoms => coverage 0.75
+ # We assume atom index are fixed and won't change
+ trg_g3d1_sub_ent = trg_g3d1.Select("aindex>6019")
+ trg_g3d1_sub = trg_g3d1_sub_ent.residues[0]
+
+ # Substructure matches
+ sc = LigandScorer(mdl.Select("protein=True"), trg.Select("protein=True"),
+ model_ligands=[mdl_g3d], target_ligands=[trg_g3d1_sub],
+ substructure_match=True)
+ self.assertEqual(sc.rmsd_details["L_2"][1]["coverage"], 0.75)
+
+ def test_6jyf(self):
+ """6JYF initially caused issues in the CASP15-CAMEO/LIGATE paper where
+ the ligand RET was wrongly assigned to short copies of OLA that float
+ around and yielded higher scores.
+ Here we test that this is resolved correctly."""
+ mdl = _LoadPDB("6jyf_mdl.pdb")
+ trg = _LoadMMCIF("6jyf_trg.cif")
+ mdl_lig = _LoadEntity("6jyf_RET_pred.sdf")
+ mdl_lig_full = _LoadEntity("6jyf_RET_pred_complete.sdf")
+
+ # Problem is easily fixed by just prioritizing full coverage
+ sc = LigandScorer(mdl, trg, model_ligands=[mdl_lig],
+ substructure_match=True)
+ self.assertEqual(sc.rmsd_details['00001_'][1]["coverage"], 1.0)
+ self.assertEqual(sc.rmsd_details['00001_'][1]["target_ligand"].name, "RET")
+ self.assertAlmostEqual(sc.rmsd['00001_'][1], 15.56022, 4)
+ self.assertTrue(np.array_equal(sc.coverage_matrix,
+ np.array([[1, 0, 0, 0, 0, 0, 0, 0, 0.5, 0.3, 0.45, 0, 0, 0.55]]).transpose()))
+
+ # We need to make sure that it also works if the match is partial.
+ # For that we load the complete ligand incl. the O missing in target
+ # with a coverage of around 95% only.
+ sc = LigandScorer(mdl, trg, model_ligands=[mdl_lig_full],
+ substructure_match=True)
+ self.assertTrue(sc.rmsd_details['00001_'][1]["coverage"] > 0.95)
+ self.assertEqual(sc.rmsd_details['00001_'][1]["target_ligand"].name, "RET")
+ self.assertAlmostEqual(sc.rmsd['00001_'][1], 15.56022, 4)
+
+ # Next, we check that coverage_delta has an effect. With a large
+ # delta of 0.5 we will assign to OLA which has a higher RMSD
+ # but a coverage of 0.52 only.
+ sc = LigandScorer(mdl, trg, model_ligands=[mdl_lig_full],
+ substructure_match=True,
+ coverage_delta=0.5)
+ self.assertTrue(sc.rmsd_details['00001_'][1]["coverage"] > 0.5)
+ self.assertEqual(sc.rmsd_details['00001_'][1]["target_ligand"].name, "OLA")
+ self.assertAlmostEqual(sc.rmsd['00001_'][1], 6.13006878, 4)
+
+
if __name__ == "__main__":
diff --git a/modules/mol/alg/tests/testfiles/1SSP.cif.gz b/modules/mol/alg/tests/testfiles/1SSP.cif.gz
new file mode 100644
index 0000000000000000000000000000000000000000..be272f4d8a027f58f99e3256ed0ca63e88a7f8c0
Binary files /dev/null and b/modules/mol/alg/tests/testfiles/1SSP.cif.gz differ
diff --git a/modules/mol/alg/tests/testfiles/1out.cif.gz b/modules/mol/alg/tests/testfiles/1out.cif.gz
new file mode 100644
index 0000000000000000000000000000000000000000..753337af9ab9dc0eca11a4391f1e9e92f5148332
Binary files /dev/null and b/modules/mol/alg/tests/testfiles/1out.cif.gz differ
diff --git a/modules/mol/alg/tests/testfiles/6jyf_RET_pred.sdf b/modules/mol/alg/tests/testfiles/6jyf_RET_pred.sdf
new file mode 100644
index 0000000000000000000000000000000000000000..e04ccbcdd605174d8c7a84ed9c28e06baaa0442a
--- /dev/null
+++ b/modules/mol/alg/tests/testfiles/6jyf_RET_pred.sdf
@@ -0,0 +1,61 @@
+
+
+
+ 20 20 0 0 0 0 0 0 0 0999 V2000
+ 13.8295 -3.5306 13.6788 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 13.7323 -3.2277 12.3773 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 14.3774 -2.0607 11.7848 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 13.7720 -0.8472 11.7984 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 12.3815 -0.5798 12.3337 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 14.4296 0.3907 11.2323 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 15.9186 0.2384 10.9458 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 16.1958 -1.0970 10.2708 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 15.7663 -2.3026 11.1502 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 15.7821 -3.5486 10.2302 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 16.8164 -2.5134 12.2695 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 11.8643 -4.6608 14.5175 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 13.2073 -4.6659 14.3579 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 14.1080 -5.7880 14.8268 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 10.5307 -6.7246 14.4431 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 11.0612 -5.6971 15.1271 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 7.5207 -8.5561 16.0576 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 8.4741 -7.5657 15.4682 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 9.7333 -7.7894 15.0373 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 10.4392 -9.1191 15.0837 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 17 18 1 0 0 0
+ 18 19 2 0 0 0
+ 19 20 1 0 0 0
+ 19 15 1 0 0 0
+ 15 16 2 0 0 0
+ 16 12 1 0 0 0
+ 12 13 2 0 0 0
+ 13 14 1 0 0 0
+ 13 1 1 0 0 0
+ 1 2 2 0 0 0
+ 2 3 1 0 0 0
+ 3 4 2 0 0 0
+ 4 5 1 0 0 0
+ 4 6 1 0 0 0
+ 6 7 1 0 0 0
+ 7 8 1 0 0 0
+ 8 9 1 0 0 0
+ 9 10 1 0 0 0
+ 9 11 1 0 0 0
+ 9 3 1 0 0 0
+M END
+> <minimizedAffinity>
+-5.97225
+
+> <CNNscore>
+0.7663099170
+
+> <CNNaffinity>
+5.3031663895
+
+> <CNN_VS>
+4.0638689995
+
+> <CNNaffinity_variance>
+0.3327504694
+
+$$$$
diff --git a/modules/mol/alg/tests/testfiles/6jyf_RET_pred_complete.sdf b/modules/mol/alg/tests/testfiles/6jyf_RET_pred_complete.sdf
new file mode 100644
index 0000000000000000000000000000000000000000..526045c3f3c390578ea7ba07a511b42c8c5be6a6
--- /dev/null
+++ b/modules/mol/alg/tests/testfiles/6jyf_RET_pred_complete.sdf
@@ -0,0 +1,63 @@
+
+
+
+ 21 21 0 0 0 0 0 0 0 0999 V2000
+ 13.8295 -3.5306 13.6788 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 13.7323 -3.2277 12.3773 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 14.3774 -2.0607 11.7848 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 13.7720 -0.8472 11.7984 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 12.3815 -0.5798 12.3337 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 14.4296 0.3907 11.2323 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 15.9186 0.2384 10.9458 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 16.1958 -1.0970 10.2708 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 15.7663 -2.3026 11.1502 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 15.7821 -3.5486 10.2302 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 16.8164 -2.5134 12.2695 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 11.8643 -4.6608 14.5175 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 13.2073 -4.6659 14.3579 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 14.1080 -5.7880 14.8268 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 10.5307 -6.7246 14.4431 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 11.0612 -5.6971 15.1271 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 7.5207 -8.5561 16.0576 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 8.4741 -7.5657 15.4682 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 9.7333 -7.7894 15.0373 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 10.4392 -9.1191 15.0837 C 0 0 0 0 0 0 0 0 0 0 0 0
+ 6.5207 -8.5561 16.0576 O 0 0 0 0 0 0 0 0 0 0 0 0
+ 17 18 1 0 0 0
+ 17 21 2 0 0 0
+ 18 19 2 0 0 0
+ 19 20 1 0 0 0
+ 19 15 1 0 0 0
+ 15 16 2 0 0 0
+ 16 12 1 0 0 0
+ 12 13 2 0 0 0
+ 13 14 1 0 0 0
+ 13 1 1 0 0 0
+ 1 2 2 0 0 0
+ 2 3 1 0 0 0
+ 3 4 2 0 0 0
+ 4 5 1 0 0 0
+ 4 6 1 0 0 0
+ 6 7 1 0 0 0
+ 7 8 1 0 0 0
+ 8 9 1 0 0 0
+ 9 10 1 0 0 0
+ 9 11 1 0 0 0
+ 9 3 1 0 0 0
+M END
+> <minimizedAffinity>
+-5.97225
+
+> <CNNscore>
+0.7663099170
+
+> <CNNaffinity>
+5.3031663895
+
+> <CNN_VS>
+4.0638689995
+
+> <CNNaffinity_variance>
+0.3327504694
+
+$$$$
diff --git a/modules/mol/alg/tests/testfiles/6jyf_mdl.pdb b/modules/mol/alg/tests/testfiles/6jyf_mdl.pdb
new file mode 100644
index 0000000000000000000000000000000000000000..11b79afcafde44b19a7b41b304c2aff44340ff9d
--- /dev/null
+++ b/modules/mol/alg/tests/testfiles/6jyf_mdl.pdb
@@ -0,0 +1,4643 @@
+ATOM 1 N MET A 1 31.934 35.198 -32.949 1.00 42.23 N
+ATOM 2 H MET A 1 31.100 34.720 -33.260 1.00 42.23 H
+ATOM 3 H2 MET A 1 31.659 35.878 -32.256 1.00 42.23 H
+ATOM 4 H3 MET A 1 32.371 35.668 -33.730 1.00 42.23 H
+ATOM 5 CA MET A 1 32.869 34.239 -32.319 1.00 42.23 C
+ATOM 6 HA MET A 1 33.077 33.424 -33.012 1.00 42.23 H
+ATOM 7 C MET A 1 32.165 33.653 -31.110 1.00 42.23 C
+ATOM 8 CB MET A 1 34.200 34.894 -31.933 1.00 42.23 C
+ATOM 9 HB2 MET A 1 34.017 35.824 -31.396 1.00 42.23 H
+ATOM 10 HB3 MET A 1 34.746 34.218 -31.274 1.00 42.23 H
+ATOM 11 O MET A 1 31.530 34.406 -30.386 1.00 42.23 O
+ATOM 12 CG MET A 1 35.073 35.165 -33.163 1.00 42.23 C
+ATOM 13 HG2 MET A 1 35.249 34.230 -33.695 1.00 42.23 H
+ATOM 14 HG3 MET A 1 34.550 35.853 -33.827 1.00 42.23 H
+ATOM 15 SD MET A 1 36.671 35.893 -32.735 1.00 42.23 S
+ATOM 16 CE MET A 1 37.297 36.313 -34.384 1.00 42.23 C
+ATOM 17 HE1 MET A 1 38.279 36.776 -34.289 1.00 42.23 H
+ATOM 18 HE2 MET A 1 36.618 37.013 -34.872 1.00 42.23 H
+ATOM 19 HE3 MET A 1 37.386 35.409 -34.985 1.00 42.23 H
+ATOM 20 N ALA A 2 32.155 32.325 -31.019 1.00 37.20 N
+ATOM 21 H ALA A 2 32.808 31.794 -31.577 1.00 37.20 H
+ATOM 22 CA ALA A 2 31.196 31.513 -30.276 1.00 37.20 C
+ATOM 23 HA ALA A 2 30.199 31.715 -30.666 1.00 37.20 H
+ATOM 24 C ALA A 2 31.165 31.757 -28.756 1.00 37.20 C
+ATOM 25 CB ALA A 2 31.537 30.049 -30.584 1.00 37.20 C
+ATOM 26 HB1 ALA A 2 32.530 29.806 -30.207 1.00 37.20 H
+ATOM 27 HB2 ALA A 2 31.496 29.864 -31.657 1.00 37.20 H
+ATOM 28 HB3 ALA A 2 30.813 29.398 -30.093 1.00 37.20 H
+ATOM 29 O ALA A 2 32.206 31.798 -28.105 1.00 37.20 O
+ATOM 30 N SER A 3 29.948 31.840 -28.210 1.00 35.53 N
+ATOM 31 H SER A 3 29.140 31.797 -28.815 1.00 35.53 H
+ATOM 32 CA SER A 3 29.658 31.684 -26.786 1.00 35.53 C
+ATOM 33 HA SER A 3 30.430 32.185 -26.202 1.00 35.53 H
+ATOM 34 C SER A 3 29.642 30.197 -26.429 1.00 35.53 C
+ATOM 35 CB SER A 3 28.301 32.319 -26.443 1.00 35.53 C
+ATOM 36 HB2 SER A 3 28.332 33.383 -26.678 1.00 35.53 H
+ATOM 37 HB3 SER A 3 28.113 32.206 -25.375 1.00 35.53 H
+ATOM 38 O SER A 3 28.874 29.430 -27.011 1.00 35.53 O
+ATOM 39 OG SER A 3 27.245 31.713 -27.165 1.00 35.53 O
+ATOM 40 HG SER A 3 27.285 30.762 -27.039 1.00 35.53 H
+ATOM 41 N MET A 4 30.460 29.790 -25.462 1.00 36.90 N
+ATOM 42 H MET A 4 31.081 30.462 -25.034 1.00 36.90 H
+ATOM 43 CA MET A 4 30.360 28.473 -24.836 1.00 36.90 C
+ATOM 44 HA MET A 4 30.149 27.718 -25.593 1.00 36.90 H
+ATOM 45 C MET A 4 29.208 28.488 -23.825 1.00 36.90 C
+ATOM 46 CB MET A 4 31.681 28.103 -24.140 1.00 36.90 C
+ATOM 47 HB2 MET A 4 31.932 28.860 -23.397 1.00 36.90 H
+ATOM 48 HB3 MET A 4 31.538 27.155 -23.621 1.00 36.90 H
+ATOM 49 O MET A 4 29.343 29.036 -22.734 1.00 36.90 O
+ATOM 50 CG MET A 4 32.865 27.944 -25.097 1.00 36.90 C
+ATOM 51 HG2 MET A 4 32.599 27.246 -25.890 1.00 36.90 H
+ATOM 52 HG3 MET A 4 33.092 28.912 -25.544 1.00 36.90 H
+ATOM 53 SD MET A 4 34.344 27.326 -24.249 1.00 36.90 S
+ATOM 54 CE MET A 4 35.604 27.636 -25.510 1.00 36.90 C
+ATOM 55 HE1 MET A 4 35.649 28.703 -25.729 1.00 36.90 H
+ATOM 56 HE2 MET A 4 36.573 27.301 -25.142 1.00 36.90 H
+ATOM 57 HE3 MET A 4 35.354 27.086 -26.418 1.00 36.90 H
+ATOM 58 N THR A 5 28.072 27.890 -24.174 1.00 41.79 N
+ATOM 59 H THR A 5 27.952 27.559 -25.121 1.00 41.79 H
+ATOM 60 CA THR A 5 27.059 27.473 -23.197 1.00 41.79 C
+ATOM 61 HA THR A 5 27.045 28.169 -22.358 1.00 41.79 H
+ATOM 62 C THR A 5 27.450 26.100 -22.665 1.00 41.79 C
+ATOM 63 CB THR A 5 25.646 27.452 -23.801 1.00 41.79 C
+ATOM 64 HB THR A 5 24.992 26.843 -23.178 1.00 41.79 H
+ATOM 65 O THR A 5 27.275 25.090 -23.344 1.00 41.79 O
+ATOM 66 CG2 THR A 5 25.064 28.863 -23.877 1.00 41.79 C
+ATOM 67 HG21 THR A 5 24.973 29.278 -22.873 1.00 41.79 H
+ATOM 68 HG22 THR A 5 24.073 28.818 -24.329 1.00 41.79 H
+ATOM 69 HG23 THR A 5 25.706 29.502 -24.482 1.00 41.79 H
+ATOM 70 OG1 THR A 5 25.673 26.924 -25.108 1.00 41.79 O
+ATOM 71 HG1 THR A 5 25.827 25.980 -25.025 1.00 41.79 H
+ATOM 72 N GLY A 6 28.017 26.072 -21.458 1.00 33.33 N
+ATOM 73 H GLY A 6 28.185 26.949 -20.986 1.00 33.33 H
+ATOM 74 CA GLY A 6 28.202 24.846 -20.692 1.00 33.33 C
+ATOM 75 HA2 GLY A 6 28.719 24.100 -21.296 1.00 33.33 H
+ATOM 76 HA3 GLY A 6 28.796 25.049 -19.800 1.00 33.33 H
+ATOM 77 C GLY A 6 26.843 24.308 -20.256 1.00 33.33 C
+ATOM 78 O GLY A 6 26.211 24.873 -19.367 1.00 33.33 O
+ATOM 79 N GLY A 7 26.389 23.234 -20.900 1.00 33.89 N
+ATOM 80 H GLY A 7 26.926 22.870 -21.675 1.00 33.89 H
+ATOM 81 CA GLY A 7 25.265 22.444 -20.417 1.00 33.89 C
+ATOM 82 HA2 GLY A 7 24.396 23.082 -20.259 1.00 33.89 H
+ATOM 83 HA3 GLY A 7 25.009 21.672 -21.142 1.00 33.89 H
+ATOM 84 C GLY A 7 25.665 21.772 -19.109 1.00 33.89 C
+ATOM 85 O GLY A 7 26.513 20.882 -19.099 1.00 33.89 O
+ATOM 86 N GLN A 8 25.083 22.219 -17.998 1.00 33.14 N
+ATOM 87 H GLN A 8 24.439 22.994 -18.072 1.00 33.14 H
+ATOM 88 CA GLN A 8 25.091 21.456 -16.758 1.00 33.14 C
+ATOM 89 HA GLN A 8 26.115 21.239 -16.455 1.00 33.14 H
+ATOM 90 C GLN A 8 24.368 20.134 -17.034 1.00 33.14 C
+ATOM 91 CB GLN A 8 24.382 22.248 -15.641 1.00 33.14 C
+ATOM 92 HB2 GLN A 8 23.469 22.693 -16.038 1.00 33.14 H
+ATOM 93 HB3 GLN A 8 24.100 21.556 -14.848 1.00 33.14 H
+ATOM 94 O GLN A 8 23.146 20.115 -17.158 1.00 33.14 O
+ATOM 95 CG GLN A 8 25.266 23.337 -15.018 1.00 33.14 C
+ATOM 96 HG2 GLN A 8 26.136 22.867 -14.559 1.00 33.14 H
+ATOM 97 HG3 GLN A 8 25.614 24.016 -15.796 1.00 33.14 H
+ATOM 98 CD GLN A 8 24.516 24.159 -13.970 1.00 33.14 C
+ATOM 99 NE2 GLN A 8 25.096 24.415 -12.818 1.00 33.14 N
+ATOM 100 HE21 GLN A 8 24.537 24.946 -12.166 1.00 33.14 H
+ATOM 101 HE22 GLN A 8 26.010 24.044 -12.601 1.00 33.14 H
+ATOM 102 OE1 GLN A 8 23.402 24.607 -14.165 1.00 33.14 O
+ATOM 103 N GLN A 9 25.121 19.038 -17.148 1.00 36.61 N
+ATOM 104 H GLN A 9 26.126 19.139 -17.161 1.00 36.61 H
+ATOM 105 CA GLN A 9 24.569 17.694 -17.014 1.00 36.61 C
+ATOM 106 HA GLN A 9 23.782 17.533 -17.751 1.00 36.61 H
+ATOM 107 C GLN A 9 23.956 17.613 -15.611 1.00 36.61 C
+ATOM 108 CB GLN A 9 25.675 16.637 -17.208 1.00 36.61 C
+ATOM 109 HB2 GLN A 9 26.536 16.890 -16.589 1.00 36.61 H
+ATOM 110 HB3 GLN A 9 25.288 15.675 -16.873 1.00 36.61 H
+ATOM 111 O GLN A 9 24.684 17.487 -14.624 1.00 36.61 O
+ATOM 112 CG GLN A 9 26.124 16.484 -18.671 1.00 36.61 C
+ATOM 113 HG2 GLN A 9 26.559 17.420 -19.021 1.00 36.61 H
+ATOM 114 HG3 GLN A 9 25.250 16.263 -19.285 1.00 36.61 H
+ATOM 115 CD GLN A 9 27.152 15.367 -18.870 1.00 36.61 C
+ATOM 116 NE2 GLN A 9 27.400 14.956 -20.094 1.00 36.61 N
+ATOM 117 HE21 GLN A 9 28.062 14.198 -20.178 1.00 36.61 H
+ATOM 118 HE22 GLN A 9 26.857 15.302 -20.872 1.00 36.61 H
+ATOM 119 OE1 GLN A 9 27.764 14.851 -17.950 1.00 36.61 O
+ATOM 120 N MET A 10 22.634 17.781 -15.500 1.00 41.89 N
+ATOM 121 H MET A 10 22.097 17.965 -16.335 1.00 41.89 H
+ATOM 122 CA MET A 10 21.921 17.485 -14.260 1.00 41.89 C
+ATOM 123 HA MET A 10 22.331 18.099 -13.458 1.00 41.89 H
+ATOM 124 C MET A 10 22.209 16.020 -13.927 1.00 41.89 C
+ATOM 125 CB MET A 10 20.411 17.765 -14.380 1.00 41.89 C
+ATOM 126 HB2 MET A 10 20.041 17.489 -15.367 1.00 41.89 H
+ATOM 127 HB3 MET A 10 19.896 17.151 -13.642 1.00 41.89 H
+ATOM 128 O MET A 10 21.907 15.130 -14.715 1.00 41.89 O
+ATOM 129 CG MET A 10 20.077 19.231 -14.072 1.00 41.89 C
+ATOM 130 HG2 MET A 10 20.692 19.549 -13.230 1.00 41.89 H
+ATOM 131 HG3 MET A 10 20.339 19.853 -14.928 1.00 41.89 H
+ATOM 132 SD MET A 10 18.350 19.527 -13.591 1.00 41.89 S
+ATOM 133 CE MET A 10 17.632 20.046 -15.171 1.00 41.89 C
+ATOM 134 HE1 MET A 10 16.570 20.251 -15.038 1.00 41.89 H
+ATOM 135 HE2 MET A 10 17.752 19.249 -15.905 1.00 41.89 H
+ATOM 136 HE3 MET A 10 18.134 20.946 -15.527 1.00 41.89 H
+ATOM 137 N GLY A 11 22.911 15.799 -12.813 1.00 41.54 N
+ATOM 138 H GLY A 11 23.172 16.595 -12.249 1.00 41.54 H
+ATOM 139 CA GLY A 11 23.435 14.491 -12.435 1.00 41.54 C
+ATOM 140 HA2 GLY A 11 24.194 14.192 -13.158 1.00 41.54 H
+ATOM 141 HA3 GLY A 11 23.893 14.545 -11.448 1.00 41.54 H
+ATOM 142 C GLY A 11 22.329 13.443 -12.393 1.00 41.54 C
+ATOM 143 O GLY A 11 21.336 13.625 -11.691 1.00 41.54 O
+ATOM 144 N ARG A 12 22.516 12.358 -13.153 1.00 52.69 N
+ATOM 145 H ARG A 12 23.331 12.342 -13.749 1.00 52.69 H
+ATOM 146 CA ARG A 12 21.632 11.185 -13.165 1.00 52.69 C
+ATOM 147 HA ARG A 12 20.666 11.470 -13.582 1.00 52.69 H
+ATOM 148 C ARG A 12 21.416 10.697 -11.730 1.00 52.69 C
+ATOM 149 CB ARG A 12 22.250 10.062 -14.019 1.00 52.69 C
+ATOM 150 HB2 ARG A 12 21.602 9.188 -13.962 1.00 52.69 H
+ATOM 151 HB3 ARG A 12 23.219 9.791 -13.599 1.00 52.69 H
+ATOM 152 O ARG A 12 22.387 10.569 -10.982 1.00 52.69 O
+ATOM 153 CG ARG A 12 22.427 10.440 -15.499 1.00 52.69 C
+ATOM 154 HG2 ARG A 12 23.068 11.319 -15.575 1.00 52.69 H
+ATOM 155 HG3 ARG A 12 21.457 10.670 -15.940 1.00 52.69 H
+ATOM 156 CD ARG A 12 23.079 9.283 -16.267 1.00 52.69 C
+ATOM 157 HD2 ARG A 12 22.360 8.468 -16.350 1.00 52.69 H
+ATOM 158 HD3 ARG A 12 23.944 8.933 -15.704 1.00 52.69 H
+ATOM 159 NE ARG A 12 23.510 9.707 -17.612 1.00 52.69 N
+ATOM 160 HE ARG A 12 23.060 10.529 -17.988 1.00 52.69 H
+ATOM 161 NH1 ARG A 12 24.808 7.875 -18.103 1.00 52.69 N
+ATOM 162 HH11 ARG A 12 25.312 7.328 -18.786 1.00 52.69 H
+ATOM 163 HH12 ARG A 12 24.489 7.439 -17.249 1.00 52.69 H
+ATOM 164 NH2 ARG A 12 24.596 9.526 -19.598 1.00 52.69 N
+ATOM 165 HH21 ARG A 12 24.086 10.336 -19.920 1.00 52.69 H
+ATOM 166 HH22 ARG A 12 25.087 8.960 -20.275 1.00 52.69 H
+ATOM 167 CZ ARG A 12 24.306 9.037 -18.425 1.00 52.69 C
+ATOM 168 N ASP A 13 20.169 10.427 -11.348 1.00 55.82 N
+ATOM 169 H ASP A 13 19.417 10.552 -12.011 1.00 55.82 H
+ATOM 170 CA ASP A 13 19.854 9.856 -10.034 1.00 55.82 C
+ATOM 171 HA ASP A 13 20.158 10.582 -9.281 1.00 55.82 H
+ATOM 172 C ASP A 13 20.629 8.530 -9.851 1.00 55.82 C
+ATOM 173 CB ASP A 13 18.336 9.675 -9.898 1.00 55.82 C
+ATOM 174 HB2 ASP A 13 18.001 9.142 -10.787 1.00 55.82 H
+ATOM 175 HB3 ASP A 13 17.872 10.661 -9.915 1.00 55.82 H
+ATOM 176 O ASP A 13 20.465 7.599 -10.643 1.00 55.82 O
+ATOM 177 CG ASP A 13 17.857 8.930 -8.632 1.00 55.82 C
+ATOM 178 OD1 ASP A 13 18.693 8.429 -7.842 1.00 55.82 O
+ATOM 179 OD2 ASP A 13 16.626 8.853 -8.445 1.00 55.82 O
+ATOM 180 N PRO A 14 21.495 8.418 -8.828 1.00 56.76 N
+ATOM 181 CA PRO A 14 22.391 7.278 -8.651 1.00 56.76 C
+ATOM 182 HA PRO A 14 23.005 7.167 -9.545 1.00 56.76 H
+ATOM 183 C PRO A 14 21.679 5.939 -8.409 1.00 56.76 C
+ATOM 184 CB PRO A 14 23.287 7.663 -7.468 1.00 56.76 C
+ATOM 185 HB2 PRO A 14 24.180 8.163 -7.843 1.00 56.76 H
+ATOM 186 HB3 PRO A 14 23.566 6.803 -6.860 1.00 56.76 H
+ATOM 187 O PRO A 14 22.328 4.899 -8.516 1.00 56.76 O
+ATOM 188 CG PRO A 14 22.444 8.662 -6.678 1.00 56.76 C
+ATOM 189 HG2 PRO A 14 23.059 9.336 -6.082 1.00 56.76 H
+ATOM 190 HG3 PRO A 14 21.731 8.128 -6.049 1.00 56.76 H
+ATOM 191 CD PRO A 14 21.699 9.401 -7.777 1.00 56.76 C
+ATOM 192 HD2 PRO A 14 20.757 9.785 -7.385 1.00 56.76 H
+ATOM 193 HD3 PRO A 14 22.311 10.217 -8.161 1.00 56.76 H
+ATOM 194 N ASN A 15 20.381 5.926 -8.078 1.00 57.60 N
+ATOM 195 H ASN A 15 19.892 6.807 -8.014 1.00 57.60 H
+ATOM 196 CA ASN A 15 19.606 4.689 -7.912 1.00 57.60 C
+ATOM 197 HA ASN A 15 20.259 3.902 -7.536 1.00 57.60 H
+ATOM 198 C ASN A 15 19.019 4.151 -9.222 1.00 57.60 C
+ATOM 199 CB ASN A 15 18.500 4.933 -6.881 1.00 57.60 C
+ATOM 200 HB2 ASN A 15 17.945 5.829 -7.157 1.00 57.60 H
+ATOM 201 HB3 ASN A 15 17.807 4.091 -6.884 1.00 57.60 H
+ATOM 202 O ASN A 15 18.431 3.067 -9.240 1.00 57.60 O
+ATOM 203 CG ASN A 15 19.022 5.076 -5.468 1.00 57.60 C
+ATOM 204 ND2 ASN A 15 18.209 5.636 -4.607 1.00 57.60 N
+ATOM 205 HD21 ASN A 15 17.356 6.055 -4.948 1.00 57.60 H
+ATOM 206 HD22 ASN A 15 18.525 5.726 -3.652 1.00 57.60 H
+ATOM 207 OD1 ASN A 15 20.118 4.667 -5.103 1.00 57.60 O
+ATOM 208 N SER A 16 19.149 4.893 -10.315 1.00 58.54 N
+ATOM 209 H SER A 16 19.615 5.788 -10.269 1.00 58.54 H
+ATOM 210 CA SER A 16 18.515 4.520 -11.566 1.00 58.54 C
+ATOM 211 HA SER A 16 17.547 4.071 -11.346 1.00 58.54 H
+ATOM 212 C SER A 16 19.300 3.556 -12.420 1.00 58.54 C
+ATOM 213 CB SER A 16 18.227 5.748 -12.345 1.00 58.54 C
+ATOM 214 HB2 SER A 16 17.384 5.434 -12.961 1.00 58.54 H
+ATOM 215 HB3 SER A 16 17.973 6.524 -11.623 1.00 58.54 H
+ATOM 216 O SER A 16 18.748 2.607 -12.951 1.00 58.54 O
+ATOM 217 OG SER A 16 19.266 6.261 -13.145 1.00 58.54 O
+ATOM 218 HG SER A 16 18.818 6.725 -13.856 1.00 58.54 H
+ATOM 219 N MET A 17 20.617 3.722 -12.428 1.00 76.92 N
+ATOM 220 H MET A 17 20.974 4.585 -12.042 1.00 76.92 H
+ATOM 221 CA MET A 17 21.547 2.767 -13.028 1.00 76.92 C
+ATOM 222 HA MET A 17 21.153 2.449 -13.993 1.00 76.92 H
+ATOM 223 C MET A 17 21.708 1.498 -12.175 1.00 76.92 C
+ATOM 224 CB MET A 17 22.896 3.459 -13.257 1.00 76.92 C
+ATOM 225 HB2 MET A 17 23.297 3.781 -12.296 1.00 76.92 H
+ATOM 226 HB3 MET A 17 23.588 2.744 -13.701 1.00 76.92 H
+ATOM 227 O MET A 17 22.487 0.616 -12.518 1.00 76.92 O
+ATOM 228 CG MET A 17 22.776 4.662 -14.203 1.00 76.92 C
+ATOM 229 HG2 MET A 17 22.297 4.325 -15.123 1.00 76.92 H
+ATOM 230 HG3 MET A 17 22.132 5.416 -13.750 1.00 76.92 H
+ATOM 231 SD MET A 17 24.354 5.449 -14.648 1.00 76.92 S
+ATOM 232 CE MET A 17 24.902 6.026 -13.018 1.00 76.92 C
+ATOM 233 HE1 MET A 17 24.122 6.638 -12.566 1.00 76.92 H
+ATOM 234 HE2 MET A 17 25.809 6.619 -13.131 1.00 76.92 H
+ATOM 235 HE3 MET A 17 25.113 5.171 -12.375 1.00 76.92 H
+ATOM 236 N LYS A 18 21.007 1.422 -11.036 1.00 91.99 N
+ATOM 237 H LYS A 18 20.369 2.180 -10.840 1.00 91.99 H
+ATOM 238 CA LYS A 18 21.016 0.277 -10.117 1.00 91.99 C
+ATOM 239 HA LYS A 18 21.882 -0.351 -10.325 1.00 91.99 H
+ATOM 240 C LYS A 18 19.813 -0.640 -10.283 1.00 91.99 C
+ATOM 241 CB LYS A 18 21.109 0.762 -8.670 1.00 91.99 C
+ATOM 242 HB2 LYS A 18 20.282 1.437 -8.449 1.00 91.99 H
+ATOM 243 HB3 LYS A 18 21.027 -0.101 -8.009 1.00 91.99 H
+ATOM 244 O LYS A 18 19.755 -1.655 -9.602 1.00 91.99 O
+ATOM 245 CG LYS A 18 22.441 1.456 -8.400 1.00 91.99 C
+ATOM 246 HG2 LYS A 18 23.259 0.787 -8.669 1.00 91.99 H
+ATOM 247 HG3 LYS A 18 22.515 2.367 -8.994 1.00 91.99 H
+ATOM 248 CD LYS A 18 22.529 1.790 -6.915 1.00 91.99 C
+ATOM 249 HD2 LYS A 18 21.697 2.433 -6.628 1.00 91.99 H
+ATOM 250 HD3 LYS A 18 22.485 0.862 -6.345 1.00 91.99 H
+ATOM 251 CE LYS A 18 23.851 2.494 -6.647 1.00 91.99 C
+ATOM 252 HE2 LYS A 18 24.653 1.879 -7.054 1.00 91.99 H
+ATOM 253 HE3 LYS A 18 23.845 3.451 -7.170 1.00 91.99 H
+ATOM 254 NZ LYS A 18 24.023 2.675 -5.192 1.00 91.99 N
+ATOM 255 HZ1 LYS A 18 23.254 3.222 -4.833 1.00 91.99 H
+ATOM 256 HZ2 LYS A 18 24.905 3.128 -4.999 1.00 91.99 H
+ATOM 257 HZ3 LYS A 18 24.015 1.763 -4.758 1.00 91.99 H
+ATOM 258 N ASN A 19 18.867 -0.285 -11.152 1.00 96.47 N
+ATOM 259 H ASN A 19 19.038 0.504 -11.759 1.00 96.47 H
+ATOM 260 CA ASN A 19 17.706 -1.109 -11.456 1.00 96.47 C
+ATOM 261 HA ASN A 19 17.725 -1.991 -10.816 1.00 96.47 H
+ATOM 262 C ASN A 19 17.766 -1.636 -12.891 1.00 96.47 C
+ATOM 263 CB ASN A 19 16.422 -0.357 -11.107 1.00 96.47 C
+ATOM 264 HB2 ASN A 19 15.572 -1.021 -11.263 1.00 96.47 H
+ATOM 265 HB3 ASN A 19 16.443 -0.104 -10.046 1.00 96.47 H
+ATOM 266 O ASN A 19 18.331 -0.987 -13.779 1.00 96.47 O
+ATOM 267 CG ASN A 19 16.202 0.896 -11.929 1.00 96.47 C
+ATOM 268 ND2 ASN A 19 16.187 2.041 -11.293 1.00 96.47 N
+ATOM 269 HD21 ASN A 19 16.004 2.816 -11.915 1.00 96.47 H
+ATOM 270 HD22 ASN A 19 16.707 2.119 -10.431 1.00 96.47 H
+ATOM 271 OD1 ASN A 19 16.031 0.882 -13.130 1.00 96.47 O
+ATOM 272 N ILE A 20 17.212 -2.832 -13.106 1.00 97.59 N
+ATOM 273 H ILE A 20 16.723 -3.287 -12.349 1.00 97.59 H
+ATOM 274 CA ILE A 20 17.299 -3.506 -14.404 1.00 97.59 C
+ATOM 275 HA ILE A 20 18.346 -3.497 -14.707 1.00 97.59 H
+ATOM 276 C ILE A 20 16.529 -2.753 -15.486 1.00 97.59 C
+ATOM 277 CB ILE A 20 16.856 -4.982 -14.349 1.00 97.59 C
+ATOM 278 HB ILE A 20 17.103 -5.414 -15.319 1.00 97.59 H
+ATOM 279 O ILE A 20 16.819 -2.946 -16.662 1.00 97.59 O
+ATOM 280 CG1 ILE A 20 15.330 -5.125 -14.160 1.00 97.59 C
+ATOM 281 HG12 ILE A 20 15.039 -4.703 -13.198 1.00 97.59 H
+ATOM 282 HG13 ILE A 20 14.820 -4.553 -14.935 1.00 97.59 H
+ATOM 283 CG2 ILE A 20 17.664 -5.763 -13.299 1.00 97.59 C
+ATOM 284 HG21 ILE A 20 18.728 -5.563 -13.425 1.00 97.59 H
+ATOM 285 HG22 ILE A 20 17.369 -5.481 -12.288 1.00 97.59 H
+ATOM 286 HG23 ILE A 20 17.513 -6.834 -13.439 1.00 97.59 H
+ATOM 287 CD1 ILE A 20 14.815 -6.563 -14.287 1.00 97.59 C
+ATOM 288 HD11 ILE A 20 15.215 -7.187 -13.489 1.00 97.59 H
+ATOM 289 HD12 ILE A 20 13.726 -6.564 -14.234 1.00 97.59 H
+ATOM 290 HD13 ILE A 20 15.116 -6.976 -15.250 1.00 97.59 H
+ATOM 291 N GLU A 21 15.567 -1.896 -15.116 1.00 97.93 N
+ATOM 292 H GLU A 21 15.344 -1.781 -14.138 1.00 97.93 H
+ATOM 293 CA GLU A 21 14.827 -1.096 -16.087 1.00 97.93 C
+ATOM 294 HA GLU A 21 14.319 -1.790 -16.757 1.00 97.93 H
+ATOM 295 C GLU A 21 15.773 -0.264 -16.964 1.00 97.93 C
+ATOM 296 CB GLU A 21 13.758 -0.214 -15.411 1.00 97.93 C
+ATOM 297 HB2 GLU A 21 14.186 0.418 -14.632 1.00 97.93 H
+ATOM 298 HB3 GLU A 21 13.369 0.456 -16.178 1.00 97.93 H
+ATOM 299 O GLU A 21 15.557 -0.191 -18.169 1.00 97.93 O
+ATOM 300 CG GLU A 21 12.554 -0.996 -14.859 1.00 97.93 C
+ATOM 301 HG2 GLU A 21 12.332 -1.780 -15.583 1.00 97.93 H
+ATOM 302 HG3 GLU A 21 11.698 -0.321 -14.828 1.00 97.93 H
+ATOM 303 CD GLU A 21 12.691 -1.655 -13.474 1.00 97.93 C
+ATOM 304 OE1 GLU A 21 11.685 -2.238 -12.981 1.00 97.93 O
+ATOM 305 OE2 GLU A 21 13.759 -1.591 -12.837 1.00 97.93 O
+ATOM 306 N SER A 22 16.865 0.260 -16.397 1.00 96.52 N
+ATOM 307 H SER A 22 16.981 0.132 -15.402 1.00 96.52 H
+ATOM 308 CA SER A 22 17.875 1.047 -17.120 1.00 96.52 C
+ATOM 309 HA SER A 22 17.354 1.816 -17.689 1.00 96.52 H
+ATOM 310 C SER A 22 18.739 0.272 -18.129 1.00 96.52 C
+ATOM 311 CB SER A 22 18.790 1.744 -16.108 1.00 96.52 C
+ATOM 312 HB2 SER A 22 19.407 2.472 -16.635 1.00 96.52 H
+ATOM 313 HB3 SER A 22 18.174 2.275 -15.381 1.00 96.52 H
+ATOM 314 O SER A 22 19.491 0.895 -18.878 1.00 96.52 O
+ATOM 315 OG SER A 22 19.639 0.826 -15.435 1.00 96.52 O
+ATOM 316 HG SER A 22 19.110 0.254 -14.874 1.00 96.52 H
+ATOM 317 N LEU A 23 18.676 -1.066 -18.151 1.00 96.79 N
+ATOM 318 H LEU A 23 17.992 -1.523 -17.566 1.00 96.79 H
+ATOM 319 CA LEU A 23 19.560 -1.908 -18.972 1.00 96.79 C
+ATOM 320 HA LEU A 23 20.519 -1.404 -19.091 1.00 96.79 H
+ATOM 321 C LEU A 23 19.036 -2.165 -20.389 1.00 96.79 C
+ATOM 322 CB LEU A 23 19.791 -3.260 -18.272 1.00 96.79 C
+ATOM 323 HB2 LEU A 23 20.430 -3.868 -18.912 1.00 96.79 H
+ATOM 324 HB3 LEU A 23 18.831 -3.771 -18.192 1.00 96.79 H
+ATOM 325 O LEU A 23 19.768 -2.728 -21.207 1.00 96.79 O
+ATOM 326 CG LEU A 23 20.432 -3.200 -16.878 1.00 96.79 C
+ATOM 327 HG LEU A 23 19.783 -2.653 -16.194 1.00 96.79 H
+ATOM 328 CD1 LEU A 23 20.597 -4.634 -16.364 1.00 96.79 C
+ATOM 329 HD11 LEU A 23 21.252 -5.197 -17.029 1.00 96.79 H
+ATOM 330 HD12 LEU A 23 21.023 -4.622 -15.361 1.00 96.79 H
+ATOM 331 HD13 LEU A 23 19.622 -5.119 -16.326 1.00 96.79 H
+ATOM 332 CD2 LEU A 23 21.804 -2.523 -16.901 1.00 96.79 C
+ATOM 333 HD21 LEU A 23 22.454 -3.012 -17.625 1.00 96.79 H
+ATOM 334 HD22 LEU A 23 21.685 -1.471 -17.164 1.00 96.79 H
+ATOM 335 HD23 LEU A 23 22.252 -2.572 -15.908 1.00 96.79 H
+ATOM 336 N PHE A 24 17.776 -1.830 -20.669 1.00 97.83 N
+ATOM 337 H PHE A 24 17.247 -1.302 -19.989 1.00 97.83 H
+ATOM 338 CA PHE A 24 17.083 -2.282 -21.872 1.00 97.83 C
+ATOM 339 HA PHE A 24 17.799 -2.771 -22.533 1.00 97.83 H
+ATOM 340 C PHE A 24 16.472 -1.129 -22.660 1.00 97.83 C
+ATOM 341 CB PHE A 24 16.006 -3.316 -21.503 1.00 97.83 C
+ATOM 342 HB2 PHE A 24 15.178 -2.794 -21.022 1.00 97.83 H
+ATOM 343 HB3 PHE A 24 15.623 -3.755 -22.424 1.00 97.83 H
+ATOM 344 O PHE A 24 15.945 -0.178 -22.087 1.00 97.83 O
+ATOM 345 CG PHE A 24 16.480 -4.435 -20.592 1.00 97.83 C
+ATOM 346 CD1 PHE A 24 17.517 -5.292 -21.005 1.00 97.83 C
+ATOM 347 HD1 PHE A 24 17.964 -5.164 -21.980 1.00 97.83 H
+ATOM 348 CD2 PHE A 24 15.930 -4.577 -19.305 1.00 97.83 C
+ATOM 349 HD2 PHE A 24 15.158 -3.901 -18.969 1.00 97.83 H
+ATOM 350 CE1 PHE A 24 18.023 -6.264 -20.125 1.00 97.83 C
+ATOM 351 HE1 PHE A 24 18.849 -6.892 -20.428 1.00 97.83 H
+ATOM 352 CE2 PHE A 24 16.427 -5.558 -18.429 1.00 97.83 C
+ATOM 353 HE2 PHE A 24 16.025 -5.639 -17.430 1.00 97.83 H
+ATOM 354 CZ PHE A 24 17.488 -6.385 -18.832 1.00 97.83 C
+ATOM 355 HZ PHE A 24 17.904 -7.108 -18.146 1.00 97.83 H
+ATOM 356 N ASP A 25 16.465 -1.289 -23.980 1.00 98.17 N
+ATOM 357 H ASP A 25 16.955 -2.076 -24.380 1.00 98.17 H
+ATOM 358 CA ASP A 25 15.539 -0.575 -24.849 1.00 98.17 C
+ATOM 359 HA ASP A 25 15.363 0.423 -24.447 1.00 98.17 H
+ATOM 360 C ASP A 25 14.210 -1.334 -24.904 1.00 98.17 C
+ATOM 361 CB ASP A 25 16.108 -0.429 -26.263 1.00 98.17 C
+ATOM 362 HB2 ASP A 25 15.372 0.087 -26.880 1.00 98.17 H
+ATOM 363 HB3 ASP A 25 16.262 -1.421 -26.685 1.00 98.17 H
+ATOM 364 O ASP A 25 14.171 -2.567 -24.828 1.00 98.17 O
+ATOM 365 CG ASP A 25 17.415 0.358 -26.329 1.00 98.17 C
+ATOM 366 OD1 ASP A 25 17.614 1.268 -25.493 1.00 98.17 O
+ATOM 367 OD2 ASP A 25 18.178 0.058 -27.274 1.00 98.17 O
+ATOM 368 N TYR A 26 13.116 -0.604 -25.091 1.00 98.63 N
+ATOM 369 H TYR A 26 13.225 0.398 -25.159 1.00 98.63 H
+ATOM 370 CA TYR A 26 11.771 -1.172 -25.093 1.00 98.63 C
+ATOM 371 HA TYR A 26 11.829 -2.233 -24.851 1.00 98.63 H
+ATOM 372 C TYR A 26 11.135 -1.060 -26.473 1.00 98.63 C
+ATOM 373 CB TYR A 26 10.920 -0.524 -23.993 1.00 98.63 C
+ATOM 374 HB2 TYR A 26 9.911 -0.933 -24.037 1.00 98.63 H
+ATOM 375 HB3 TYR A 26 10.852 0.550 -24.169 1.00 98.63 H
+ATOM 376 O TYR A 26 11.192 -0.022 -27.134 1.00 98.63 O
+ATOM 377 CG TYR A 26 11.485 -0.748 -22.606 1.00 98.63 C
+ATOM 378 CD1 TYR A 26 11.077 -1.861 -21.845 1.00 98.63 C
+ATOM 379 HD1 TYR A 26 10.323 -2.532 -22.229 1.00 98.63 H
+ATOM 380 CD2 TYR A 26 12.485 0.113 -22.116 1.00 98.63 C
+ATOM 381 HD2 TYR A 26 12.826 0.953 -22.703 1.00 98.63 H
+ATOM 382 CE1 TYR A 26 11.675 -2.118 -20.596 1.00 98.63 C
+ATOM 383 HE1 TYR A 26 11.377 -2.971 -20.006 1.00 98.63 H
+ATOM 384 CE2 TYR A 26 13.103 -0.164 -20.886 1.00 98.63 C
+ATOM 385 HE2 TYR A 26 13.924 0.444 -20.536 1.00 98.63 H
+ATOM 386 OH TYR A 26 13.296 -1.503 -18.934 1.00 98.63 O
+ATOM 387 HH TYR A 26 14.045 -0.914 -18.822 1.00 98.63 H
+ATOM 388 CZ TYR A 26 12.700 -1.271 -20.125 1.00 98.63 C
+ATOM 389 N SER A 27 10.461 -2.121 -26.914 1.00 98.61 N
+ATOM 390 H SER A 27 10.448 -2.952 -26.341 1.00 98.61 H
+ATOM 391 CA SER A 27 9.521 -1.989 -28.032 1.00 98.61 C
+ATOM 392 HA SER A 27 10.050 -1.556 -28.881 1.00 98.61 H
+ATOM 393 C SER A 27 8.373 -1.047 -27.647 1.00 98.61 C
+ATOM 394 CB SER A 27 8.976 -3.354 -28.455 1.00 98.61 C
+ATOM 395 HB2 SER A 27 8.347 -3.232 -29.336 1.00 98.61 H
+ATOM 396 HB3 SER A 27 9.805 -4.016 -28.705 1.00 98.61 H
+ATOM 397 O SER A 27 8.036 -0.931 -26.467 1.00 98.61 O
+ATOM 398 OG SER A 27 8.209 -3.929 -27.416 1.00 98.61 O
+ATOM 399 HG SER A 27 8.828 -4.207 -26.737 1.00 98.61 H
+ATOM 400 N ALA A 28 7.717 -0.427 -28.635 1.00 98.48 N
+ATOM 401 H ALA A 28 8.060 -0.497 -29.583 1.00 98.48 H
+ATOM 402 CA ALA A 28 6.533 0.401 -28.380 1.00 98.48 C
+ATOM 403 HA ALA A 28 6.827 1.265 -27.784 1.00 98.48 H
+ATOM 404 C ALA A 28 5.467 -0.362 -27.569 1.00 98.48 C
+ATOM 405 CB ALA A 28 5.975 0.899 -29.719 1.00 98.48 C
+ATOM 406 HB1 ALA A 28 5.107 1.530 -29.530 1.00 98.48 H
+ATOM 407 HB2 ALA A 28 6.727 1.496 -30.236 1.00 98.48 H
+ATOM 408 HB3 ALA A 28 5.673 0.061 -30.346 1.00 98.48 H
+ATOM 409 O ALA A 28 4.942 0.160 -26.594 1.00 98.48 O
+ATOM 410 N GLY A 29 5.244 -1.644 -27.885 1.00 98.61 N
+ATOM 411 H GLY A 29 5.742 -2.035 -28.672 1.00 98.61 H
+ATOM 412 CA GLY A 29 4.294 -2.486 -27.157 1.00 98.61 C
+ATOM 413 HA2 GLY A 29 3.307 -2.025 -27.202 1.00 98.61 H
+ATOM 414 HA3 GLY A 29 4.245 -3.464 -27.636 1.00 98.61 H
+ATOM 415 C GLY A 29 4.651 -2.698 -25.682 1.00 98.61 C
+ATOM 416 O GLY A 29 3.773 -2.604 -24.831 1.00 98.61 O
+ATOM 417 N GLN A 30 5.922 -2.956 -25.353 1.00 98.76 N
+ATOM 418 H GLN A 30 6.624 -2.959 -26.080 1.00 98.76 H
+ATOM 419 CA GLN A 30 6.356 -3.108 -23.955 1.00 98.76 C
+ATOM 420 HA GLN A 30 5.703 -3.816 -23.444 1.00 98.76 H
+ATOM 421 C GLN A 30 6.267 -1.777 -23.199 1.00 98.76 C
+ATOM 422 CB GLN A 30 7.797 -3.633 -23.905 1.00 98.76 C
+ATOM 423 HB2 GLN A 30 8.178 -3.538 -22.888 1.00 98.76 H
+ATOM 424 HB3 GLN A 30 8.407 -2.999 -24.549 1.00 98.76 H
+ATOM 425 O GLN A 30 5.770 -1.740 -22.072 1.00 98.76 O
+ATOM 426 CG GLN A 30 7.929 -5.110 -24.324 1.00 98.76 C
+ATOM 427 HG2 GLN A 30 7.303 -5.313 -25.194 1.00 98.76 H
+ATOM 428 HG3 GLN A 30 7.588 -5.753 -23.514 1.00 98.76 H
+ATOM 429 CD GLN A 30 9.362 -5.475 -24.692 1.00 98.76 C
+ATOM 430 NE2 GLN A 30 9.819 -6.675 -24.416 1.00 98.76 N
+ATOM 431 HE21 GLN A 30 10.753 -6.900 -24.727 1.00 98.76 H
+ATOM 432 HE22 GLN A 30 9.249 -7.401 -24.006 1.00 98.76 H
+ATOM 433 OE1 GLN A 30 10.067 -4.688 -25.315 1.00 98.76 O
+ATOM 434 N PHE A 31 6.719 -0.692 -23.834 1.00 98.76 N
+ATOM 435 H PHE A 31 7.088 -0.794 -24.768 1.00 98.76 H
+ATOM 436 CA PHE A 31 6.739 0.640 -23.244 1.00 98.76 C
+ATOM 437 HA PHE A 31 7.271 0.589 -22.294 1.00 98.76 H
+ATOM 438 C PHE A 31 5.332 1.163 -22.934 1.00 98.76 C
+ATOM 439 CB PHE A 31 7.502 1.583 -24.177 1.00 98.76 C
+ATOM 440 HB2 PHE A 31 8.511 1.201 -24.331 1.00 98.76 H
+ATOM 441 HB3 PHE A 31 7.009 1.613 -25.148 1.00 98.76 H
+ATOM 442 O PHE A 31 5.046 1.526 -21.790 1.00 98.76 O
+ATOM 443 CG PHE A 31 7.590 2.983 -23.621 1.00 98.76 C
+ATOM 444 CD1 PHE A 31 6.621 3.940 -23.977 1.00 98.76 C
+ATOM 445 HD1 PHE A 31 5.840 3.692 -24.680 1.00 98.76 H
+ATOM 446 CD2 PHE A 31 8.593 3.304 -22.691 1.00 98.76 C
+ATOM 447 HD2 PHE A 31 9.325 2.567 -22.392 1.00 98.76 H
+ATOM 448 CE1 PHE A 31 6.682 5.232 -23.436 1.00 98.76 C
+ATOM 449 HE1 PHE A 31 5.954 5.976 -23.723 1.00 98.76 H
+ATOM 450 CE2 PHE A 31 8.625 4.583 -22.120 1.00 98.76 C
+ATOM 451 HE2 PHE A 31 9.348 4.814 -21.352 1.00 98.76 H
+ATOM 452 CZ PHE A 31 7.701 5.555 -22.529 1.00 98.76 C
+ATOM 453 HZ PHE A 31 7.775 6.562 -22.146 1.00 98.76 H
+ATOM 454 N GLU A 32 4.439 1.138 -23.926 1.00 98.69 N
+ATOM 455 H GLU A 32 4.739 0.838 -24.843 1.00 98.69 H
+ATOM 456 CA GLU A 32 3.051 1.583 -23.787 1.00 98.69 C
+ATOM 457 HA GLU A 32 3.024 2.597 -23.389 1.00 98.69 H
+ATOM 458 C GLU A 32 2.269 0.684 -22.824 1.00 98.69 C
+ATOM 459 CB GLU A 32 2.360 1.572 -25.160 1.00 98.69 C
+ATOM 460 HB2 GLU A 32 1.294 1.741 -25.010 1.00 98.69 H
+ATOM 461 HB3 GLU A 32 2.484 0.584 -25.602 1.00 98.69 H
+ATOM 462 O GLU A 32 1.436 1.164 -22.063 1.00 98.69 O
+ATOM 463 CG GLU A 32 2.881 2.647 -26.131 1.00 98.69 C
+ATOM 464 HG2 GLU A 32 2.607 3.628 -25.743 1.00 98.69 H
+ATOM 465 HG3 GLU A 32 3.969 2.601 -26.174 1.00 98.69 H
+ATOM 466 CD GLU A 32 2.315 2.482 -27.555 1.00 98.69 C
+ATOM 467 OE1 GLU A 32 2.865 3.127 -28.476 1.00 98.69 O
+ATOM 468 OE2 GLU A 32 1.344 1.706 -27.735 1.00 98.69 O
+ATOM 469 N PHE A 33 2.534 -0.627 -22.794 1.00 98.74 N
+ATOM 470 H PHE A 33 3.211 -1.007 -23.441 1.00 98.74 H
+ATOM 471 CA PHE A 33 1.849 -1.524 -21.863 1.00 98.74 C
+ATOM 472 HA PHE A 33 0.776 -1.373 -21.976 1.00 98.74 H
+ATOM 473 C PHE A 33 2.180 -1.218 -20.394 1.00 98.74 C
+ATOM 474 CB PHE A 33 2.160 -2.976 -22.225 1.00 98.74 C
+ATOM 475 HB2 PHE A 33 3.237 -3.138 -22.167 1.00 98.74 H
+ATOM 476 HB3 PHE A 33 1.847 -3.152 -23.254 1.00 98.74 H
+ATOM 477 O PHE A 33 1.274 -1.225 -19.557 1.00 98.74 O
+ATOM 478 CG PHE A 33 1.449 -3.984 -21.350 1.00 98.74 C
+ATOM 479 CD1 PHE A 33 2.158 -4.662 -20.347 1.00 98.74 C
+ATOM 480 HD1 PHE A 33 3.204 -4.434 -20.204 1.00 98.74 H
+ATOM 481 CD2 PHE A 33 0.078 -4.238 -21.531 1.00 98.74 C
+ATOM 482 HD2 PHE A 33 -0.469 -3.708 -22.296 1.00 98.74 H
+ATOM 483 CE1 PHE A 33 1.512 -5.621 -19.547 1.00 98.74 C
+ATOM 484 HE1 PHE A 33 2.070 -6.152 -18.790 1.00 98.74 H
+ATOM 485 CE2 PHE A 33 -0.578 -5.178 -20.717 1.00 98.74 C
+ATOM 486 HE2 PHE A 33 -1.631 -5.368 -20.857 1.00 98.74 H
+ATOM 487 CZ PHE A 33 0.141 -5.875 -19.728 1.00 98.74 C
+ATOM 488 HZ PHE A 33 -0.360 -6.604 -19.108 1.00 98.74 H
+ATOM 489 N ILE A 34 3.443 -0.913 -20.071 1.00 98.77 N
+ATOM 490 H ILE A 34 4.137 -0.895 -20.804 1.00 98.77 H
+ATOM 491 CA ILE A 34 3.833 -0.479 -18.719 1.00 98.77 C
+ATOM 492 HA ILE A 34 3.480 -1.219 -18.001 1.00 98.77 H
+ATOM 493 C ILE A 34 3.143 0.842 -18.361 1.00 98.77 C
+ATOM 494 CB ILE A 34 5.372 -0.385 -18.593 1.00 98.77 C
+ATOM 495 HB ILE A 34 5.758 0.171 -19.448 1.00 98.77 H
+ATOM 496 O ILE A 34 2.566 0.944 -17.276 1.00 98.77 O
+ATOM 497 CG1 ILE A 34 5.976 -1.807 -18.607 1.00 98.77 C
+ATOM 498 HG12 ILE A 34 5.761 -2.305 -17.662 1.00 98.77 H
+ATOM 499 HG13 ILE A 34 5.512 -2.388 -19.404 1.00 98.77 H
+ATOM 500 CG2 ILE A 34 5.783 0.358 -17.305 1.00 98.77 C
+ATOM 501 HG21 ILE A 34 6.865 0.343 -17.178 1.00 98.77 H
+ATOM 502 HG22 ILE A 34 5.499 1.409 -17.377 1.00 98.77 H
+ATOM 503 HG23 ILE A 34 5.296 -0.086 -16.437 1.00 98.77 H
+ATOM 504 CD1 ILE A 34 7.489 -1.825 -18.853 1.00 98.77 C
+ATOM 505 HD11 ILE A 34 8.022 -1.312 -18.052 1.00 98.77 H
+ATOM 506 HD12 ILE A 34 7.712 -1.345 -19.805 1.00 98.77 H
+ATOM 507 HD13 ILE A 34 7.832 -2.858 -18.898 1.00 98.77 H
+ATOM 508 N ASP A 35 3.139 1.815 -19.274 1.00 98.71 N
+ATOM 509 H ASP A 35 3.628 1.677 -20.147 1.00 98.71 H
+ATOM 510 CA ASP A 35 2.463 3.100 -19.064 1.00 98.71 C
+ATOM 511 HA ASP A 35 2.885 3.578 -18.180 1.00 98.71 H
+ATOM 512 C ASP A 35 0.952 2.924 -18.816 1.00 98.71 C
+ATOM 513 CB ASP A 35 2.724 4.016 -20.268 1.00 98.71 C
+ATOM 514 HB2 ASP A 35 3.798 4.141 -20.406 1.00 98.71 H
+ATOM 515 HB3 ASP A 35 2.314 3.561 -21.169 1.00 98.71 H
+ATOM 516 O ASP A 35 0.396 3.426 -17.832 1.00 98.71 O
+ATOM 517 CG ASP A 35 2.085 5.389 -20.047 1.00 98.71 C
+ATOM 518 OD1 ASP A 35 2.207 5.895 -18.909 1.00 98.71 O
+ATOM 519 OD2 ASP A 35 1.422 5.879 -20.985 1.00 98.71 O
+ATOM 520 N HIS A 36 0.284 2.103 -19.631 1.00 98.75 N
+ATOM 521 H HIS A 36 0.768 1.753 -20.446 1.00 98.75 H
+ATOM 522 CA HIS A 36 -1.133 1.783 -19.467 1.00 98.75 C
+ATOM 523 HA HIS A 36 -1.696 2.716 -19.471 1.00 98.75 H
+ATOM 524 C HIS A 36 -1.431 1.080 -18.135 1.00 98.75 C
+ATOM 525 CB HIS A 36 -1.610 0.913 -20.638 1.00 98.75 C
+ATOM 526 HB2 HIS A 36 -0.985 0.021 -20.692 1.00 98.75 H
+ATOM 527 HB3 HIS A 36 -2.631 0.592 -20.436 1.00 98.75 H
+ATOM 528 O HIS A 36 -2.448 1.384 -17.505 1.00 98.75 O
+ATOM 529 CG HIS A 36 -1.607 1.588 -21.989 1.00 98.75 C
+ATOM 530 CD2 HIS A 36 -1.847 2.908 -22.266 1.00 98.75 C
+ATOM 531 HD2 HIS A 36 -2.054 3.687 -21.547 1.00 98.75 H
+ATOM 532 ND1 HIS A 36 -1.353 0.968 -23.194 1.00 98.75 N
+ATOM 533 HD1 HIS A 36 -0.912 0.067 -23.306 1.00 98.75 H
+ATOM 534 CE1 HIS A 36 -1.431 1.893 -24.165 1.00 98.75 C
+ATOM 535 HE1 HIS A 36 -1.183 1.731 -25.204 1.00 98.75 H
+ATOM 536 NE2 HIS A 36 -1.776 3.080 -23.650 1.00 98.75 N
+ATOM 537 N LEU A 37 -0.567 0.169 -17.669 1.00 98.76 N
+ATOM 538 H LEU A 37 0.247 -0.044 -18.228 1.00 98.76 H
+ATOM 539 CA LEU A 37 -0.723 -0.484 -16.363 1.00 98.76 C
+ATOM 540 HA LEU A 37 -1.715 -0.932 -16.309 1.00 98.76 H
+ATOM 541 C LEU A 37 -0.635 0.522 -15.210 1.00 98.76 C
+ATOM 542 CB LEU A 37 0.352 -1.570 -16.171 1.00 98.76 C
+ATOM 543 HB2 LEU A 37 1.312 -1.176 -16.505 1.00 98.76 H
+ATOM 544 HB3 LEU A 37 0.442 -1.774 -15.104 1.00 98.76 H
+ATOM 545 O LEU A 37 -1.489 0.512 -14.317 1.00 98.76 O
+ATOM 546 CG LEU A 37 0.095 -2.909 -16.880 1.00 98.76 C
+ATOM 547 HG LEU A 37 -0.053 -2.756 -17.949 1.00 98.76 H
+ATOM 548 CD1 LEU A 37 1.319 -3.798 -16.654 1.00 98.76 C
+ATOM 549 HD11 LEU A 37 2.163 -3.385 -17.207 1.00 98.76 H
+ATOM 550 HD12 LEU A 37 1.570 -3.837 -15.594 1.00 98.76 H
+ATOM 551 HD13 LEU A 37 1.123 -4.806 -17.020 1.00 98.76 H
+ATOM 552 CD2 LEU A 37 -1.124 -3.645 -16.315 1.00 98.76 C
+ATOM 553 HD21 LEU A 37 -0.987 -3.829 -15.249 1.00 98.76 H
+ATOM 554 HD22 LEU A 37 -2.027 -3.057 -16.478 1.00 98.76 H
+ATOM 555 HD23 LEU A 37 -1.242 -4.595 -16.837 1.00 98.76 H
+ATOM 556 N LEU A 38 0.371 1.401 -15.234 1.00 98.62 N
+ATOM 557 H LEU A 38 1.008 1.376 -16.017 1.00 98.62 H
+ATOM 558 CA LEU A 38 0.557 2.437 -14.217 1.00 98.62 C
+ATOM 559 HA LEU A 38 0.590 1.966 -13.234 1.00 98.62 H
+ATOM 560 C LEU A 38 -0.636 3.401 -14.205 1.00 98.62 C
+ATOM 561 CB LEU A 38 1.885 3.175 -14.473 1.00 98.62 C
+ATOM 562 HB2 LEU A 38 1.873 3.569 -15.490 1.00 98.62 H
+ATOM 563 HB3 LEU A 38 1.951 4.021 -13.789 1.00 98.62 H
+ATOM 564 O LEU A 38 -1.228 3.633 -13.147 1.00 98.62 O
+ATOM 565 CG LEU A 38 3.146 2.310 -14.293 1.00 98.62 C
+ATOM 566 HG LEU A 38 3.050 1.380 -14.852 1.00 98.62 H
+ATOM 567 CD1 LEU A 38 4.386 3.047 -14.792 1.00 98.62 C
+ATOM 568 HD11 LEU A 38 5.261 2.399 -14.734 1.00 98.62 H
+ATOM 569 HD12 LEU A 38 4.247 3.325 -15.837 1.00 98.62 H
+ATOM 570 HD13 LEU A 38 4.558 3.949 -14.205 1.00 98.62 H
+ATOM 571 CD2 LEU A 38 3.374 1.951 -12.824 1.00 98.62 C
+ATOM 572 HD21 LEU A 38 2.565 1.305 -12.483 1.00 98.62 H
+ATOM 573 HD22 LEU A 38 3.414 2.860 -12.225 1.00 98.62 H
+ATOM 574 HD23 LEU A 38 4.318 1.411 -12.751 1.00 98.62 H
+ATOM 575 N THR A 39 -1.053 3.871 -15.381 1.00 98.64 N
+ATOM 576 H THR A 39 -0.491 3.662 -16.194 1.00 98.64 H
+ATOM 577 CA THR A 39 -2.198 4.772 -15.571 1.00 98.64 C
+ATOM 578 HA THR A 39 -2.041 5.667 -14.969 1.00 98.64 H
+ATOM 579 C THR A 39 -3.517 4.139 -15.123 1.00 98.64 C
+ATOM 580 CB THR A 39 -2.268 5.211 -17.043 1.00 98.64 C
+ATOM 581 HB THR A 39 -2.280 4.341 -17.701 1.00 98.64 H
+ATOM 582 O THR A 39 -4.292 4.755 -14.383 1.00 98.64 O
+ATOM 583 CG2 THR A 39 -3.484 6.091 -17.338 1.00 98.64 C
+ATOM 584 HG21 THR A 39 -3.513 6.928 -16.640 1.00 98.64 H
+ATOM 585 HG22 THR A 39 -3.402 6.480 -18.353 1.00 98.64 H
+ATOM 586 HG23 THR A 39 -4.403 5.509 -17.264 1.00 98.64 H
+ATOM 587 OG1 THR A 39 -1.143 6.003 -17.318 1.00 98.64 O
+ATOM 588 HG1 THR A 39 -0.462 5.491 -17.761 1.00 98.64 H
+ATOM 589 N MET A 40 -3.774 2.879 -15.486 1.00 98.78 N
+ATOM 590 H MET A 40 -3.127 2.409 -16.103 1.00 98.78 H
+ATOM 591 CA MET A 40 -4.938 2.139 -14.992 1.00 98.78 C
+ATOM 592 HA MET A 40 -5.838 2.701 -15.244 1.00 98.78 H
+ATOM 593 C MET A 40 -4.887 2.007 -13.464 1.00 98.78 C
+ATOM 594 CB MET A 40 -5.011 0.775 -15.697 1.00 98.78 C
+ATOM 595 HB2 MET A 40 -4.071 0.241 -15.557 1.00 98.78 H
+ATOM 596 HB3 MET A 40 -5.125 0.944 -16.768 1.00 98.78 H
+ATOM 597 O MET A 40 -5.900 2.203 -12.789 1.00 98.78 O
+ATOM 598 CG MET A 40 -6.194 -0.081 -15.216 1.00 98.78 C
+ATOM 599 HG2 MET A 40 -6.897 -0.176 -16.044 1.00 98.78 H
+ATOM 600 HG3 MET A 40 -6.727 0.433 -14.416 1.00 98.78 H
+ATOM 601 SD MET A 40 -5.798 -1.754 -14.633 1.00 98.78 S
+ATOM 602 CE MET A 40 -4.502 -1.413 -13.421 1.00 98.78 C
+ATOM 603 HE1 MET A 40 -4.292 -2.339 -12.887 1.00 98.78 H
+ATOM 604 HE2 MET A 40 -3.592 -1.069 -13.912 1.00 98.78 H
+ATOM 605 HE3 MET A 40 -4.854 -0.663 -12.712 1.00 98.78 H
+ATOM 606 N GLY A 41 -3.705 1.749 -12.900 1.00 98.68 N
+ATOM 607 H GLY A 41 -2.909 1.598 -13.503 1.00 98.68 H
+ATOM 608 CA GLY A 41 -3.489 1.710 -11.458 1.00 98.68 C
+ATOM 609 HA2 GLY A 41 -2.425 1.549 -11.281 1.00 98.68 H
+ATOM 610 HA3 GLY A 41 -4.051 0.881 -11.028 1.00 98.68 H
+ATOM 611 C GLY A 41 -3.912 3.011 -10.770 1.00 98.68 C
+ATOM 612 O GLY A 41 -4.631 2.959 -9.769 1.00 98.68 O
+ATOM 613 N VAL A 42 -3.540 4.170 -11.324 1.00 98.73 N
+ATOM 614 H VAL A 42 -2.942 4.132 -12.137 1.00 98.73 H
+ATOM 615 CA VAL A 42 -3.983 5.493 -10.844 1.00 98.73 C
+ATOM 616 HA VAL A 42 -3.656 5.621 -9.812 1.00 98.73 H
+ATOM 617 C VAL A 42 -5.509 5.590 -10.858 1.00 98.73 C
+ATOM 618 CB VAL A 42 -3.369 6.632 -11.688 1.00 98.73 C
+ATOM 619 HB VAL A 42 -3.625 6.497 -12.739 1.00 98.73 H
+ATOM 620 O VAL A 42 -6.118 5.875 -9.822 1.00 98.73 O
+ATOM 621 CG1 VAL A 42 -3.862 8.018 -11.257 1.00 98.73 C
+ATOM 622 HG11 VAL A 42 -3.608 8.192 -10.211 1.00 98.73 H
+ATOM 623 HG12 VAL A 42 -3.378 8.781 -11.866 1.00 98.73 H
+ATOM 624 HG13 VAL A 42 -4.938 8.111 -11.403 1.00 98.73 H
+ATOM 625 CG2 VAL A 42 -1.849 6.653 -11.555 1.00 98.73 C
+ATOM 626 HG21 VAL A 42 -1.573 6.827 -10.515 1.00 98.73 H
+ATOM 627 HG22 VAL A 42 -1.414 5.713 -11.893 1.00 98.73 H
+ATOM 628 HG23 VAL A 42 -1.442 7.446 -12.183 1.00 98.73 H
+ATOM 629 N GLY A 43 -6.134 5.299 -12.003 1.00 98.33 N
+ATOM 630 H GLY A 43 -5.568 5.054 -12.803 1.00 98.33 H
+ATOM 631 CA GLY A 43 -7.586 5.387 -12.175 1.00 98.33 C
+ATOM 632 HA2 GLY A 43 -7.840 5.036 -13.175 1.00 98.33 H
+ATOM 633 HA3 GLY A 43 -7.899 6.426 -12.079 1.00 98.33 H
+ATOM 634 C GLY A 43 -8.362 4.545 -11.159 1.00 98.33 C
+ATOM 635 O GLY A 43 -9.302 5.039 -10.533 1.00 98.33 O
+ATOM 636 N VAL A 44 -7.930 3.301 -10.921 1.00 98.71 N
+ATOM 637 H VAL A 44 -7.152 2.959 -11.465 1.00 98.71 H
+ATOM 638 CA VAL A 44 -8.570 2.402 -9.946 1.00 98.71 C
+ATOM 639 HA VAL A 44 -9.632 2.339 -10.186 1.00 98.71 H
+ATOM 640 C VAL A 44 -8.473 2.956 -8.517 1.00 98.71 C
+ATOM 641 CB VAL A 44 -7.981 0.978 -10.040 1.00 98.71 C
+ATOM 642 HB VAL A 44 -6.901 1.023 -9.899 1.00 98.71 H
+ATOM 643 O VAL A 44 -9.467 2.939 -7.789 1.00 98.71 O
+ATOM 644 CG1 VAL A 44 -8.578 0.042 -8.983 1.00 98.71 C
+ATOM 645 HG11 VAL A 44 -8.135 -0.950 -9.071 1.00 98.71 H
+ATOM 646 HG12 VAL A 44 -8.378 0.432 -7.985 1.00 98.71 H
+ATOM 647 HG13 VAL A 44 -9.657 -0.033 -9.116 1.00 98.71 H
+ATOM 648 CG2 VAL A 44 -8.287 0.324 -11.395 1.00 98.71 C
+ATOM 649 HG21 VAL A 44 -9.361 0.180 -11.513 1.00 98.71 H
+ATOM 650 HG22 VAL A 44 -7.783 -0.640 -11.466 1.00 98.71 H
+ATOM 651 HG23 VAL A 44 -7.937 0.950 -12.216 1.00 98.71 H
+ATOM 652 N HIS A 45 -7.312 3.479 -8.104 1.00 98.78 N
+ATOM 653 H HIS A 45 -6.541 3.529 -8.755 1.00 98.78 H
+ATOM 654 CA HIS A 45 -7.130 4.001 -6.744 1.00 98.78 C
+ATOM 655 HA HIS A 45 -7.492 3.254 -6.037 1.00 98.78 H
+ATOM 656 C HIS A 45 -7.953 5.272 -6.494 1.00 98.78 C
+ATOM 657 CB HIS A 45 -5.642 4.240 -6.450 1.00 98.78 C
+ATOM 658 HB2 HIS A 45 -5.186 4.786 -7.275 1.00 98.78 H
+ATOM 659 HB3 HIS A 45 -5.559 4.859 -5.557 1.00 98.78 H
+ATOM 660 O HIS A 45 -8.612 5.382 -5.458 1.00 98.78 O
+ATOM 661 CG HIS A 45 -4.873 2.967 -6.202 1.00 98.78 C
+ATOM 662 CD2 HIS A 45 -4.540 2.427 -4.991 1.00 98.78 C
+ATOM 663 HD2 HIS A 45 -4.786 2.847 -4.027 1.00 98.78 H
+ATOM 664 ND1 HIS A 45 -4.372 2.124 -7.160 1.00 98.78 N
+ATOM 665 HD1 HIS A 45 -4.419 2.281 -8.156 1.00 98.78 H
+ATOM 666 CE1 HIS A 45 -3.747 1.106 -6.550 1.00 98.78 C
+ATOM 667 HE1 HIS A 45 -3.241 0.300 -7.060 1.00 98.78 H
+ATOM 668 NE2 HIS A 45 -3.821 1.246 -5.215 1.00 98.78 N
+ATOM 669 N PHE A 46 -7.981 6.215 -7.439 1.00 98.67 N
+ATOM 670 H PHE A 46 -7.431 6.089 -8.277 1.00 98.67 H
+ATOM 671 CA PHE A 46 -8.784 7.434 -7.290 1.00 98.67 C
+ATOM 672 HA PHE A 46 -8.630 7.822 -6.283 1.00 98.67 H
+ATOM 673 C PHE A 46 -10.293 7.174 -7.413 1.00 98.67 C
+ATOM 674 CB PHE A 46 -8.302 8.512 -8.266 1.00 98.67 C
+ATOM 675 HB2 PHE A 46 -9.096 9.247 -8.396 1.00 98.67 H
+ATOM 676 HB3 PHE A 46 -8.111 8.067 -9.242 1.00 98.67 H
+ATOM 677 O PHE A 46 -11.075 7.815 -6.712 1.00 98.67 O
+ATOM 678 CG PHE A 46 -7.069 9.249 -7.775 1.00 98.67 C
+ATOM 679 CD1 PHE A 46 -7.202 10.295 -6.842 1.00 98.67 C
+ATOM 680 HD1 PHE A 46 -8.182 10.579 -6.489 1.00 98.67 H
+ATOM 681 CD2 PHE A 46 -5.791 8.902 -8.247 1.00 98.67 C
+ATOM 682 HD2 PHE A 46 -5.681 8.114 -8.977 1.00 98.67 H
+ATOM 683 CE1 PHE A 46 -6.065 10.986 -6.384 1.00 98.67 C
+ATOM 684 HE1 PHE A 46 -6.172 11.798 -5.680 1.00 98.67 H
+ATOM 685 CE2 PHE A 46 -4.654 9.596 -7.796 1.00 98.67 C
+ATOM 686 HE2 PHE A 46 -3.677 9.345 -8.182 1.00 98.67 H
+ATOM 687 CZ PHE A 46 -4.790 10.636 -6.862 1.00 98.67 C
+ATOM 688 HZ PHE A 46 -3.916 11.175 -6.527 1.00 98.67 H
+ATOM 689 N ALA A 47 -10.727 6.194 -8.211 1.00 98.71 N
+ATOM 690 H ALA A 47 -10.078 5.727 -8.828 1.00 98.71 H
+ATOM 691 CA ALA A 47 -12.125 5.765 -8.211 1.00 98.71 C
+ATOM 692 HA ALA A 47 -12.760 6.632 -8.394 1.00 98.71 H
+ATOM 693 C ALA A 47 -12.531 5.170 -6.847 1.00 98.71 C
+ATOM 694 CB ALA A 47 -12.333 4.767 -9.356 1.00 98.71 C
+ATOM 695 HB1 ALA A 47 -11.694 3.895 -9.220 1.00 98.71 H
+ATOM 696 HB2 ALA A 47 -12.087 5.241 -10.306 1.00 98.71 H
+ATOM 697 HB3 ALA A 47 -13.375 4.448 -9.381 1.00 98.71 H
+ATOM 698 O ALA A 47 -13.556 5.547 -6.270 1.00 98.71 O
+ATOM 699 N ALA A 48 -11.695 4.291 -6.285 1.00 98.59 N
+ATOM 700 H ALA A 48 -10.878 4.001 -6.803 1.00 98.59 H
+ATOM 701 CA ALA A 48 -11.923 3.701 -4.968 1.00 98.59 C
+ATOM 702 HA ALA A 48 -12.917 3.253 -4.959 1.00 98.59 H
+ATOM 703 C ALA A 48 -11.878 4.740 -3.832 1.00 98.59 C
+ATOM 704 CB ALA A 48 -10.897 2.584 -4.766 1.00 98.59 C
+ATOM 705 HB1 ALA A 48 -9.889 2.997 -4.807 1.00 98.59 H
+ATOM 706 HB2 ALA A 48 -11.059 2.105 -3.800 1.00 98.59 H
+ATOM 707 HB3 ALA A 48 -11.005 1.843 -5.557 1.00 98.59 H
+ATOM 708 O ALA A 48 -12.640 4.627 -2.871 1.00 98.59 O
+ATOM 709 N LEU A 49 -11.053 5.789 -3.949 1.00 98.71 N
+ATOM 710 H LEU A 49 -10.401 5.793 -4.720 1.00 98.71 H
+ATOM 711 CA LEU A 49 -11.026 6.914 -3.006 1.00 98.71 C
+ATOM 712 HA LEU A 49 -10.713 6.544 -2.030 1.00 98.71 H
+ATOM 713 C LEU A 49 -12.414 7.543 -2.840 1.00 98.71 C
+ATOM 714 CB LEU A 49 -10.011 7.965 -3.495 1.00 98.71 C
+ATOM 715 HB2 LEU A 49 -10.244 8.221 -4.529 1.00 98.71 H
+ATOM 716 HB3 LEU A 49 -9.011 7.531 -3.486 1.00 98.71 H
+ATOM 717 O LEU A 49 -12.866 7.737 -1.710 1.00 98.71 O
+ATOM 718 CG LEU A 49 -9.997 9.287 -2.709 1.00 98.71 C
+ATOM 719 HG LEU A 49 -10.981 9.753 -2.746 1.00 98.71 H
+ATOM 720 CD1 LEU A 49 -9.606 9.078 -1.250 1.00 98.71 C
+ATOM 721 HD11 LEU A 49 -9.561 10.042 -0.744 1.00 98.71 H
+ATOM 722 HD12 LEU A 49 -8.627 8.601 -1.200 1.00 98.71 H
+ATOM 723 HD13 LEU A 49 -10.352 8.458 -0.753 1.00 98.71 H
+ATOM 724 CD2 LEU A 49 -9.001 10.251 -3.350 1.00 98.71 C
+ATOM 725 HD21 LEU A 49 -8.983 11.190 -2.798 1.00 98.71 H
+ATOM 726 HD22 LEU A 49 -9.307 10.458 -4.376 1.00 98.71 H
+ATOM 727 HD23 LEU A 49 -8.002 9.815 -3.356 1.00 98.71 H
+ATOM 728 N ILE A 50 -13.100 7.830 -3.951 1.00 98.74 N
+ATOM 729 H ILE A 50 -12.674 7.634 -4.845 1.00 98.74 H
+ATOM 730 CA ILE A 50 -14.445 8.417 -3.916 1.00 98.74 C
+ATOM 731 HA ILE A 50 -14.414 9.315 -3.299 1.00 98.74 H
+ATOM 732 C ILE A 50 -15.427 7.463 -3.238 1.00 98.74 C
+ATOM 733 CB ILE A 50 -14.914 8.815 -5.333 1.00 98.74 C
+ATOM 734 HB ILE A 50 -14.931 7.921 -5.956 1.00 98.74 H
+ATOM 735 O ILE A 50 -16.204 7.900 -2.389 1.00 98.74 O
+ATOM 736 CG1 ILE A 50 -13.963 9.831 -6.007 1.00 98.74 C
+ATOM 737 HG12 ILE A 50 -14.378 10.109 -6.976 1.00 98.74 H
+ATOM 738 HG13 ILE A 50 -13.008 9.344 -6.204 1.00 98.74 H
+ATOM 739 CG2 ILE A 50 -16.347 9.382 -5.301 1.00 98.74 C
+ATOM 740 HG21 ILE A 50 -16.622 9.744 -6.291 1.00 98.74 H
+ATOM 741 HG22 ILE A 50 -17.056 8.603 -5.022 1.00 98.74 H
+ATOM 742 HG23 ILE A 50 -16.420 10.202 -4.587 1.00 98.74 H
+ATOM 743 CD1 ILE A 50 -13.682 11.114 -5.211 1.00 98.74 C
+ATOM 744 HD11 ILE A 50 -13.053 11.772 -5.811 1.00 98.74 H
+ATOM 745 HD12 ILE A 50 -13.153 10.883 -4.287 1.00 98.74 H
+ATOM 746 HD13 ILE A 50 -14.612 11.635 -4.984 1.00 98.74 H
+ATOM 747 N PHE A 51 -15.351 6.162 -3.534 1.00 98.75 N
+ATOM 748 H PHE A 51 -14.680 5.865 -4.228 1.00 98.75 H
+ATOM 749 CA PHE A 51 -16.168 5.153 -2.861 1.00 98.75 C
+ATOM 750 HA PHE A 51 -17.219 5.382 -3.040 1.00 98.75 H
+ATOM 751 C PHE A 51 -15.961 5.163 -1.336 1.00 98.75 C
+ATOM 752 CB PHE A 51 -15.886 3.768 -3.459 1.00 98.75 C
+ATOM 753 HB2 PHE A 51 -16.189 3.766 -4.506 1.00 98.75 H
+ATOM 754 HB3 PHE A 51 -14.816 3.562 -3.430 1.00 98.75 H
+ATOM 755 O PHE A 51 -16.931 5.286 -0.584 1.00 98.75 O
+ATOM 756 CG PHE A 51 -16.604 2.653 -2.729 1.00 98.75 C
+ATOM 757 CD1 PHE A 51 -15.983 2.005 -1.643 1.00 98.75 C
+ATOM 758 HD1 PHE A 51 -14.977 2.274 -1.356 1.00 98.75 H
+ATOM 759 CD2 PHE A 51 -17.909 2.290 -3.105 1.00 98.75 C
+ATOM 760 HD2 PHE A 51 -18.389 2.785 -3.937 1.00 98.75 H
+ATOM 761 CE1 PHE A 51 -16.671 1.007 -0.930 1.00 98.75 C
+ATOM 762 HE1 PHE A 51 -16.193 0.515 -0.096 1.00 98.75 H
+ATOM 763 CE2 PHE A 51 -18.585 1.273 -2.410 1.00 98.75 C
+ATOM 764 HE2 PHE A 51 -19.580 0.982 -2.715 1.00 98.75 H
+ATOM 765 CZ PHE A 51 -17.966 0.631 -1.323 1.00 98.75 C
+ATOM 766 HZ PHE A 51 -18.486 -0.153 -0.792 1.00 98.75 H
+ATOM 767 N PHE A 52 -14.714 5.084 -0.858 1.00 98.73 N
+ATOM 768 H PHE A 52 -13.949 4.997 -1.512 1.00 98.73 H
+ATOM 769 CA PHE A 52 -14.425 5.082 0.580 1.00 98.73 C
+ATOM 770 HA PHE A 52 -14.990 4.274 1.045 1.00 98.73 H
+ATOM 771 C PHE A 52 -14.880 6.377 1.258 1.00 98.73 C
+ATOM 772 CB PHE A 52 -12.928 4.848 0.822 1.00 98.73 C
+ATOM 773 HB2 PHE A 52 -12.366 5.620 0.296 1.00 98.73 H
+ATOM 774 HB3 PHE A 52 -12.726 4.955 1.888 1.00 98.73 H
+ATOM 775 O PHE A 52 -15.445 6.331 2.355 1.00 98.73 O
+ATOM 776 CG PHE A 52 -12.418 3.487 0.399 1.00 98.73 C
+ATOM 777 CD1 PHE A 52 -13.050 2.321 0.865 1.00 98.73 C
+ATOM 778 HD1 PHE A 52 -13.887 2.384 1.544 1.00 98.73 H
+ATOM 779 CD2 PHE A 52 -11.306 3.382 -0.456 1.00 98.73 C
+ATOM 780 HD2 PHE A 52 -10.816 4.274 -0.816 1.00 98.73 H
+ATOM 781 CE1 PHE A 52 -12.604 1.061 0.440 1.00 98.73 C
+ATOM 782 HE1 PHE A 52 -13.109 0.175 0.796 1.00 98.73 H
+ATOM 783 CE2 PHE A 52 -10.855 2.119 -0.877 1.00 98.73 C
+ATOM 784 HE2 PHE A 52 -10.016 2.041 -1.553 1.00 98.73 H
+ATOM 785 CZ PHE A 52 -11.512 0.958 -0.441 1.00 98.73 C
+ATOM 786 HZ PHE A 52 -11.177 -0.008 -0.789 1.00 98.73 H
+ATOM 787 N LEU A 53 -14.706 7.520 0.590 1.00 98.61 N
+ATOM 788 H LEU A 53 -14.221 7.488 -0.295 1.00 98.61 H
+ATOM 789 CA LEU A 53 -15.153 8.818 1.084 1.00 98.61 C
+ATOM 790 HA LEU A 53 -14.687 8.985 2.055 1.00 98.61 H
+ATOM 791 C LEU A 53 -16.672 8.847 1.292 1.00 98.61 C
+ATOM 792 CB LEU A 53 -14.675 9.912 0.112 1.00 98.61 C
+ATOM 793 HB2 LEU A 53 -13.586 9.890 0.067 1.00 98.61 H
+ATOM 794 HB3 LEU A 53 -15.050 9.684 -0.886 1.00 98.61 H
+ATOM 795 O LEU A 53 -17.127 9.123 2.404 1.00 98.61 O
+ATOM 796 CG LEU A 53 -15.134 11.333 0.483 1.00 98.61 C
+ATOM 797 HG LEU A 53 -16.223 11.372 0.513 1.00 98.61 H
+ATOM 798 CD1 LEU A 53 -14.587 11.777 1.842 1.00 98.61 C
+ATOM 799 HD11 LEU A 53 -13.500 11.702 1.850 1.00 98.61 H
+ATOM 800 HD12 LEU A 53 -14.875 12.811 2.030 1.00 98.61 H
+ATOM 801 HD13 LEU A 53 -15.006 11.159 2.637 1.00 98.61 H
+ATOM 802 CD2 LEU A 53 -14.660 12.319 -0.583 1.00 98.61 C
+ATOM 803 HD21 LEU A 53 -15.011 13.322 -0.343 1.00 98.61 H
+ATOM 804 HD22 LEU A 53 -13.572 12.322 -0.637 1.00 98.61 H
+ATOM 805 HD23 LEU A 53 -15.064 12.033 -1.554 1.00 98.61 H
+ATOM 806 N VAL A 54 -17.462 8.525 0.262 1.00 98.43 N
+ATOM 807 H VAL A 54 -17.034 8.270 -0.616 1.00 98.43 H
+ATOM 808 CA VAL A 54 -18.931 8.635 0.338 1.00 98.43 C
+ATOM 809 HA VAL A 54 -19.165 9.601 0.787 1.00 98.43 H
+ATOM 810 C VAL A 54 -19.557 7.581 1.248 1.00 98.43 C
+ATOM 811 CB VAL A 54 -19.604 8.616 -1.049 1.00 98.43 C
+ATOM 812 HB VAL A 54 -20.668 8.798 -0.898 1.00 98.43 H
+ATOM 813 O VAL A 54 -20.602 7.832 1.848 1.00 98.43 O
+ATOM 814 CG1 VAL A 54 -19.083 9.752 -1.936 1.00 98.43 C
+ATOM 815 HG11 VAL A 54 -19.647 9.780 -2.869 1.00 98.43 H
+ATOM 816 HG12 VAL A 54 -19.208 10.707 -1.426 1.00 98.43 H
+ATOM 817 HG13 VAL A 54 -18.028 9.612 -2.173 1.00 98.43 H
+ATOM 818 CG2 VAL A 54 -19.478 7.276 -1.781 1.00 98.43 C
+ATOM 819 HG21 VAL A 54 -19.892 7.363 -2.785 1.00 98.43 H
+ATOM 820 HG22 VAL A 54 -20.034 6.503 -1.250 1.00 98.43 H
+ATOM 821 HG23 VAL A 54 -18.432 6.979 -1.859 1.00 98.43 H
+ATOM 822 N VAL A 55 -18.924 6.413 1.393 1.00 98.35 N
+ATOM 823 H VAL A 55 -18.108 6.243 0.822 1.00 98.35 H
+ATOM 824 CA VAL A 55 -19.415 5.325 2.250 1.00 98.35 C
+ATOM 825 HA VAL A 55 -20.504 5.330 2.209 1.00 98.35 H
+ATOM 826 C VAL A 55 -19.044 5.528 3.727 1.00 98.35 C
+ATOM 827 CB VAL A 55 -18.944 3.973 1.682 1.00 98.35 C
+ATOM 828 HB VAL A 55 -17.866 3.997 1.529 1.00 98.35 H
+ATOM 829 O VAL A 55 -19.733 5.013 4.609 1.00 98.35 O
+ATOM 830 CG1 VAL A 55 -19.263 2.800 2.598 1.00 98.35 C
+ATOM 831 HG11 VAL A 55 -20.327 2.787 2.838 1.00 98.35 H
+ATOM 832 HG12 VAL A 55 -18.677 2.871 3.515 1.00 98.35 H
+ATOM 833 HG13 VAL A 55 -18.992 1.873 2.094 1.00 98.35 H
+ATOM 834 CG2 VAL A 55 -19.650 3.680 0.350 1.00 98.35 C
+ATOM 835 HG21 VAL A 55 -19.398 4.441 -0.388 1.00 98.35 H
+ATOM 836 HG22 VAL A 55 -19.309 2.722 -0.044 1.00 98.35 H
+ATOM 837 HG23 VAL A 55 -20.731 3.650 0.485 1.00 98.35 H
+ATOM 838 N SER A 56 -18.022 6.336 4.031 1.00 98.31 N
+ATOM 839 H SER A 56 -17.478 6.715 3.269 1.00 98.31 H
+ATOM 840 CA SER A 56 -17.539 6.570 5.403 1.00 98.31 C
+ATOM 841 HA SER A 56 -17.176 5.621 5.796 1.00 98.31 H
+ATOM 842 C SER A 56 -18.607 7.088 6.385 1.00 98.31 C
+ATOM 843 CB SER A 56 -16.359 7.547 5.380 1.00 98.31 C
+ATOM 844 HB2 SER A 56 -15.905 7.566 6.370 1.00 98.31 H
+ATOM 845 HB3 SER A 56 -15.605 7.216 4.666 1.00 98.31 H
+ATOM 846 O SER A 56 -18.537 6.801 7.585 1.00 98.31 O
+ATOM 847 OG SER A 56 -16.786 8.856 5.057 1.00 98.31 O
+ATOM 848 HG SER A 56 -16.878 8.942 4.105 1.00 98.31 H
+ATOM 849 N GLN A 57 -19.629 7.797 5.892 1.00 98.33 N
+ATOM 850 H GLN A 57 -19.603 8.027 4.909 1.00 98.33 H
+ATOM 851 CA GLN A 57 -20.752 8.296 6.697 1.00 98.33 C
+ATOM 852 HA GLN A 57 -20.340 8.840 7.547 1.00 98.33 H
+ATOM 853 C GLN A 57 -21.637 7.174 7.271 1.00 98.33 C
+ATOM 854 CB GLN A 57 -21.572 9.295 5.863 1.00 98.33 C
+ATOM 855 HB2 GLN A 57 -20.895 10.040 5.445 1.00 98.33 H
+ATOM 856 HB3 GLN A 57 -22.271 9.810 6.522 1.00 98.33 H
+ATOM 857 O GLN A 57 -22.271 7.354 8.307 1.00 98.33 O
+ATOM 858 CG GLN A 57 -22.366 8.640 4.723 1.00 98.33 C
+ATOM 859 HG2 GLN A 57 -21.714 7.986 4.144 1.00 98.33 H
+ATOM 860 HG3 GLN A 57 -23.170 8.035 5.141 1.00 98.33 H
+ATOM 861 CD GLN A 57 -22.995 9.678 3.803 1.00 98.33 C
+ATOM 862 NE2 GLN A 57 -22.647 9.697 2.536 1.00 98.33 N
+ATOM 863 HE21 GLN A 57 -23.046 10.434 1.972 1.00 98.33 H
+ATOM 864 HE22 GLN A 57 -21.949 9.051 2.196 1.00 98.33 H
+ATOM 865 OE1 GLN A 57 -23.800 10.495 4.211 1.00 98.33 O
+ATOM 866 N PHE A 58 -21.639 5.994 6.644 1.00 98.48 N
+ATOM 867 H PHE A 58 -21.079 5.888 5.810 1.00 98.48 H
+ATOM 868 CA PHE A 58 -22.396 4.821 7.096 1.00 98.48 C
+ATOM 869 HA PHE A 58 -23.277 5.164 7.638 1.00 98.48 H
+ATOM 870 C PHE A 58 -21.599 3.942 8.067 1.00 98.48 C
+ATOM 871 CB PHE A 58 -22.885 4.027 5.878 1.00 98.48 C
+ATOM 872 HB2 PHE A 58 -23.572 3.251 6.215 1.00 98.48 H
+ATOM 873 HB3 PHE A 58 -22.029 3.531 5.420 1.00 98.48 H
+ATOM 874 O PHE A 58 -22.104 2.935 8.548 1.00 98.48 O
+ATOM 875 CG PHE A 58 -23.593 4.875 4.838 1.00 98.48 C
+ATOM 876 CD1 PHE A 58 -24.746 5.606 5.179 1.00 98.48 C
+ATOM 877 HD1 PHE A 58 -25.156 5.542 6.176 1.00 98.48 H
+ATOM 878 CD2 PHE A 58 -23.071 4.968 3.535 1.00 98.48 C
+ATOM 879 HD2 PHE A 58 -22.180 4.414 3.277 1.00 98.48 H
+ATOM 880 CE1 PHE A 58 -25.371 6.427 4.225 1.00 98.48 C
+ATOM 881 HE1 PHE A 58 -26.247 6.996 4.498 1.00 98.48 H
+ATOM 882 CE2 PHE A 58 -23.676 5.812 2.588 1.00 98.48 C
+ATOM 883 HE2 PHE A 58 -23.225 5.934 1.614 1.00 98.48 H
+ATOM 884 CZ PHE A 58 -24.829 6.541 2.933 1.00 98.48 C
+ATOM 885 HZ PHE A 58 -25.276 7.223 2.225 1.00 98.48 H
+ATOM 886 N VAL A 59 -20.359 4.314 8.390 1.00 98.68 N
+ATOM 887 H VAL A 59 -19.993 5.158 7.974 1.00 98.68 H
+ATOM 888 CA VAL A 59 -19.512 3.597 9.348 1.00 98.68 C
+ATOM 889 HA VAL A 59 -19.879 2.576 9.453 1.00 98.68 H
+ATOM 890 C VAL A 59 -19.599 4.280 10.711 1.00 98.68 C
+ATOM 891 CB VAL A 59 -18.064 3.514 8.833 1.00 98.68 C
+ATOM 892 HB VAL A 59 -17.635 4.514 8.772 1.00 98.68 H
+ATOM 893 O VAL A 59 -19.444 5.498 10.808 1.00 98.68 O
+ATOM 894 CG1 VAL A 59 -17.213 2.669 9.779 1.00 98.68 C
+ATOM 895 HG11 VAL A 59 -17.665 1.685 9.898 1.00 98.68 H
+ATOM 896 HG12 VAL A 59 -17.145 3.158 10.752 1.00 98.68 H
+ATOM 897 HG13 VAL A 59 -16.208 2.560 9.371 1.00 98.68 H
+ATOM 898 CG2 VAL A 59 -17.991 2.857 7.450 1.00 98.68 C
+ATOM 899 HG21 VAL A 59 -18.553 3.434 6.715 1.00 98.68 H
+ATOM 900 HG22 VAL A 59 -18.394 1.846 7.500 1.00 98.68 H
+ATOM 901 HG23 VAL A 59 -16.955 2.809 7.114 1.00 98.68 H
+ATOM 902 N ALA A 60 -19.829 3.514 11.781 1.00 98.55 N
+ATOM 903 H ALA A 60 -19.937 2.520 11.643 1.00 98.55 H
+ATOM 904 CA ALA A 60 -19.913 4.029 13.147 1.00 98.55 C
+ATOM 905 HA ALA A 60 -20.700 4.783 13.161 1.00 98.55 H
+ATOM 906 C ALA A 60 -18.585 4.667 13.600 1.00 98.55 C
+ATOM 907 CB ALA A 60 -20.315 2.889 14.093 1.00 98.55 C
+ATOM 908 HB1 ALA A 60 -21.258 2.453 13.764 1.00 98.55 H
+ATOM 909 HB2 ALA A 60 -19.547 2.116 14.094 1.00 98.55 H
+ATOM 910 HB3 ALA A 60 -20.447 3.267 15.107 1.00 98.55 H
+ATOM 911 O ALA A 60 -17.517 4.243 13.144 1.00 98.55 O
+ATOM 912 N PRO A 61 -18.602 5.616 14.562 1.00 98.69 N
+ATOM 913 CA PRO A 61 -17.390 6.293 15.037 1.00 98.69 C
+ATOM 914 HA PRO A 61 -17.032 6.957 14.250 1.00 98.69 H
+ATOM 915 C PRO A 61 -16.243 5.347 15.418 1.00 98.69 C
+ATOM 916 CB PRO A 61 -17.841 7.130 16.239 1.00 98.69 C
+ATOM 917 HB2 PRO A 61 -17.250 8.040 16.339 1.00 98.69 H
+ATOM 918 HB3 PRO A 61 -17.786 6.541 17.154 1.00 98.69 H
+ATOM 919 O PRO A 61 -15.094 5.620 15.087 1.00 98.69 O
+ATOM 920 CG PRO A 61 -19.305 7.437 15.929 1.00 98.69 C
+ATOM 921 HG2 PRO A 61 -19.878 7.631 16.835 1.00 98.69 H
+ATOM 922 HG3 PRO A 61 -19.367 8.287 15.249 1.00 98.69 H
+ATOM 923 CD PRO A 61 -19.782 6.173 15.218 1.00 98.69 C
+ATOM 924 HD2 PRO A 61 -20.161 5.462 15.952 1.00 98.69 H
+ATOM 925 HD3 PRO A 61 -20.565 6.425 14.503 1.00 98.69 H
+ATOM 926 N LYS A 62 -16.565 4.197 16.029 1.00 98.50 N
+ATOM 927 H LYS A 62 -17.541 4.047 16.243 1.00 98.50 H
+ATOM 928 CA LYS A 62 -15.601 3.157 16.423 1.00 98.50 C
+ATOM 929 HA LYS A 62 -14.906 3.580 17.149 1.00 98.50 H
+ATOM 930 C LYS A 62 -14.738 2.642 15.261 1.00 98.50 C
+ATOM 931 CB LYS A 62 -16.383 2.006 17.080 1.00 98.50 C
+ATOM 932 HB2 LYS A 62 -17.085 1.598 16.353 1.00 98.50 H
+ATOM 933 HB3 LYS A 62 -16.951 2.400 17.923 1.00 98.50 H
+ATOM 934 O LYS A 62 -13.572 2.336 15.480 1.00 98.50 O
+ATOM 935 CG LYS A 62 -15.476 0.872 17.585 1.00 98.50 C
+ATOM 936 HG2 LYS A 62 -14.780 1.259 18.329 1.00 98.50 H
+ATOM 937 HG3 LYS A 62 -14.911 0.459 16.750 1.00 98.50 H
+ATOM 938 CD LYS A 62 -16.309 -0.258 18.196 1.00 98.50 C
+ATOM 939 HD2 LYS A 62 -16.783 0.081 19.118 1.00 98.50 H
+ATOM 940 HD3 LYS A 62 -17.084 -0.541 17.483 1.00 98.50 H
+ATOM 941 CE LYS A 62 -15.410 -1.467 18.472 1.00 98.50 C
+ATOM 942 HE2 LYS A 62 -14.773 -1.268 19.333 1.00 98.50 H
+ATOM 943 HE3 LYS A 62 -14.765 -1.610 17.605 1.00 98.50 H
+ATOM 944 NZ LYS A 62 -16.211 -2.699 18.656 1.00 98.50 N
+ATOM 945 HZ1 LYS A 62 -15.616 -3.514 18.614 1.00 98.50 H
+ATOM 946 HZ2 LYS A 62 -16.758 -2.851 17.821 1.00 98.50 H
+ATOM 947 HZ3 LYS A 62 -16.822 -2.700 19.461 1.00 98.50 H
+ATOM 948 N TYR A 63 -15.296 2.532 14.054 1.00 98.74 N
+ATOM 949 H TYR A 63 -16.247 2.850 13.933 1.00 98.74 H
+ATOM 950 CA TYR A 63 -14.620 1.921 12.901 1.00 98.74 C
+ATOM 951 HA TYR A 63 -13.667 1.504 13.224 1.00 98.74 H
+ATOM 952 C TYR A 63 -14.299 2.915 11.781 1.00 98.74 C
+ATOM 953 CB TYR A 63 -15.458 0.760 12.353 1.00 98.74 C
+ATOM 954 HB2 TYR A 63 -14.869 0.236 11.601 1.00 98.74 H
+ATOM 955 HB3 TYR A 63 -16.337 1.171 11.857 1.00 98.74 H
+ATOM 956 O TYR A 63 -13.597 2.557 10.840 1.00 98.74 O
+ATOM 957 CG TYR A 63 -15.918 -0.255 13.375 1.00 98.74 C
+ATOM 958 CD1 TYR A 63 -14.986 -1.078 14.036 1.00 98.74 C
+ATOM 959 HD1 TYR A 63 -13.930 -0.983 13.831 1.00 98.74 H
+ATOM 960 CD2 TYR A 63 -17.293 -0.397 13.636 1.00 98.74 C
+ATOM 961 HD2 TYR A 63 -18.005 0.230 13.120 1.00 98.74 H
+ATOM 962 CE1 TYR A 63 -15.436 -2.050 14.948 1.00 98.74 C
+ATOM 963 HE1 TYR A 63 -14.724 -2.712 15.418 1.00 98.74 H
+ATOM 964 CE2 TYR A 63 -17.749 -1.372 14.535 1.00 98.74 C
+ATOM 965 HE2 TYR A 63 -18.808 -1.488 14.711 1.00 98.74 H
+ATOM 966 OH TYR A 63 -17.291 -3.125 16.068 1.00 98.74 O
+ATOM 967 HH TYR A 63 -18.210 -3.332 15.883 1.00 98.74 H
+ATOM 968 CZ TYR A 63 -16.820 -2.205 15.188 1.00 98.74 C
+ATOM 969 N ARG A 64 -14.782 4.163 11.856 1.00 98.66 N
+ATOM 970 H ARG A 64 -15.383 4.387 12.636 1.00 98.66 H
+ATOM 971 CA ARG A 64 -14.677 5.138 10.755 1.00 98.66 C
+ATOM 972 HA ARG A 64 -15.164 4.713 9.878 1.00 98.66 H
+ATOM 973 C ARG A 64 -13.236 5.426 10.333 1.00 98.66 C
+ATOM 974 CB ARG A 64 -15.426 6.415 11.151 1.00 98.66 C
+ATOM 975 HB2 ARG A 64 -14.881 6.940 11.935 1.00 98.66 H
+ATOM 976 HB3 ARG A 64 -16.400 6.123 11.542 1.00 98.66 H
+ATOM 977 O ARG A 64 -12.978 5.597 9.145 1.00 98.66 O
+ATOM 978 CG ARG A 64 -15.628 7.345 9.941 1.00 98.66 C
+ATOM 979 HG2 ARG A 64 -16.091 6.786 9.128 1.00 98.66 H
+ATOM 980 HG3 ARG A 64 -14.663 7.719 9.597 1.00 98.66 H
+ATOM 981 CD ARG A 64 -16.518 8.543 10.281 1.00 98.66 C
+ATOM 982 HD2 ARG A 64 -16.020 9.150 11.037 1.00 98.66 H
+ATOM 983 HD3 ARG A 64 -16.630 9.151 9.383 1.00 98.66 H
+ATOM 984 NE ARG A 64 -17.856 8.103 10.724 1.00 98.66 N
+ATOM 985 HE ARG A 64 -18.374 7.531 10.072 1.00 98.66 H
+ATOM 986 NH1 ARG A 64 -17.881 9.054 12.817 1.00 98.66 N
+ATOM 987 HH11 ARG A 64 -18.405 9.327 13.636 1.00 98.66 H
+ATOM 988 HH12 ARG A 64 -16.984 9.472 12.617 1.00 98.66 H
+ATOM 989 NH2 ARG A 64 -19.649 7.910 12.096 1.00 98.66 N
+ATOM 990 HH21 ARG A 64 -20.219 8.235 12.863 1.00 98.66 H
+ATOM 991 HH22 ARG A 64 -20.044 7.277 11.415 1.00 98.66 H
+ATOM 992 CZ ARG A 64 -18.450 8.355 11.873 1.00 98.66 C
+ATOM 993 N ILE A 65 -12.294 5.393 11.280 1.00 98.55 N
+ATOM 994 H ILE A 65 -12.586 5.239 12.234 1.00 98.55 H
+ATOM 995 CA ILE A 65 -10.860 5.542 10.988 1.00 98.55 C
+ATOM 996 HA ILE A 65 -10.724 6.479 10.447 1.00 98.55 H
+ATOM 997 C ILE A 65 -10.354 4.432 10.051 1.00 98.55 C
+ATOM 998 CB ILE A 65 -10.031 5.643 12.293 1.00 98.55 C
+ATOM 999 HB ILE A 65 -10.280 4.795 12.930 1.00 98.55 H
+ATOM 1000 O ILE A 65 -9.510 4.712 9.211 1.00 98.55 O
+ATOM 1001 CG1 ILE A 65 -10.400 6.948 13.039 1.00 98.55 C
+ATOM 1002 HG12 ILE A 65 -11.468 6.942 13.259 1.00 98.55 H
+ATOM 1003 HG13 ILE A 65 -10.196 7.803 12.395 1.00 98.55 H
+ATOM 1004 CG2 ILE A 65 -8.516 5.604 12.009 1.00 98.55 C
+ATOM 1005 HG21 ILE A 65 -8.231 4.677 11.511 1.00 98.55 H
+ATOM 1006 HG22 ILE A 65 -7.945 5.643 12.937 1.00 98.55 H
+ATOM 1007 HG23 ILE A 65 -8.228 6.444 11.377 1.00 98.55 H
+ATOM 1008 CD1 ILE A 65 -9.664 7.158 14.370 1.00 98.55 C
+ATOM 1009 HD11 ILE A 65 -9.759 6.269 14.993 1.00 98.55 H
+ATOM 1010 HD12 ILE A 65 -10.105 8.006 14.893 1.00 98.55 H
+ATOM 1011 HD13 ILE A 65 -8.610 7.376 14.196 1.00 98.55 H
+ATOM 1012 N ALA A 66 -10.896 3.209 10.101 1.00 98.65 N
+ATOM 1013 H ALA A 66 -11.668 3.027 10.726 1.00 98.65 H
+ATOM 1014 CA ALA A 66 -10.499 2.145 9.174 1.00 98.65 C
+ATOM 1015 HA ALA A 66 -9.421 2.008 9.247 1.00 98.65 H
+ATOM 1016 C ALA A 66 -10.815 2.503 7.708 1.00 98.65 C
+ATOM 1017 CB ALA A 66 -11.183 0.835 9.589 1.00 98.65 C
+ATOM 1018 HB1 ALA A 66 -10.953 0.605 10.630 1.00 98.65 H
+ATOM 1019 HB2 ALA A 66 -12.262 0.904 9.457 1.00 98.65 H
+ATOM 1020 HB3 ALA A 66 -10.816 0.018 8.967 1.00 98.65 H
+ATOM 1021 O ALA A 66 -10.002 2.262 6.821 1.00 98.65 O
+ATOM 1022 N THR A 67 -11.968 3.134 7.454 1.00 98.61 N
+ATOM 1023 H THR A 67 -12.567 3.365 8.234 1.00 98.61 H
+ATOM 1024 CA THR A 67 -12.333 3.624 6.112 1.00 98.61 C
+ATOM 1025 HA THR A 67 -12.060 2.872 5.371 1.00 98.61 H
+ATOM 1026 C THR A 67 -11.563 4.895 5.740 1.00 98.61 C
+ATOM 1027 CB THR A 67 -13.849 3.838 6.017 1.00 98.61 C
+ATOM 1028 HB THR A 67 -14.162 4.575 6.756 1.00 98.61 H
+ATOM 1029 O THR A 67 -11.129 5.027 4.600 1.00 98.61 O
+ATOM 1030 CG2 THR A 67 -14.321 4.279 4.635 1.00 98.61 C
+ATOM 1031 HG21 THR A 67 -13.931 3.609 3.869 1.00 98.61 H
+ATOM 1032 HG22 THR A 67 -15.411 4.275 4.594 1.00 98.61 H
+ATOM 1033 HG23 THR A 67 -13.970 5.290 4.425 1.00 98.61 H
+ATOM 1034 OG1 THR A 67 -14.481 2.607 6.295 1.00 98.61 O
+ATOM 1035 HG1 THR A 67 -13.814 2.033 6.680 1.00 98.61 H
+ATOM 1036 N ALA A 68 -11.301 5.793 6.696 1.00 98.73 N
+ATOM 1037 H ALA A 68 -11.692 5.661 7.618 1.00 98.73 H
+ATOM 1038 CA ALA A 68 -10.458 6.969 6.456 1.00 98.73 C
+ATOM 1039 HA ALA A 68 -10.879 7.531 5.622 1.00 98.73 H
+ATOM 1040 C ALA A 68 -9.015 6.590 6.069 1.00 98.73 C
+ATOM 1041 CB ALA A 68 -10.484 7.860 7.703 1.00 98.73 C
+ATOM 1042 HB1 ALA A 68 -9.954 8.788 7.491 1.00 98.73 H
+ATOM 1043 HB2 ALA A 68 -11.513 8.094 7.974 1.00 98.73 H
+ATOM 1044 HB3 ALA A 68 -9.987 7.356 8.532 1.00 98.73 H
+ATOM 1045 O ALA A 68 -8.438 7.194 5.168 1.00 98.73 O
+ATOM 1046 N LEU A 69 -8.448 5.552 6.695 1.00 98.71 N
+ATOM 1047 H LEU A 69 -8.944 5.123 7.462 1.00 98.71 H
+ATOM 1048 CA LEU A 69 -7.140 5.001 6.328 1.00 98.71 C
+ATOM 1049 HA LEU A 69 -6.402 5.803 6.338 1.00 98.71 H
+ATOM 1050 C LEU A 69 -7.135 4.436 4.903 1.00 98.71 C
+ATOM 1051 CB LEU A 69 -6.728 3.922 7.342 1.00 98.71 C
+ATOM 1052 HB2 LEU A 69 -5.909 3.334 6.927 1.00 98.71 H
+ATOM 1053 HB3 LEU A 69 -7.573 3.249 7.485 1.00 98.71 H
+ATOM 1054 O LEU A 69 -6.146 4.614 4.202 1.00 98.71 O
+ATOM 1055 CG LEU A 69 -6.282 4.482 8.705 1.00 98.71 C
+ATOM 1056 HG LEU A 69 -6.999 5.223 9.057 1.00 98.71 H
+ATOM 1057 CD1 LEU A 69 -6.218 3.346 9.724 1.00 98.71 C
+ATOM 1058 HD11 LEU A 69 -7.200 2.880 9.810 1.00 98.71 H
+ATOM 1059 HD12 LEU A 69 -5.933 3.746 10.697 1.00 98.71 H
+ATOM 1060 HD13 LEU A 69 -5.491 2.600 9.400 1.00 98.71 H
+ATOM 1061 CD2 LEU A 69 -4.903 5.141 8.644 1.00 98.71 C
+ATOM 1062 HD21 LEU A 69 -4.905 5.973 7.940 1.00 98.71 H
+ATOM 1063 HD22 LEU A 69 -4.632 5.525 9.628 1.00 98.71 H
+ATOM 1064 HD23 LEU A 69 -4.154 4.415 8.326 1.00 98.71 H
+ATOM 1065 N SER A 70 -8.243 3.849 4.435 1.00 98.73 N
+ATOM 1066 H SER A 70 -9.043 3.755 5.044 1.00 98.73 H
+ATOM 1067 CA SER A 70 -8.356 3.435 3.029 1.00 98.73 C
+ATOM 1068 HA SER A 70 -7.494 2.812 2.789 1.00 98.73 H
+ATOM 1069 C SER A 70 -8.302 4.640 2.084 1.00 98.73 C
+ATOM 1070 CB SER A 70 -9.606 2.584 2.789 1.00 98.73 C
+ATOM 1071 HB2 SER A 70 -9.672 2.323 1.733 1.00 98.73 H
+ATOM 1072 HB3 SER A 70 -10.503 3.134 3.074 1.00 98.73 H
+ATOM 1073 O SER A 70 -7.559 4.588 1.110 1.00 98.73 O
+ATOM 1074 OG SER A 70 -9.503 1.394 3.552 1.00 98.73 O
+ATOM 1075 HG SER A 70 -9.103 1.619 4.395 1.00 98.73 H
+ATOM 1076 N CYS A 71 -8.964 5.763 2.398 1.00 98.75 N
+ATOM 1077 H CYS A 71 -9.588 5.763 3.192 1.00 98.75 H
+ATOM 1078 CA CYS A 71 -8.813 7.004 1.622 1.00 98.75 C
+ATOM 1079 HA CYS A 71 -9.123 6.812 0.595 1.00 98.75 H
+ATOM 1080 C CYS A 71 -7.351 7.489 1.572 1.00 98.75 C
+ATOM 1081 CB CYS A 71 -9.696 8.121 2.201 1.00 98.75 C
+ATOM 1082 HB2 CYS A 71 -9.546 9.022 1.606 1.00 98.75 H
+ATOM 1083 HB3 CYS A 71 -9.399 8.342 3.227 1.00 98.75 H
+ATOM 1084 O CYS A 71 -6.852 7.832 0.501 1.00 98.75 O
+ATOM 1085 SG CYS A 71 -11.454 7.682 2.158 1.00 98.75 S
+ATOM 1086 HG CYS A 71 -11.937 8.904 2.401 1.00 98.75 H
+ATOM 1087 N ILE A 72 -6.654 7.482 2.714 1.00 98.73 N
+ATOM 1088 H ILE A 72 -7.131 7.195 3.557 1.00 98.73 H
+ATOM 1089 CA ILE A 72 -5.238 7.882 2.812 1.00 98.73 C
+ATOM 1090 HA ILE A 72 -5.132 8.895 2.423 1.00 98.73 H
+ATOM 1091 C ILE A 72 -4.353 6.975 1.947 1.00 98.73 C
+ATOM 1092 CB ILE A 72 -4.781 7.889 4.291 1.00 98.73 C
+ATOM 1093 HB ILE A 72 -5.040 6.930 4.739 1.00 98.73 H
+ATOM 1094 O ILE A 72 -3.505 7.463 1.201 1.00 98.73 O
+ATOM 1095 CG1 ILE A 72 -5.506 9.013 5.068 1.00 98.73 C
+ATOM 1096 HG12 ILE A 72 -6.565 9.018 4.810 1.00 98.73 H
+ATOM 1097 HG13 ILE A 72 -5.096 9.978 4.771 1.00 98.73 H
+ATOM 1098 CG2 ILE A 72 -3.254 8.071 4.409 1.00 98.73 C
+ATOM 1099 HG21 ILE A 72 -2.729 7.227 3.960 1.00 98.73 H
+ATOM 1100 HG22 ILE A 72 -2.948 8.113 5.454 1.00 98.73 H
+ATOM 1101 HG23 ILE A 72 -2.944 8.988 3.909 1.00 98.73 H
+ATOM 1102 CD1 ILE A 72 -5.416 8.879 6.593 1.00 98.73 C
+ATOM 1103 HD11 ILE A 72 -5.842 7.927 6.909 1.00 98.73 H
+ATOM 1104 HD12 ILE A 72 -5.986 9.685 7.056 1.00 98.73 H
+ATOM 1105 HD13 ILE A 72 -4.382 8.950 6.931 1.00 98.73 H
+ATOM 1106 N VAL A 73 -4.572 5.659 1.999 1.00 98.77 N
+ATOM 1107 H VAL A 73 -5.268 5.310 2.643 1.00 98.77 H
+ATOM 1108 CA VAL A 73 -3.837 4.698 1.167 1.00 98.77 C
+ATOM 1109 HA VAL A 73 -2.769 4.871 1.301 1.00 98.77 H
+ATOM 1110 C VAL A 73 -4.131 4.915 -0.317 1.00 98.77 C
+ATOM 1111 CB VAL A 73 -4.141 3.248 1.592 1.00 98.77 C
+ATOM 1112 HB VAL A 73 -5.220 3.094 1.614 1.00 98.77 H
+ATOM 1113 O VAL A 73 -3.198 4.855 -1.114 1.00 98.77 O
+ATOM 1114 CG1 VAL A 73 -3.517 2.218 0.641 1.00 98.77 C
+ATOM 1115 HG11 VAL A 73 -3.714 1.211 1.010 1.00 98.77 H
+ATOM 1116 HG12 VAL A 73 -2.441 2.375 0.569 1.00 98.77 H
+ATOM 1117 HG13 VAL A 73 -3.955 2.303 -0.354 1.00 98.77 H
+ATOM 1118 CG2 VAL A 73 -3.562 2.951 2.982 1.00 98.77 C
+ATOM 1119 HG21 VAL A 73 -3.900 3.694 3.705 1.00 98.77 H
+ATOM 1120 HG22 VAL A 73 -3.893 1.968 3.317 1.00 98.77 H
+ATOM 1121 HG23 VAL A 73 -2.472 2.974 2.948 1.00 98.77 H
+ATOM 1122 N MET A 74 -5.382 5.197 -0.700 1.00 98.83 N
+ATOM 1123 H MET A 74 -6.112 5.218 -0.003 1.00 98.83 H
+ATOM 1124 CA MET A 74 -5.746 5.431 -2.103 1.00 98.83 C
+ATOM 1125 HA MET A 74 -5.434 4.571 -2.695 1.00 98.83 H
+ATOM 1126 C MET A 74 -5.022 6.641 -2.694 1.00 98.83 C
+ATOM 1127 CB MET A 74 -7.259 5.620 -2.278 1.00 98.83 C
+ATOM 1128 HB2 MET A 74 -7.419 5.974 -3.296 1.00 98.83 H
+ATOM 1129 HB3 MET A 74 -7.616 6.392 -1.596 1.00 98.83 H
+ATOM 1130 O MET A 74 -4.444 6.522 -3.771 1.00 98.83 O
+ATOM 1131 CG MET A 74 -8.120 4.367 -2.101 1.00 98.83 C
+ATOM 1132 HG2 MET A 74 -9.135 4.630 -2.400 1.00 98.83 H
+ATOM 1133 HG3 MET A 74 -8.161 4.076 -1.051 1.00 98.83 H
+ATOM 1134 SD MET A 74 -7.631 2.923 -3.069 1.00 98.83 S
+ATOM 1135 CE MET A 74 -6.765 1.965 -1.810 1.00 98.83 C
+ATOM 1136 HE1 MET A 74 -7.452 1.699 -1.007 1.00 98.83 H
+ATOM 1137 HE2 MET A 74 -6.392 1.057 -2.283 1.00 98.83 H
+ATOM 1138 HE3 MET A 74 -5.934 2.545 -1.409 1.00 98.83 H
+ATOM 1139 N VAL A 75 -4.998 7.781 -1.992 1.00 98.51 N
+ATOM 1140 H VAL A 75 -5.488 7.826 -1.111 1.00 98.51 H
+ATOM 1141 CA VAL A 75 -4.282 8.968 -2.489 1.00 98.51 C
+ATOM 1142 HA VAL A 75 -4.566 9.108 -3.532 1.00 98.51 H
+ATOM 1143 C VAL A 75 -2.768 8.752 -2.491 1.00 98.51 C
+ATOM 1144 CB VAL A 75 -4.701 10.250 -1.743 1.00 98.51 C
+ATOM 1145 HB VAL A 75 -5.786 10.332 -1.818 1.00 98.51 H
+ATOM 1146 O VAL A 75 -2.108 9.090 -3.466 1.00 98.51 O
+ATOM 1147 CG1 VAL A 75 -4.339 10.267 -0.254 1.00 98.51 C
+ATOM 1148 HG11 VAL A 75 -3.259 10.227 -0.112 1.00 98.51 H
+ATOM 1149 HG12 VAL A 75 -4.812 9.419 0.242 1.00 98.51 H
+ATOM 1150 HG13 VAL A 75 -4.717 11.182 0.201 1.00 98.51 H
+ATOM 1151 CG2 VAL A 75 -4.104 11.496 -2.401 1.00 98.51 C
+ATOM 1152 HG21 VAL A 75 -4.521 12.393 -1.943 1.00 98.51 H
+ATOM 1153 HG22 VAL A 75 -3.020 11.509 -2.281 1.00 98.51 H
+ATOM 1154 HG23 VAL A 75 -4.343 11.504 -3.464 1.00 98.51 H
+ATOM 1155 N SER A 76 -2.210 8.125 -1.454 1.00 98.62 N
+ATOM 1156 H SER A 76 -2.799 7.858 -0.678 1.00 98.62 H
+ATOM 1157 CA SER A 76 -0.772 7.843 -1.375 1.00 98.62 C
+ATOM 1158 HA SER A 76 -0.222 8.776 -1.498 1.00 98.62 H
+ATOM 1159 C SER A 76 -0.304 6.895 -2.488 1.00 98.62 C
+ATOM 1160 CB SER A 76 -0.468 7.291 0.019 1.00 98.62 C
+ATOM 1161 HB2 SER A 76 -0.480 8.108 0.740 1.00 98.62 H
+ATOM 1162 HB3 SER A 76 -1.246 6.578 0.293 1.00 98.62 H
+ATOM 1163 O SER A 76 0.675 7.184 -3.173 1.00 98.62 O
+ATOM 1164 OG SER A 76 0.763 6.613 0.085 1.00 98.62 O
+ATOM 1165 HG SER A 76 1.496 7.144 -0.235 1.00 98.62 H
+ATOM 1166 N ALA A 77 -1.011 5.785 -2.713 1.00 98.43 N
+ATOM 1167 H ALA A 77 -1.824 5.598 -2.144 1.00 98.43 H
+ATOM 1168 CA ALA A 77 -0.680 4.844 -3.779 1.00 98.43 C
+ATOM 1169 HA ALA A 77 0.387 4.623 -3.734 1.00 98.43 H
+ATOM 1170 C ALA A 77 -0.955 5.429 -5.171 1.00 98.43 C
+ATOM 1171 CB ALA A 77 -1.451 3.545 -3.541 1.00 98.43 C
+ATOM 1172 HB1 ALA A 77 -1.177 3.139 -2.567 1.00 98.43 H
+ATOM 1173 HB2 ALA A 77 -2.523 3.743 -3.562 1.00 98.43 H
+ATOM 1174 HB3 ALA A 77 -1.208 2.824 -4.321 1.00 98.43 H
+ATOM 1175 O ALA A 77 -0.116 5.290 -6.055 1.00 98.43 O
+ATOM 1176 N GLY A 78 -2.080 6.129 -5.353 1.00 98.58 N
+ATOM 1177 H GLY A 78 -2.740 6.212 -4.593 1.00 98.58 H
+ATOM 1178 CA GLY A 78 -2.415 6.794 -6.612 1.00 98.58 C
+ATOM 1179 HA2 GLY A 78 -2.489 6.053 -7.408 1.00 98.58 H
+ATOM 1180 HA3 GLY A 78 -3.380 7.288 -6.502 1.00 98.58 H
+ATOM 1181 C GLY A 78 -1.380 7.845 -7.017 1.00 98.58 C
+ATOM 1182 O GLY A 78 -0.984 7.884 -8.176 1.00 98.58 O
+ATOM 1183 N LEU A 79 -0.879 8.646 -6.069 1.00 98.70 N
+ATOM 1184 H LEU A 79 -1.256 8.591 -5.133 1.00 98.70 H
+ATOM 1185 CA LEU A 79 0.170 9.636 -6.337 1.00 98.70 C
+ATOM 1186 HA LEU A 79 -0.133 10.245 -7.189 1.00 98.70 H
+ATOM 1187 C LEU A 79 1.500 8.992 -6.738 1.00 98.70 C
+ATOM 1188 CB LEU A 79 0.371 10.540 -5.108 1.00 98.70 C
+ATOM 1189 HB2 LEU A 79 0.441 9.912 -4.220 1.00 98.70 H
+ATOM 1190 HB3 LEU A 79 1.323 11.061 -5.214 1.00 98.70 H
+ATOM 1191 O LEU A 79 2.146 9.477 -7.662 1.00 98.70 O
+ATOM 1192 CG LEU A 79 -0.726 11.599 -4.904 1.00 98.70 C
+ATOM 1193 HG LEU A 79 -1.708 11.127 -4.879 1.00 98.70 H
+ATOM 1194 CD1 LEU A 79 -0.487 12.314 -3.573 1.00 98.70 C
+ATOM 1195 HD11 LEU A 79 0.483 12.811 -3.586 1.00 98.70 H
+ATOM 1196 HD12 LEU A 79 -0.511 11.587 -2.761 1.00 98.70 H
+ATOM 1197 HD13 LEU A 79 -1.269 13.056 -3.409 1.00 98.70 H
+ATOM 1198 CD2 LEU A 79 -0.736 12.652 -6.014 1.00 98.70 C
+ATOM 1199 HD21 LEU A 79 -1.465 13.428 -5.782 1.00 98.70 H
+ATOM 1200 HD22 LEU A 79 0.250 13.106 -6.111 1.00 98.70 H
+ATOM 1201 HD23 LEU A 79 -1.017 12.200 -6.966 1.00 98.70 H
+ATOM 1202 N ILE A 80 1.900 7.891 -6.096 1.00 98.48 N
+ATOM 1203 H ILE A 80 1.345 7.546 -5.326 1.00 98.48 H
+ATOM 1204 CA ILE A 80 3.124 7.177 -6.484 1.00 98.48 C
+ATOM 1205 HA ILE A 80 3.922 7.908 -6.620 1.00 98.48 H
+ATOM 1206 C ILE A 80 2.966 6.493 -7.834 1.00 98.48 C
+ATOM 1207 CB ILE A 80 3.553 6.191 -5.389 1.00 98.48 C
+ATOM 1208 HB ILE A 80 2.673 5.627 -5.078 1.00 98.48 H
+ATOM 1209 O ILE A 80 3.879 6.578 -8.642 1.00 98.48 O
+ATOM 1210 CG1 ILE A 80 4.063 6.975 -4.169 1.00 98.48 C
+ATOM 1211 HG12 ILE A 80 4.162 6.240 -3.371 1.00 98.48 H
+ATOM 1212 HG13 ILE A 80 3.311 7.696 -3.848 1.00 98.48 H
+ATOM 1213 CG2 ILE A 80 4.608 5.165 -5.853 1.00 98.48 C
+ATOM 1214 HG21 ILE A 80 4.167 4.466 -6.564 1.00 98.48 H
+ATOM 1215 HG22 ILE A 80 4.985 4.601 -4.999 1.00 98.48 H
+ATOM 1216 HG23 ILE A 80 5.441 5.673 -6.340 1.00 98.48 H
+ATOM 1217 CD1 ILE A 80 5.411 7.699 -4.309 1.00 98.48 C
+ATOM 1218 HD11 ILE A 80 5.652 8.185 -3.364 1.00 98.48 H
+ATOM 1219 HD12 ILE A 80 5.360 8.462 -5.086 1.00 98.48 H
+ATOM 1220 HD13 ILE A 80 6.205 6.990 -4.543 1.00 98.48 H
+ATOM 1221 N LEU A 81 1.825 5.863 -8.123 1.00 98.57 N
+ATOM 1222 H LEU A 81 1.097 5.824 -7.425 1.00 98.57 H
+ATOM 1223 CA LEU A 81 1.571 5.278 -9.443 1.00 98.57 C
+ATOM 1224 HA LEU A 81 2.374 4.582 -9.685 1.00 98.57 H
+ATOM 1225 C LEU A 81 1.596 6.346 -10.543 1.00 98.57 C
+ATOM 1226 CB LEU A 81 0.231 4.525 -9.424 1.00 98.57 C
+ATOM 1227 HB2 LEU A 81 -0.535 5.188 -9.021 1.00 98.57 H
+ATOM 1228 HB3 LEU A 81 -0.049 4.278 -10.448 1.00 98.57 H
+ATOM 1229 O LEU A 81 2.208 6.125 -11.582 1.00 98.57 O
+ATOM 1230 CG LEU A 81 0.261 3.225 -8.602 1.00 98.57 C
+ATOM 1231 HG LEU A 81 0.681 3.413 -7.614 1.00 98.57 H
+ATOM 1232 CD1 LEU A 81 -1.159 2.691 -8.426 1.00 98.57 C
+ATOM 1233 HD11 LEU A 81 -1.774 3.442 -7.930 1.00 98.57 H
+ATOM 1234 HD12 LEU A 81 -1.134 1.790 -7.813 1.00 98.57 H
+ATOM 1235 HD13 LEU A 81 -1.580 2.457 -9.403 1.00 98.57 H
+ATOM 1236 CD2 LEU A 81 1.096 2.136 -9.278 1.00 98.57 C
+ATOM 1237 HD21 LEU A 81 2.139 2.448 -9.323 1.00 98.57 H
+ATOM 1238 HD22 LEU A 81 1.013 1.211 -8.706 1.00 98.57 H
+ATOM 1239 HD23 LEU A 81 0.728 1.965 -10.289 1.00 98.57 H
+ATOM 1240 N ASN A 82 1.023 7.524 -10.281 1.00 98.61 N
+ATOM 1241 H ASN A 82 0.497 7.628 -9.424 1.00 98.61 H
+ATOM 1242 CA ASN A 82 1.076 8.662 -11.196 1.00 98.61 C
+ATOM 1243 HA ASN A 82 0.714 8.353 -12.177 1.00 98.61 H
+ATOM 1244 C ASN A 82 2.513 9.160 -11.387 1.00 98.61 C
+ATOM 1245 CB ASN A 82 0.160 9.766 -10.649 1.00 98.61 C
+ATOM 1246 HB2 ASN A 82 -0.851 9.374 -10.535 1.00 98.61 H
+ATOM 1247 HB3 ASN A 82 0.512 10.104 -9.674 1.00 98.61 H
+ATOM 1248 O ASN A 82 2.942 9.402 -12.508 1.00 98.61 O
+ATOM 1249 CG ASN A 82 0.089 10.949 -11.592 1.00 98.61 C
+ATOM 1250 ND2 ASN A 82 0.920 11.951 -11.419 1.00 98.61 N
+ATOM 1251 HD21 ASN A 82 0.908 12.637 -12.160 1.00 98.61 H
+ATOM 1252 HD22 ASN A 82 1.685 11.884 -10.763 1.00 98.61 H
+ATOM 1253 OD1 ASN A 82 -0.725 10.989 -12.491 1.00 98.61 O
+ATOM 1254 N SER A 83 3.274 9.279 -10.296 1.00 98.29 N
+ATOM 1255 H SER A 83 2.863 9.092 -9.393 1.00 98.29 H
+ATOM 1256 CA SER A 83 4.687 9.653 -10.361 1.00 98.29 C
+ATOM 1257 HA SER A 83 4.772 10.616 -10.864 1.00 98.29 H
+ATOM 1258 C SER A 83 5.504 8.635 -11.155 1.00 98.29 C
+ATOM 1259 CB SER A 83 5.264 9.786 -8.951 1.00 98.29 C
+ATOM 1260 HB2 SER A 83 5.374 8.799 -8.501 1.00 98.29 H
+ATOM 1261 HB3 SER A 83 4.585 10.377 -8.336 1.00 98.29 H
+ATOM 1262 O SER A 83 6.335 9.040 -11.956 1.00 98.29 O
+ATOM 1263 OG SER A 83 6.518 10.435 -8.978 1.00 98.29 O
+ATOM 1264 HG SER A 83 7.018 10.168 -9.752 1.00 98.29 H
+ATOM 1265 N GLN A 84 5.274 7.331 -10.959 1.00 98.34 N
+ATOM 1266 H GLN A 84 4.586 7.059 -10.270 1.00 98.34 H
+ATOM 1267 CA GLN A 84 5.944 6.276 -11.723 1.00 98.34 C
+ATOM 1268 HA GLN A 84 7.023 6.411 -11.647 1.00 98.34 H
+ATOM 1269 C GLN A 84 5.593 6.359 -13.212 1.00 98.34 C
+ATOM 1270 CB GLN A 84 5.580 4.876 -11.196 1.00 98.34 C
+ATOM 1271 HB2 GLN A 84 4.494 4.792 -11.150 1.00 98.34 H
+ATOM 1272 HB3 GLN A 84 5.930 4.133 -11.912 1.00 98.34 H
+ATOM 1273 O GLN A 84 6.490 6.179 -14.021 1.00 98.34 O
+ATOM 1274 CG GLN A 84 6.149 4.500 -9.820 1.00 98.34 C
+ATOM 1275 HG2 GLN A 84 5.756 3.520 -9.547 1.00 98.34 H
+ATOM 1276 HG3 GLN A 84 5.808 5.215 -9.072 1.00 98.34 H
+ATOM 1277 CD GLN A 84 7.667 4.442 -9.736 1.00 98.34 C
+ATOM 1278 NE2 GLN A 84 8.331 3.471 -10.313 1.00 98.34 N
+ATOM 1279 HE21 GLN A 84 7.938 2.934 -11.073 1.00 98.34 H
+ATOM 1280 HE22 GLN A 84 9.331 3.542 -10.194 1.00 98.34 H
+ATOM 1281 OE1 GLN A 84 8.282 5.238 -9.058 1.00 98.34 O
+ATOM 1282 N ALA A 85 4.335 6.638 -13.575 1.00 98.44 N
+ATOM 1283 H ALA A 85 3.624 6.743 -12.866 1.00 98.44 H
+ATOM 1284 CA ALA A 85 3.931 6.793 -14.975 1.00 98.44 C
+ATOM 1285 HA ALA A 85 4.190 5.890 -15.529 1.00 98.44 H
+ATOM 1286 C ALA A 85 4.674 7.958 -15.648 1.00 98.44 C
+ATOM 1287 CB ALA A 85 2.409 6.973 -15.046 1.00 98.44 C
+ATOM 1288 HB1 ALA A 85 1.902 6.143 -14.553 1.00 98.44 H
+ATOM 1289 HB2 ALA A 85 2.112 7.909 -14.573 1.00 98.44 H
+ATOM 1290 HB3 ALA A 85 2.102 6.995 -16.091 1.00 98.44 H
+ATOM 1291 O ALA A 85 5.302 7.770 -16.682 1.00 98.44 O
+ATOM 1292 N VAL A 86 4.707 9.130 -15.004 1.00 98.38 N
+ATOM 1293 H VAL A 86 4.165 9.228 -14.157 1.00 98.38 H
+ATOM 1294 CA VAL A 86 5.430 10.303 -15.529 1.00 98.38 C
+ATOM 1295 HA VAL A 86 5.095 10.489 -16.549 1.00 98.38 H
+ATOM 1296 C VAL A 86 6.937 10.044 -15.609 1.00 98.38 C
+ATOM 1297 CB VAL A 86 5.127 11.557 -14.690 1.00 98.38 C
+ATOM 1298 HB VAL A 86 5.365 11.355 -13.645 1.00 98.38 H
+ATOM 1299 O VAL A 86 7.550 10.312 -16.634 1.00 98.38 O
+ATOM 1300 CG1 VAL A 86 5.935 12.777 -15.144 1.00 98.38 C
+ATOM 1301 HG11 VAL A 86 5.795 12.948 -16.211 1.00 98.38 H
+ATOM 1302 HG12 VAL A 86 5.632 13.667 -14.593 1.00 98.38 H
+ATOM 1303 HG13 VAL A 86 6.999 12.620 -14.967 1.00 98.38 H
+ATOM 1304 CG2 VAL A 86 3.641 11.934 -14.785 1.00 98.38 C
+ATOM 1305 HG21 VAL A 86 3.389 12.158 -15.822 1.00 98.38 H
+ATOM 1306 HG22 VAL A 86 3.441 12.810 -14.168 1.00 98.38 H
+ATOM 1307 HG23 VAL A 86 3.012 11.111 -14.444 1.00 98.38 H
+ATOM 1308 N MET A 87 7.540 9.456 -14.571 1.00 97.52 N
+ATOM 1309 H MET A 87 6.994 9.247 -13.746 1.00 97.52 H
+ATOM 1310 CA MET A 87 8.962 9.086 -14.594 1.00 97.52 C
+ATOM 1311 HA MET A 87 9.558 9.970 -14.819 1.00 97.52 H
+ATOM 1312 C MET A 87 9.280 8.057 -15.683 1.00 97.52 C
+ATOM 1313 CB MET A 87 9.381 8.531 -13.227 1.00 97.52 C
+ATOM 1314 HB2 MET A 87 10.321 7.989 -13.331 1.00 97.52 H
+ATOM 1315 HB3 MET A 87 8.629 7.827 -12.872 1.00 97.52 H
+ATOM 1316 O MET A 87 10.352 8.108 -16.274 1.00 97.52 O
+ATOM 1317 CG MET A 87 9.584 9.657 -12.210 1.00 97.52 C
+ATOM 1318 HG2 MET A 87 8.638 10.175 -12.055 1.00 97.52 H
+ATOM 1319 HG3 MET A 87 10.287 10.373 -12.636 1.00 97.52 H
+ATOM 1320 SD MET A 87 10.242 9.139 -10.600 1.00 97.52 S
+ATOM 1321 CE MET A 87 8.952 8.000 -10.057 1.00 97.52 C
+ATOM 1322 HE1 MET A 87 9.107 7.739 -9.010 1.00 97.52 H
+ATOM 1323 HE2 MET A 87 7.976 8.476 -10.154 1.00 97.52 H
+ATOM 1324 HE3 MET A 87 8.987 7.098 -10.667 1.00 97.52 H
+ATOM 1325 N TRP A 88 8.360 7.130 -15.963 1.00 98.29 N
+ATOM 1326 H TRP A 88 7.486 7.139 -15.457 1.00 98.29 H
+ATOM 1327 CA TRP A 88 8.505 6.161 -17.047 1.00 98.29 C
+ATOM 1328 HA TRP A 88 9.464 5.651 -16.949 1.00 98.29 H
+ATOM 1329 C TRP A 88 8.519 6.861 -18.406 1.00 98.29 C
+ATOM 1330 CB TRP A 88 7.383 5.120 -16.960 1.00 98.29 C
+ATOM 1331 HB2 TRP A 88 7.446 4.611 -15.998 1.00 98.29 H
+ATOM 1332 HB3 TRP A 88 6.413 5.616 -17.008 1.00 98.29 H
+ATOM 1333 O TRP A 88 9.396 6.589 -19.219 1.00 98.29 O
+ATOM 1334 CG TRP A 88 7.422 4.083 -18.027 1.00 98.29 C
+ATOM 1335 CD1 TRP A 88 6.526 3.937 -19.029 1.00 98.29 C
+ATOM 1336 HD1 TRP A 88 5.661 4.566 -19.179 1.00 98.29 H
+ATOM 1337 CD2 TRP A 88 8.444 3.071 -18.246 1.00 98.29 C
+ATOM 1338 CE2 TRP A 88 8.100 2.335 -19.418 1.00 98.29 C
+ATOM 1339 CE3 TRP A 88 9.629 2.712 -17.566 1.00 98.29 C
+ATOM 1340 HE3 TRP A 88 9.911 3.256 -16.677 1.00 98.29 H
+ATOM 1341 NE1 TRP A 88 6.909 2.889 -19.843 1.00 98.29 N
+ATOM 1342 HE1 TRP A 88 6.396 2.623 -20.672 1.00 98.29 H
+ATOM 1343 CH2 TRP A 88 10.082 0.972 -19.203 1.00 98.29 C
+ATOM 1344 HH2 TRP A 88 10.714 0.178 -19.574 1.00 98.29 H
+ATOM 1345 CZ2 TRP A 88 8.909 1.297 -19.896 1.00 98.29 C
+ATOM 1346 HZ2 TRP A 88 8.649 0.753 -20.791 1.00 98.29 H
+ATOM 1347 CZ3 TRP A 88 10.441 1.668 -18.040 1.00 98.29 C
+ATOM 1348 HZ3 TRP A 88 11.351 1.403 -17.522 1.00 98.29 H
+ATOM 1349 N THR A 89 7.615 7.814 -18.633 1.00 98.10 N
+ATOM 1350 H THR A 89 6.899 8.001 -17.945 1.00 98.10 H
+ATOM 1351 CA THR A 89 7.577 8.570 -19.890 1.00 98.10 C
+ATOM 1352 HA THR A 89 7.710 7.862 -20.708 1.00 98.10 H
+ATOM 1353 C THR A 89 8.717 9.569 -20.043 1.00 98.10 C
+ATOM 1354 CB THR A 89 6.225 9.253 -20.108 1.00 98.10 C
+ATOM 1355 HB THR A 89 6.273 9.839 -21.026 1.00 98.10 H
+ATOM 1356 O THR A 89 9.200 9.765 -21.152 1.00 98.10 O
+ATOM 1357 CG2 THR A 89 5.101 8.223 -20.249 1.00 98.10 C
+ATOM 1358 HG21 THR A 89 5.317 7.545 -21.075 1.00 98.10 H
+ATOM 1359 HG22 THR A 89 4.988 7.646 -19.332 1.00 98.10 H
+ATOM 1360 HG23 THR A 89 4.161 8.736 -20.452 1.00 98.10 H
+ATOM 1361 OG1 THR A 89 5.887 10.109 -19.039 1.00 98.10 O
+ATOM 1362 HG1 THR A 89 6.646 10.655 -18.820 1.00 98.10 H
+ATOM 1363 N ASP A 90 9.181 10.172 -18.949 1.00 97.71 N
+ATOM 1364 H ASP A 90 8.700 10.021 -18.074 1.00 97.71 H
+ATOM 1365 CA ASP A 90 10.290 11.131 -18.961 1.00 97.71 C
+ATOM 1366 HA ASP A 90 10.153 11.837 -19.780 1.00 97.71 H
+ATOM 1367 C ASP A 90 11.652 10.446 -19.167 1.00 97.71 C
+ATOM 1368 CB ASP A 90 10.303 11.910 -17.633 1.00 97.71 C
+ATOM 1369 HB2 ASP A 90 10.231 11.207 -16.803 1.00 97.71 H
+ATOM 1370 HB3 ASP A 90 11.267 12.411 -17.546 1.00 97.71 H
+ATOM 1371 O ASP A 90 12.577 11.044 -19.719 1.00 97.71 O
+ATOM 1372 CG ASP A 90 9.218 12.987 -17.488 1.00 97.71 C
+ATOM 1373 OD1 ASP A 90 8.520 13.296 -18.480 1.00 97.71 O
+ATOM 1374 OD2 ASP A 90 9.130 13.544 -16.367 1.00 97.71 O
+ATOM 1375 N ALA A 91 11.799 9.198 -18.709 1.00 97.23 N
+ATOM 1376 H ALA A 91 11.024 8.769 -18.225 1.00 97.23 H
+ATOM 1377 CA ALA A 91 13.057 8.461 -18.787 1.00 97.23 C
+ATOM 1378 HA ALA A 91 13.869 9.139 -18.526 1.00 97.23 H
+ATOM 1379 C ALA A 91 13.375 7.924 -20.191 1.00 97.23 C
+ATOM 1380 CB ALA A 91 13.036 7.338 -17.744 1.00 97.23 C
+ATOM 1381 HB1 ALA A 91 12.931 7.770 -16.749 1.00 97.23 H
+ATOM 1382 HB2 ALA A 91 12.198 6.667 -17.935 1.00 97.23 H
+ATOM 1383 HB3 ALA A 91 13.969 6.776 -17.790 1.00 97.23 H
+ATOM 1384 O ALA A 91 14.546 7.679 -20.468 1.00 97.23 O
+ATOM 1385 N TYR A 92 12.391 7.754 -21.083 1.00 98.08 N
+ATOM 1386 H TYR A 92 11.455 8.045 -20.840 1.00 98.08 H
+ATOM 1387 CA TYR A 92 12.603 7.137 -22.398 1.00 98.08 C
+ATOM 1388 HA TYR A 92 13.674 7.030 -22.568 1.00 98.08 H
+ATOM 1389 C TYR A 92 12.038 7.973 -23.546 1.00 98.08 C
+ATOM 1390 CB TYR A 92 11.996 5.734 -22.459 1.00 98.08 C
+ATOM 1391 HB2 TYR A 92 12.160 5.342 -23.463 1.00 98.08 H
+ATOM 1392 HB3 TYR A 92 10.920 5.833 -22.315 1.00 98.08 H
+ATOM 1393 O TYR A 92 10.949 8.529 -23.455 1.00 98.08 O
+ATOM 1394 CG TYR A 92 12.562 4.742 -21.466 1.00 98.08 C
+ATOM 1395 CD1 TYR A 92 13.583 3.856 -21.856 1.00 98.08 C
+ATOM 1396 HD1 TYR A 92 13.929 3.836 -22.879 1.00 98.08 H
+ATOM 1397 CD2 TYR A 92 12.094 4.731 -20.142 1.00 98.08 C
+ATOM 1398 HD2 TYR A 92 11.301 5.405 -19.853 1.00 98.08 H
+ATOM 1399 CE1 TYR A 92 14.177 3.010 -20.904 1.00 98.08 C
+ATOM 1400 HE1 TYR A 92 14.985 2.349 -21.184 1.00 98.08 H
+ATOM 1401 CE2 TYR A 92 12.667 3.879 -19.189 1.00 98.08 C
+ATOM 1402 HE2 TYR A 92 12.308 3.892 -18.171 1.00 98.08 H
+ATOM 1403 OH TYR A 92 14.291 2.238 -18.635 1.00 98.08 O
+ATOM 1404 HH TYR A 92 13.885 2.350 -17.773 1.00 98.08 H
+ATOM 1405 CZ TYR A 92 13.718 3.026 -19.570 1.00 98.08 C
+ATOM 1406 N ALA A 93 12.739 7.975 -24.680 1.00 98.34 N
+ATOM 1407 H ALA A 93 13.603 7.452 -24.709 1.00 98.34 H
+ATOM 1408 CA ALA A 93 12.256 8.558 -25.929 1.00 98.34 C
+ATOM 1409 HA ALA A 93 11.211 8.842 -25.811 1.00 98.34 H
+ATOM 1410 C ALA A 93 12.327 7.537 -27.064 1.00 98.34 C
+ATOM 1411 CB ALA A 93 13.045 9.828 -26.262 1.00 98.34 C
+ATOM 1412 HB1 ALA A 93 12.996 10.526 -25.426 1.00 98.34 H
+ATOM 1413 HB2 ALA A 93 12.617 10.305 -27.143 1.00 98.34 H
+ATOM 1414 HB3 ALA A 93 14.083 9.574 -26.475 1.00 98.34 H
+ATOM 1415 O ALA A 93 13.211 6.680 -27.087 1.00 98.34 O
+ATOM 1416 N TYR A 94 11.400 7.640 -28.016 1.00 98.24 N
+ATOM 1417 H TYR A 94 10.713 8.378 -27.952 1.00 98.24 H
+ATOM 1418 CA TYR A 94 11.365 6.764 -29.182 1.00 98.24 C
+ATOM 1419 HA TYR A 94 11.604 5.754 -28.850 1.00 98.24 H
+ATOM 1420 C TYR A 94 12.420 7.195 -30.213 1.00 98.24 C
+ATOM 1421 CB TYR A 94 9.946 6.730 -29.761 1.00 98.24 C
+ATOM 1422 HB2 TYR A 94 9.236 6.603 -28.943 1.00 98.24 H
+ATOM 1423 HB3 TYR A 94 9.722 7.682 -30.243 1.00 98.24 H
+ATOM 1424 O TYR A 94 12.274 8.237 -30.857 1.00 98.24 O
+ATOM 1425 CG TYR A 94 9.731 5.591 -30.735 1.00 98.24 C
+ATOM 1426 CD1 TYR A 94 9.623 5.833 -32.118 1.00 98.24 C
+ATOM 1427 HD1 TYR A 94 9.702 6.842 -32.494 1.00 98.24 H
+ATOM 1428 CD2 TYR A 94 9.656 4.276 -30.243 1.00 98.24 C
+ATOM 1429 HD2 TYR A 94 9.769 4.099 -29.184 1.00 98.24 H
+ATOM 1430 CE1 TYR A 94 9.412 4.757 -33.003 1.00 98.24 C
+ATOM 1431 HE1 TYR A 94 9.325 4.928 -34.066 1.00 98.24 H
+ATOM 1432 CE2 TYR A 94 9.460 3.197 -31.123 1.00 98.24 C
+ATOM 1433 HE2 TYR A 94 9.422 2.188 -30.739 1.00 98.24 H
+ATOM 1434 OH TYR A 94 9.168 2.397 -33.360 1.00 98.24 O
+ATOM 1435 HH TYR A 94 9.357 1.566 -32.918 1.00 98.24 H
+ATOM 1436 CZ TYR A 94 9.329 3.439 -32.505 1.00 98.24 C
+ATOM 1437 N VAL A 95 13.483 6.402 -30.357 1.00 98.24 N
+ATOM 1438 H VAL A 95 13.507 5.552 -29.813 1.00 98.24 H
+ATOM 1439 CA VAL A 95 14.652 6.660 -31.210 1.00 98.24 C
+ATOM 1440 HA VAL A 95 14.409 7.446 -31.924 1.00 98.24 H
+ATOM 1441 C VAL A 95 14.989 5.387 -31.988 1.00 98.24 C
+ATOM 1442 CB VAL A 95 15.860 7.133 -30.371 1.00 98.24 C
+ATOM 1443 HB VAL A 95 16.132 6.352 -29.660 1.00 98.24 H
+ATOM 1444 O VAL A 95 15.079 4.303 -31.419 1.00 98.24 O
+ATOM 1445 CG1 VAL A 95 17.076 7.437 -31.255 1.00 98.24 C
+ATOM 1446 HG11 VAL A 95 16.826 8.184 -32.009 1.00 98.24 H
+ATOM 1447 HG12 VAL A 95 17.422 6.528 -31.748 1.00 98.24 H
+ATOM 1448 HG13 VAL A 95 17.897 7.803 -30.640 1.00 98.24 H
+ATOM 1449 CG2 VAL A 95 15.537 8.410 -29.580 1.00 98.24 C
+ATOM 1450 HG21 VAL A 95 14.765 8.204 -28.839 1.00 98.24 H
+ATOM 1451 HG22 VAL A 95 15.190 9.193 -30.255 1.00 98.24 H
+ATOM 1452 HG23 VAL A 95 16.425 8.752 -29.049 1.00 98.24 H
+ATOM 1453 N ASP A 96 15.149 5.509 -33.307 1.00 97.40 N
+ATOM 1454 H ASP A 96 15.196 6.442 -33.692 1.00 97.40 H
+ATOM 1455 CA ASP A 96 15.567 4.421 -34.206 1.00 97.40 C
+ATOM 1456 HA ASP A 96 15.376 4.776 -35.219 1.00 97.40 H
+ATOM 1457 C ASP A 96 14.742 3.117 -34.107 1.00 97.40 C
+ATOM 1458 CB ASP A 96 17.090 4.219 -34.114 1.00 97.40 C
+ATOM 1459 HB2 ASP A 96 17.354 3.915 -33.100 1.00 97.40 H
+ATOM 1460 HB3 ASP A 96 17.388 3.423 -34.796 1.00 97.40 H
+ATOM 1461 O ASP A 96 15.232 2.023 -34.379 1.00 97.40 O
+ATOM 1462 CG ASP A 96 17.872 5.479 -34.500 1.00 97.40 C
+ATOM 1463 OD1 ASP A 96 17.353 6.264 -35.332 1.00 97.40 O
+ATOM 1464 OD2 ASP A 96 18.994 5.648 -33.976 1.00 97.40 O
+ATOM 1465 N GLY A 97 13.452 3.231 -33.769 1.00 96.93 N
+ATOM 1466 H GLY A 97 13.132 4.144 -33.477 1.00 96.93 H
+ATOM 1467 CA GLY A 97 12.507 2.109 -33.745 1.00 96.93 C
+ATOM 1468 HA2 GLY A 97 11.562 2.452 -34.165 1.00 96.93 H
+ATOM 1469 HA3 GLY A 97 12.879 1.306 -34.381 1.00 96.93 H
+ATOM 1470 C GLY A 97 12.229 1.506 -32.361 1.00 96.93 C
+ATOM 1471 O GLY A 97 11.371 0.622 -32.262 1.00 96.93 O
+ATOM 1472 N SER A 98 12.876 1.994 -31.298 1.00 98.23 N
+ATOM 1473 H SER A 98 13.597 2.687 -31.441 1.00 98.23 H
+ATOM 1474 CA SER A 98 12.673 1.567 -29.905 1.00 98.23 C
+ATOM 1475 HA SER A 98 11.714 1.055 -29.819 1.00 98.23 H
+ATOM 1476 C SER A 98 12.641 2.755 -28.935 1.00 98.23 C
+ATOM 1477 CB SER A 98 13.768 0.576 -29.482 1.00 98.23 C
+ATOM 1478 HB2 SER A 98 13.599 0.269 -28.450 1.00 98.23 H
+ATOM 1479 HB3 SER A 98 13.725 -0.306 -30.121 1.00 98.23 H
+ATOM 1480 O SER A 98 13.086 3.853 -29.252 1.00 98.23 O
+ATOM 1481 OG SER A 98 15.047 1.170 -29.593 1.00 98.23 O
+ATOM 1482 HG SER A 98 15.696 0.680 -29.083 1.00 98.23 H
+ATOM 1483 N TYR A 99 12.091 2.552 -27.740 1.00 98.49 N
+ATOM 1484 H TYR A 99 11.756 1.625 -27.519 1.00 98.49 H
+ATOM 1485 CA TYR A 99 12.215 3.485 -26.622 1.00 98.49 C
+ATOM 1486 HA TYR A 99 12.179 4.508 -26.995 1.00 98.49 H
+ATOM 1487 C TYR A 99 13.559 3.270 -25.927 1.00 98.49 C
+ATOM 1488 CB TYR A 99 11.044 3.295 -25.653 1.00 98.49 C
+ATOM 1489 HB2 TYR A 99 10.825 2.232 -25.553 1.00 98.49 H
+ATOM 1490 HB3 TYR A 99 11.329 3.657 -24.665 1.00 98.49 H
+ATOM 1491 O TYR A 99 13.781 2.205 -25.353 1.00 98.49 O
+ATOM 1492 CG TYR A 99 9.792 4.023 -26.082 1.00 98.49 C
+ATOM 1493 CD1 TYR A 99 9.594 5.360 -25.687 1.00 98.49 C
+ATOM 1494 HD1 TYR A 99 10.319 5.852 -25.055 1.00 98.49 H
+ATOM 1495 CD2 TYR A 99 8.829 3.365 -26.870 1.00 98.49 C
+ATOM 1496 HD2 TYR A 99 8.983 2.335 -27.156 1.00 98.49 H
+ATOM 1497 CE1 TYR A 99 8.430 6.044 -26.077 1.00 98.49 C
+ATOM 1498 HE1 TYR A 99 8.267 7.058 -25.740 1.00 98.49 H
+ATOM 1499 CE2 TYR A 99 7.667 4.052 -27.272 1.00 98.49 C
+ATOM 1500 HE2 TYR A 99 6.906 3.571 -27.869 1.00 98.49 H
+ATOM 1501 OH TYR A 99 6.331 6.037 -27.234 1.00 98.49 O
+ATOM 1502 HH TYR A 99 6.257 6.893 -26.806 1.00 98.49 H
+ATOM 1503 CZ TYR A 99 7.464 5.387 -26.868 1.00 98.49 C
+ATOM 1504 N GLN A 100 14.426 4.280 -25.973 1.00 97.97 N
+ATOM 1505 H GLN A 100 14.150 5.122 -26.459 1.00 97.97 H
+ATOM 1506 CA GLN A 100 15.776 4.248 -25.406 1.00 97.97 C
+ATOM 1507 HA GLN A 100 16.009 3.236 -25.074 1.00 97.97 H
+ATOM 1508 C GLN A 100 15.875 5.179 -24.198 1.00 97.97 C
+ATOM 1509 CB GLN A 100 16.822 4.640 -26.461 1.00 97.97 C
+ATOM 1510 HB2 GLN A 100 17.809 4.528 -26.013 1.00 97.97 H
+ATOM 1511 HB3 GLN A 100 16.684 5.686 -26.735 1.00 97.97 H
+ATOM 1512 O GLN A 100 15.250 6.247 -24.181 1.00 97.97 O
+ATOM 1513 CG GLN A 100 16.750 3.783 -27.734 1.00 97.97 C
+ATOM 1514 HG2 GLN A 100 15.806 3.975 -28.244 1.00 97.97 H
+ATOM 1515 HG3 GLN A 100 16.779 2.725 -27.472 1.00 97.97 H
+ATOM 1516 CD GLN A 100 17.888 4.060 -28.710 1.00 97.97 C
+ATOM 1517 NE2 GLN A 100 17.698 3.750 -29.974 1.00 97.97 N
+ATOM 1518 HE21 GLN A 100 16.798 3.411 -30.282 1.00 97.97 H
+ATOM 1519 HE22 GLN A 100 18.445 3.970 -30.617 1.00 97.97 H
+ATOM 1520 OE1 GLN A 100 18.937 4.601 -28.388 1.00 97.97 O
+ATOM 1521 N LEU A 101 16.670 4.795 -23.200 1.00 96.65 N
+ATOM 1522 H LEU A 101 17.170 3.923 -23.297 1.00 96.65 H
+ATOM 1523 CA LEU A 101 16.896 5.597 -21.995 1.00 96.65 C
+ATOM 1524 HA LEU A 101 15.928 5.771 -21.525 1.00 96.65 H
+ATOM 1525 C LEU A 101 17.524 6.958 -22.350 1.00 96.65 C
+ATOM 1526 CB LEU A 101 17.782 4.794 -21.024 1.00 96.65 C
+ATOM 1527 HB2 LEU A 101 18.752 4.647 -21.498 1.00 96.65 H
+ATOM 1528 HB3 LEU A 101 17.337 3.811 -20.866 1.00 96.65 H
+ATOM 1529 O LEU A 101 18.492 7.028 -23.105 1.00 96.65 O
+ATOM 1530 CG LEU A 101 17.998 5.463 -19.652 1.00 96.65 C
+ATOM 1531 HG LEU A 101 18.320 6.496 -19.788 1.00 96.65 H
+ATOM 1532 CD1 LEU A 101 16.735 5.442 -18.790 1.00 96.65 C
+ATOM 1533 HD11 LEU A 101 16.925 5.945 -17.842 1.00 96.65 H
+ATOM 1534 HD12 LEU A 101 16.423 4.413 -18.608 1.00 96.65 H
+ATOM 1535 HD13 LEU A 101 15.925 5.967 -19.297 1.00 96.65 H
+ATOM 1536 CD2 LEU A 101 19.093 4.725 -18.882 1.00 96.65 C
+ATOM 1537 HD21 LEU A 101 20.027 4.776 -19.442 1.00 96.65 H
+ATOM 1538 HD22 LEU A 101 18.816 3.678 -18.758 1.00 96.65 H
+ATOM 1539 HD23 LEU A 101 19.235 5.187 -17.905 1.00 96.65 H
+ATOM 1540 N GLN A 102 16.968 8.036 -21.801 1.00 95.25 N
+ATOM 1541 H GLN A 102 16.170 7.887 -21.201 1.00 95.25 H
+ATOM 1542 CA GLN A 102 17.427 9.415 -21.985 1.00 95.25 C
+ATOM 1543 HA GLN A 102 18.102 9.463 -22.839 1.00 95.25 H
+ATOM 1544 C GLN A 102 18.240 9.881 -20.761 1.00 95.25 C
+ATOM 1545 CB GLN A 102 16.212 10.321 -22.293 1.00 95.25 C
+ATOM 1546 HB2 GLN A 102 15.565 10.361 -21.416 1.00 95.25 H
+ATOM 1547 HB3 GLN A 102 16.565 11.331 -22.503 1.00 95.25 H
+ATOM 1548 O GLN A 102 18.979 9.110 -20.148 1.00 95.25 O
+ATOM 1549 CG GLN A 102 15.369 9.871 -23.491 1.00 95.25 C
+ATOM 1550 HG2 GLN A 102 14.909 8.909 -23.263 1.00 95.25 H
+ATOM 1551 HG3 GLN A 102 14.569 10.595 -23.644 1.00 95.25 H
+ATOM 1552 CD GLN A 102 16.179 9.758 -24.778 1.00 95.25 C
+ATOM 1553 NE2 GLN A 102 16.510 8.567 -25.217 1.00 95.25 N
+ATOM 1554 HE21 GLN A 102 16.233 7.737 -24.713 1.00 95.25 H
+ATOM 1555 HE22 GLN A 102 17.095 8.518 -26.039 1.00 95.25 H
+ATOM 1556 OE1 GLN A 102 16.524 10.741 -25.414 1.00 95.25 O
+ATOM 1557 N ASP A 103 18.123 11.157 -20.390 1.00 87.47 N
+ATOM 1558 H ASP A 103 17.574 11.775 -20.970 1.00 87.47 H
+ATOM 1559 CA ASP A 103 18.853 11.739 -19.260 1.00 87.47 C
+ATOM 1560 HA ASP A 103 19.851 11.304 -19.220 1.00 87.47 H
+ATOM 1561 C ASP A 103 18.186 11.472 -17.899 1.00 87.47 C
+ATOM 1562 CB ASP A 103 18.999 13.248 -19.499 1.00 87.47 C
+ATOM 1563 HB2 ASP A 103 19.474 13.697 -18.627 1.00 87.47 H
+ATOM 1564 HB3 ASP A 103 18.008 13.690 -19.605 1.00 87.47 H
+ATOM 1565 O ASP A 103 18.842 11.576 -16.857 1.00 87.47 O
+ATOM 1566 CG ASP A 103 19.851 13.585 -20.728 1.00 87.47 C
+ATOM 1567 OD1 ASP A 103 20.880 12.899 -20.935 1.00 87.47 O
+ATOM 1568 OD2 ASP A 103 19.506 14.577 -21.406 1.00 87.47 O
+ATOM 1569 N LEU A 104 16.885 11.149 -17.898 1.00 88.52 N
+ATOM 1570 H LEU A 104 16.443 10.984 -18.791 1.00 88.52 H
+ATOM 1571 CA LEU A 104 16.059 11.056 -16.697 1.00 88.52 C
+ATOM 1572 HA LEU A 104 16.622 11.534 -15.895 1.00 88.52 H
+ATOM 1573 C LEU A 104 15.814 9.638 -16.166 1.00 88.52 C
+ATOM 1574 CB LEU A 104 14.744 11.853 -16.870 1.00 88.52 C
+ATOM 1575 HB2 LEU A 104 13.997 11.508 -16.156 1.00 88.52 H
+ATOM 1576 HB3 LEU A 104 14.343 11.645 -17.862 1.00 88.52 H
+ATOM 1577 O LEU A 104 16.111 8.595 -16.739 1.00 88.52 O
+ATOM 1578 CG LEU A 104 14.878 13.379 -16.698 1.00 88.52 C
+ATOM 1579 HG LEU A 104 15.537 13.774 -17.471 1.00 88.52 H
+ATOM 1580 CD1 LEU A 104 13.501 14.023 -16.851 1.00 88.52 C
+ATOM 1581 HD11 LEU A 104 13.578 15.107 -16.767 1.00 88.52 H
+ATOM 1582 HD12 LEU A 104 12.812 13.648 -16.094 1.00 88.52 H
+ATOM 1583 HD13 LEU A 104 13.103 13.787 -17.837 1.00 88.52 H
+ATOM 1584 CD2 LEU A 104 15.421 13.800 -15.325 1.00 88.52 C
+ATOM 1585 HD21 LEU A 104 16.470 13.522 -15.231 1.00 88.52 H
+ATOM 1586 HD22 LEU A 104 14.834 13.334 -14.533 1.00 88.52 H
+ATOM 1587 HD23 LEU A 104 15.358 14.884 -15.227 1.00 88.52 H
+ATOM 1588 N THR A 105 15.328 9.689 -14.936 1.00 87.38 N
+ATOM 1589 H THR A 105 15.074 10.623 -14.647 1.00 87.38 H
+ATOM 1590 CA THR A 105 15.046 8.664 -13.949 1.00 87.38 C
+ATOM 1591 HA THR A 105 14.696 9.331 -13.161 1.00 87.38 H
+ATOM 1592 C THR A 105 13.817 7.756 -14.051 1.00 87.38 C
+ATOM 1593 CB THR A 105 16.272 8.075 -13.313 1.00 87.38 C
+ATOM 1594 HB THR A 105 17.024 8.853 -13.179 1.00 87.38 H
+ATOM 1595 O THR A 105 12.750 8.294 -13.797 1.00 87.38 O
+ATOM 1596 CG2 THR A 105 15.810 7.559 -11.932 1.00 87.38 C
+ATOM 1597 HG21 THR A 105 15.619 6.486 -11.969 1.00 87.38 H
+ATOM 1598 HG22 THR A 105 14.898 8.041 -11.581 1.00 87.38 H
+ATOM 1599 HG23 THR A 105 16.533 7.773 -11.145 1.00 87.38 H
+ATOM 1600 OG1 THR A 105 16.725 7.119 -14.239 1.00 87.38 O
+ATOM 1601 HG1 THR A 105 16.634 7.496 -15.118 1.00 87.38 H
+ATOM 1602 N PHE A 106 13.914 6.421 -14.158 1.00 96.10 N
+ATOM 1603 H PHE A 106 14.822 6.028 -14.359 1.00 96.10 H
+ATOM 1604 CA PHE A 106 12.893 5.526 -13.574 1.00 96.10 C
+ATOM 1605 HA PHE A 106 12.126 6.138 -13.099 1.00 96.10 H
+ATOM 1606 C PHE A 106 13.484 4.635 -12.471 1.00 96.10 C
+ATOM 1607 CB PHE A 106 12.170 4.705 -14.648 1.00 96.10 C
+ATOM 1608 HB2 PHE A 106 11.780 5.386 -15.406 1.00 96.10 H
+ATOM 1609 HB3 PHE A 106 12.887 4.046 -15.137 1.00 96.10 H
+ATOM 1610 O PHE A 106 14.580 4.093 -12.606 1.00 96.10 O
+ATOM 1611 CG PHE A 106 11.018 3.875 -14.098 1.00 96.10 C
+ATOM 1612 CD1 PHE A 106 11.232 2.548 -13.676 1.00 96.10 C
+ATOM 1613 HD1 PHE A 106 12.220 2.116 -13.741 1.00 96.10 H
+ATOM 1614 CD2 PHE A 106 9.724 4.422 -14.016 1.00 96.10 C
+ATOM 1615 HD2 PHE A 106 9.550 5.439 -14.336 1.00 96.10 H
+ATOM 1616 CE1 PHE A 106 10.158 1.767 -13.211 1.00 96.10 C
+ATOM 1617 HE1 PHE A 106 10.330 0.738 -12.931 1.00 96.10 H
+ATOM 1618 CE2 PHE A 106 8.645 3.633 -13.577 1.00 96.10 C
+ATOM 1619 HE2 PHE A 106 7.645 4.040 -13.597 1.00 96.10 H
+ATOM 1620 CZ PHE A 106 8.858 2.300 -13.186 1.00 96.10 C
+ATOM 1621 HZ PHE A 106 8.025 1.673 -12.905 1.00 96.10 H
+ATOM 1622 N SER A 107 12.767 4.477 -11.353 1.00 96.11 N
+ATOM 1623 H SER A 107 11.873 4.942 -11.284 1.00 96.11 H
+ATOM 1624 CA SER A 107 13.172 3.583 -10.261 1.00 96.11 C
+ATOM 1625 HA SER A 107 13.709 2.735 -10.686 1.00 96.11 H
+ATOM 1626 C SER A 107 11.969 3.040 -9.496 1.00 96.11 C
+ATOM 1627 CB SER A 107 14.108 4.316 -9.290 1.00 96.11 C
+ATOM 1628 HB2 SER A 107 14.976 4.693 -9.830 1.00 96.11 H
+ATOM 1629 HB3 SER A 107 13.578 5.158 -8.845 1.00 96.11 H
+ATOM 1630 O SER A 107 11.021 3.768 -9.210 1.00 96.11 O
+ATOM 1631 OG SER A 107 14.535 3.434 -8.262 1.00 96.11 O
+ATOM 1632 HG SER A 107 15.381 3.069 -8.533 1.00 96.11 H
+ATOM 1633 N ASN A 108 12.019 1.771 -9.082 1.00 97.30 N
+ATOM 1634 H ASN A 108 12.807 1.206 -9.364 1.00 97.30 H
+ATOM 1635 CA ASN A 108 11.035 1.210 -8.151 1.00 97.30 C
+ATOM 1636 HA ASN A 108 10.049 1.582 -8.431 1.00 97.30 H
+ATOM 1637 C ASN A 108 11.265 1.662 -6.695 1.00 97.30 C
+ATOM 1638 CB ASN A 108 11.006 -0.321 -8.279 1.00 97.30 C
+ATOM 1639 HB2 ASN A 108 10.346 -0.739 -7.518 1.00 97.30 H
+ATOM 1640 HB3 ASN A 108 12.005 -0.724 -8.114 1.00 97.30 H
+ATOM 1641 O ASN A 108 10.394 1.448 -5.849 1.00 97.30 O
+ATOM 1642 CG ASN A 108 10.477 -0.771 -9.629 1.00 97.30 C
+ATOM 1643 ND2 ASN A 108 11.305 -1.438 -10.396 1.00 97.30 N
+ATOM 1644 HD21 ASN A 108 11.091 -1.627 -11.365 1.00 97.30 H
+ATOM 1645 HD22 ASN A 108 12.264 -1.600 -10.125 1.00 97.30 H
+ATOM 1646 OD1 ASN A 108 9.324 -0.530 -9.974 1.00 97.30 O
+ATOM 1647 N GLY A 109 12.389 2.323 -6.384 1.00 96.70 N
+ATOM 1648 H GLY A 109 13.064 2.490 -7.117 1.00 96.70 H
+ATOM 1649 CA GLY A 109 12.740 2.771 -5.031 1.00 96.70 C
+ATOM 1650 HA2 GLY A 109 12.907 1.900 -4.397 1.00 96.70 H
+ATOM 1651 HA3 GLY A 109 13.669 3.338 -5.089 1.00 96.70 H
+ATOM 1652 C GLY A 109 11.678 3.665 -4.376 1.00 96.70 C
+ATOM 1653 O GLY A 109 11.419 3.542 -3.178 1.00 96.70 O
+ATOM 1654 N TYR A 110 10.970 4.488 -5.156 1.00 96.99 N
+ATOM 1655 H TYR A 110 11.229 4.581 -6.127 1.00 96.99 H
+ATOM 1656 CA TYR A 110 9.873 5.325 -4.650 1.00 96.99 C
+ATOM 1657 HA TYR A 110 10.255 5.942 -3.837 1.00 96.99 H
+ATOM 1658 C TYR A 110 8.698 4.505 -4.096 1.00 96.99 C
+ATOM 1659 CB TYR A 110 9.384 6.253 -5.765 1.00 96.99 C
+ATOM 1660 HB2 TYR A 110 8.587 6.885 -5.373 1.00 96.99 H
+ATOM 1661 HB3 TYR A 110 8.958 5.651 -6.567 1.00 96.99 H
+ATOM 1662 O TYR A 110 8.062 4.915 -3.121 1.00 96.99 O
+ATOM 1663 CG TYR A 110 10.465 7.150 -6.331 1.00 96.99 C
+ATOM 1664 CD1 TYR A 110 10.897 8.281 -5.609 1.00 96.99 C
+ATOM 1665 HD1 TYR A 110 10.454 8.514 -4.652 1.00 96.99 H
+ATOM 1666 CD2 TYR A 110 11.035 6.853 -7.582 1.00 96.99 C
+ATOM 1667 HD2 TYR A 110 10.685 6.009 -8.158 1.00 96.99 H
+ATOM 1668 CE1 TYR A 110 11.888 9.125 -6.148 1.00 96.99 C
+ATOM 1669 HE1 TYR A 110 12.213 10.005 -5.612 1.00 96.99 H
+ATOM 1670 CE2 TYR A 110 12.016 7.700 -8.125 1.00 96.99 C
+ATOM 1671 HE2 TYR A 110 12.435 7.510 -9.102 1.00 96.99 H
+ATOM 1672 OH TYR A 110 13.370 9.651 -7.977 1.00 96.99 O
+ATOM 1673 HH TYR A 110 13.738 10.313 -7.388 1.00 96.99 H
+ATOM 1674 CZ TYR A 110 12.439 8.841 -7.418 1.00 96.99 C
+ATOM 1675 N ARG A 111 8.437 3.309 -4.651 1.00 98.33 N
+ATOM 1676 H ARG A 111 9.041 2.991 -5.395 1.00 98.33 H
+ATOM 1677 CA ARG A 111 7.417 2.388 -4.120 1.00 98.33 C
+ATOM 1678 HA ARG A 111 6.472 2.924 -4.034 1.00 98.33 H
+ATOM 1679 C ARG A 111 7.783 1.929 -2.711 1.00 98.33 C
+ATOM 1680 CB ARG A 111 7.216 1.169 -5.038 1.00 98.33 C
+ATOM 1681 HB2 ARG A 111 8.145 0.604 -5.107 1.00 98.33 H
+ATOM 1682 HB3 ARG A 111 6.476 0.518 -4.572 1.00 98.33 H
+ATOM 1683 O ARG A 111 6.932 1.989 -1.826 1.00 98.33 O
+ATOM 1684 CG ARG A 111 6.723 1.518 -6.450 1.00 98.33 C
+ATOM 1685 HG2 ARG A 111 7.445 2.161 -6.952 1.00 98.33 H
+ATOM 1686 HG3 ARG A 111 5.767 2.038 -6.382 1.00 98.33 H
+ATOM 1687 CD ARG A 111 6.557 0.222 -7.258 1.00 98.33 C
+ATOM 1688 HD2 ARG A 111 5.930 -0.479 -6.708 1.00 98.33 H
+ATOM 1689 HD3 ARG A 111 7.536 -0.240 -7.379 1.00 98.33 H
+ATOM 1690 NE ARG A 111 5.983 0.456 -8.596 1.00 98.33 N
+ATOM 1691 HE ARG A 111 6.633 0.436 -9.368 1.00 98.33 H
+ATOM 1692 NH1 ARG A 111 3.759 0.534 -8.004 1.00 98.33 N
+ATOM 1693 HH11 ARG A 111 4.010 0.377 -7.038 1.00 98.33 H
+ATOM 1694 HH12 ARG A 111 2.789 0.402 -8.251 1.00 98.33 H
+ATOM 1695 NH2 ARG A 111 4.355 0.580 -10.162 1.00 98.33 N
+ATOM 1696 HH21 ARG A 111 5.030 0.363 -10.881 1.00 98.33 H
+ATOM 1697 HH22 ARG A 111 3.383 0.642 -10.430 1.00 98.33 H
+ATOM 1698 CZ ARG A 111 4.702 0.536 -8.911 1.00 98.33 C
+ATOM 1699 N TYR A 112 9.045 1.558 -2.486 1.00 98.36 N
+ATOM 1700 H TYR A 112 9.690 1.579 -3.263 1.00 98.36 H
+ATOM 1701 CA TYR A 112 9.547 1.150 -1.168 1.00 98.36 C
+ATOM 1702 HA TYR A 112 8.964 0.301 -0.812 1.00 98.36 H
+ATOM 1703 C TYR A 112 9.403 2.266 -0.136 1.00 98.36 C
+ATOM 1704 CB TYR A 112 11.017 0.724 -1.255 1.00 98.36 C
+ATOM 1705 HB2 TYR A 112 11.585 1.466 -1.817 1.00 98.36 H
+ATOM 1706 HB3 TYR A 112 11.423 0.709 -0.244 1.00 98.36 H
+ATOM 1707 O TYR A 112 8.889 2.033 0.958 1.00 98.36 O
+ATOM 1708 CG TYR A 112 11.233 -0.638 -1.871 1.00 98.36 C
+ATOM 1709 CD1 TYR A 112 11.450 -1.752 -1.038 1.00 98.36 C
+ATOM 1710 HD1 TYR A 112 11.492 -1.630 0.035 1.00 98.36 H
+ATOM 1711 CD2 TYR A 112 11.201 -0.796 -3.270 1.00 98.36 C
+ATOM 1712 HD2 TYR A 112 11.064 0.060 -3.915 1.00 98.36 H
+ATOM 1713 CE1 TYR A 112 11.615 -3.029 -1.602 1.00 98.36 C
+ATOM 1714 HE1 TYR A 112 11.769 -3.890 -0.969 1.00 98.36 H
+ATOM 1715 CE2 TYR A 112 11.344 -2.073 -3.836 1.00 98.36 C
+ATOM 1716 HE2 TYR A 112 11.318 -2.211 -4.907 1.00 98.36 H
+ATOM 1717 OH TYR A 112 11.642 -4.421 -3.545 1.00 98.36 O
+ATOM 1718 HH TYR A 112 11.900 -5.090 -2.907 1.00 98.36 H
+ATOM 1719 CZ TYR A 112 11.547 -3.188 -3.001 1.00 98.36 C
+ATOM 1720 N VAL A 113 9.779 3.497 -0.492 1.00 97.45 N
+ATOM 1721 H VAL A 113 10.219 3.626 -1.392 1.00 97.45 H
+ATOM 1722 CA VAL A 113 9.618 4.655 0.400 1.00 97.45 C
+ATOM 1723 HA VAL A 113 10.140 4.448 1.334 1.00 97.45 H
+ATOM 1724 C VAL A 113 8.143 4.869 0.750 1.00 97.45 C
+ATOM 1725 CB VAL A 113 10.242 5.918 -0.223 1.00 97.45 C
+ATOM 1726 HB VAL A 113 9.787 6.106 -1.195 1.00 97.45 H
+ATOM 1727 O VAL A 113 7.806 5.084 1.912 1.00 97.45 O
+ATOM 1728 CG1 VAL A 113 10.033 7.152 0.664 1.00 97.45 C
+ATOM 1729 HG11 VAL A 113 8.973 7.398 0.731 1.00 97.45 H
+ATOM 1730 HG12 VAL A 113 10.548 8.008 0.229 1.00 97.45 H
+ATOM 1731 HG13 VAL A 113 10.426 6.968 1.664 1.00 97.45 H
+ATOM 1732 CG2 VAL A 113 11.755 5.739 -0.410 1.00 97.45 C
+ATOM 1733 HG21 VAL A 113 12.180 6.633 -0.866 1.00 97.45 H
+ATOM 1734 HG22 VAL A 113 11.967 4.896 -1.068 1.00 97.45 H
+ATOM 1735 HG23 VAL A 113 12.238 5.564 0.552 1.00 97.45 H
+ATOM 1736 N ASN A 114 7.231 4.725 -0.212 1.00 98.18 N
+ATOM 1737 H ASN A 114 7.546 4.573 -1.160 1.00 98.18 H
+ATOM 1738 CA ASN A 114 5.798 4.858 0.043 1.00 98.18 C
+ATOM 1739 HA ASN A 114 5.631 5.792 0.579 1.00 98.18 H
+ATOM 1740 C ASN A 114 5.207 3.725 0.900 1.00 98.18 C
+ATOM 1741 CB ASN A 114 5.098 4.945 -1.307 1.00 98.18 C
+ATOM 1742 HB2 ASN A 114 5.166 3.994 -1.835 1.00 98.18 H
+ATOM 1743 HB3 ASN A 114 5.602 5.709 -1.898 1.00 98.18 H
+ATOM 1744 O ASN A 114 4.255 3.931 1.665 1.00 98.18 O
+ATOM 1745 CG ASN A 114 3.651 5.350 -1.120 1.00 98.18 C
+ATOM 1746 ND2 ASN A 114 2.706 4.490 -1.418 1.00 98.18 N
+ATOM 1747 HD21 ASN A 114 2.937 3.619 -1.875 1.00 98.18 H
+ATOM 1748 HD22 ASN A 114 1.768 4.847 -1.308 1.00 98.18 H
+ATOM 1749 OD1 ASN A 114 3.353 6.451 -0.695 1.00 98.18 O
+ATOM 1750 N TRP A 115 5.758 2.514 0.808 1.00 98.70 N
+ATOM 1751 H TRP A 115 6.491 2.362 0.129 1.00 98.70 H
+ATOM 1752 CA TRP A 115 5.356 1.393 1.658 1.00 98.70 C
+ATOM 1753 HA TRP A 115 4.279 1.244 1.571 1.00 98.70 H
+ATOM 1754 C TRP A 115 5.613 1.668 3.141 1.00 98.70 C
+ATOM 1755 CB TRP A 115 6.012 0.099 1.177 1.00 98.70 C
+ATOM 1756 HB2 TRP A 115 7.095 0.215 1.209 1.00 98.70 H
+ATOM 1757 HB3 TRP A 115 5.757 -0.697 1.876 1.00 98.70 H
+ATOM 1758 O TRP A 115 4.844 1.187 3.975 1.00 98.70 O
+ATOM 1759 CG TRP A 115 5.623 -0.363 -0.198 1.00 98.70 C
+ATOM 1760 CD1 TRP A 115 4.529 0.011 -0.909 1.00 98.70 C
+ATOM 1761 HD1 TRP A 115 3.781 0.710 -0.566 1.00 98.70 H
+ATOM 1762 CD2 TRP A 115 6.355 -1.283 -1.060 1.00 98.70 C
+ATOM 1763 CE2 TRP A 115 5.657 -1.400 -2.299 1.00 98.70 C
+ATOM 1764 CE3 TRP A 115 7.547 -2.024 -0.921 1.00 98.70 C
+ATOM 1765 HE3 TRP A 115 8.108 -1.962 0.000 1.00 98.70 H
+ATOM 1766 NE1 TRP A 115 4.550 -0.595 -2.152 1.00 98.70 N
+ATOM 1767 HE1 TRP A 115 3.874 -0.426 -2.884 1.00 98.70 H
+ATOM 1768 CH2 TRP A 115 7.322 -2.907 -3.189 1.00 98.70 C
+ATOM 1769 HH2 TRP A 115 7.714 -3.511 -3.993 1.00 98.70 H
+ATOM 1770 CZ2 TRP A 115 6.126 -2.190 -3.358 1.00 98.70 C
+ATOM 1771 HZ2 TRP A 115 5.583 -2.247 -4.289 1.00 98.70 H
+ATOM 1772 CZ3 TRP A 115 8.020 -2.829 -1.972 1.00 98.70 C
+ATOM 1773 HZ3 TRP A 115 8.938 -3.386 -1.854 1.00 98.70 H
+ATOM 1774 N MET A 116 6.591 2.522 3.477 1.00 98.54 N
+ATOM 1775 H MET A 116 7.189 2.879 2.745 1.00 98.54 H
+ATOM 1776 CA MET A 116 6.848 2.953 4.859 1.00 98.54 C
+ATOM 1777 HA MET A 116 7.074 2.073 5.461 1.00 98.54 H
+ATOM 1778 C MET A 116 5.641 3.640 5.508 1.00 98.54 C
+ATOM 1779 CB MET A 116 8.050 3.908 4.926 1.00 98.54 C
+ATOM 1780 HB2 MET A 116 8.167 4.254 5.953 1.00 98.54 H
+ATOM 1781 HB3 MET A 116 7.853 4.792 4.320 1.00 98.54 H
+ATOM 1782 O MET A 116 5.512 3.587 6.731 1.00 98.54 O
+ATOM 1783 CG MET A 116 9.364 3.257 4.484 1.00 98.54 C
+ATOM 1784 HG2 MET A 116 9.244 2.858 3.477 1.00 98.54 H
+ATOM 1785 HG3 MET A 116 10.137 4.024 4.440 1.00 98.54 H
+ATOM 1786 SD MET A 116 9.936 1.926 5.578 1.00 98.54 S
+ATOM 1787 CE MET A 116 10.479 2.891 7.012 1.00 98.54 C
+ATOM 1788 HE1 MET A 116 9.633 3.413 7.459 1.00 98.54 H
+ATOM 1789 HE2 MET A 116 11.233 3.615 6.703 1.00 98.54 H
+ATOM 1790 HE3 MET A 116 10.914 2.221 7.753 1.00 98.54 H
+ATOM 1791 N ALA A 117 4.754 4.252 4.714 1.00 98.29 N
+ATOM 1792 H ALA A 117 4.950 4.271 3.723 1.00 98.29 H
+ATOM 1793 CA ALA A 117 3.523 4.890 5.180 1.00 98.29 C
+ATOM 1794 HA ALA A 117 3.589 5.068 6.254 1.00 98.29 H
+ATOM 1795 C ALA A 117 2.277 4.021 4.938 1.00 98.29 C
+ATOM 1796 CB ALA A 117 3.405 6.252 4.486 1.00 98.29 C
+ATOM 1797 HB1 ALA A 117 4.276 6.863 4.720 1.00 98.29 H
+ATOM 1798 HB2 ALA A 117 2.510 6.767 4.835 1.00 98.29 H
+ATOM 1799 HB3 ALA A 117 3.343 6.124 3.405 1.00 98.29 H
+ATOM 1800 O ALA A 117 1.447 3.845 5.835 1.00 98.29 O
+ATOM 1801 N THR A 118 2.140 3.448 3.739 1.00 98.65 N
+ATOM 1802 H THR A 118 2.851 3.621 3.043 1.00 98.65 H
+ATOM 1803 CA THR A 118 0.925 2.703 3.364 1.00 98.65 C
+ATOM 1804 HA THR A 118 0.063 3.305 3.651 1.00 98.65 H
+ATOM 1805 C THR A 118 0.778 1.379 4.105 1.00 98.65 C
+ATOM 1806 CB THR A 118 0.816 2.457 1.854 1.00 98.65 C
+ATOM 1807 HB THR A 118 -0.002 1.761 1.664 1.00 98.65 H
+ATOM 1808 O THR A 118 -0.334 1.058 4.522 1.00 98.65 O
+ATOM 1809 CG2 THR A 118 0.541 3.745 1.099 1.00 98.65 C
+ATOM 1810 HG21 THR A 118 1.379 4.430 1.229 1.00 98.65 H
+ATOM 1811 HG22 THR A 118 0.404 3.532 0.039 1.00 98.65 H
+ATOM 1812 HG23 THR A 118 -0.366 4.215 1.480 1.00 98.65 H
+ATOM 1813 OG1 THR A 118 2.004 1.934 1.319 1.00 98.65 O
+ATOM 1814 HG1 THR A 118 2.622 2.666 1.252 1.00 98.65 H
+ATOM 1815 N ILE A 119 1.862 0.632 4.346 1.00 98.73 N
+ATOM 1816 H ILE A 119 2.765 0.951 4.025 1.00 98.73 H
+ATOM 1817 CA ILE A 119 1.784 -0.653 5.059 1.00 98.73 C
+ATOM 1818 HA ILE A 119 0.992 -1.234 4.588 1.00 98.73 H
+ATOM 1819 C ILE A 119 1.318 -0.464 6.516 1.00 98.73 C
+ATOM 1820 CB ILE A 119 3.083 -1.483 4.894 1.00 98.73 C
+ATOM 1821 HB ILE A 119 3.948 -0.887 5.184 1.00 98.73 H
+ATOM 1822 O ILE A 119 0.374 -1.150 6.916 1.00 98.73 O
+ATOM 1823 CG1 ILE A 119 3.234 -1.873 3.404 1.00 98.73 C
+ATOM 1824 HG12 ILE A 119 3.398 -0.967 2.820 1.00 98.73 H
+ATOM 1825 HG13 ILE A 119 2.303 -2.323 3.058 1.00 98.73 H
+ATOM 1826 CG2 ILE A 119 3.049 -2.723 5.802 1.00 98.73 C
+ATOM 1827 HG21 ILE A 119 3.002 -2.427 6.850 1.00 98.73 H
+ATOM 1828 HG22 ILE A 119 2.187 -3.341 5.553 1.00 98.73 H
+ATOM 1829 HG23 ILE A 119 3.956 -3.315 5.679 1.00 98.73 H
+ATOM 1830 CD1 ILE A 119 4.367 -2.852 3.070 1.00 98.73 C
+ATOM 1831 HD11 ILE A 119 5.319 -2.501 3.469 1.00 98.73 H
+ATOM 1832 HD12 ILE A 119 4.140 -3.840 3.470 1.00 98.73 H
+ATOM 1833 HD13 ILE A 119 4.454 -2.939 1.987 1.00 98.73 H
+ATOM 1834 N PRO A 120 1.849 0.498 7.300 1.00 98.82 N
+ATOM 1835 CA PRO A 120 1.272 0.852 8.598 1.00 98.82 C
+ATOM 1836 HA PRO A 120 1.425 0.019 9.285 1.00 98.82 H
+ATOM 1837 C PRO A 120 -0.224 1.189 8.560 1.00 98.82 C
+ATOM 1838 CB PRO A 120 2.089 2.052 9.075 1.00 98.82 C
+ATOM 1839 HB2 PRO A 120 2.092 2.147 10.161 1.00 98.82 H
+ATOM 1840 HB3 PRO A 120 1.719 2.971 8.620 1.00 98.82 H
+ATOM 1841 O PRO A 120 -0.967 0.747 9.438 1.00 98.82 O
+ATOM 1842 CG PRO A 120 3.470 1.737 8.515 1.00 98.82 C
+ATOM 1843 HG2 PRO A 120 3.954 0.972 9.122 1.00 98.82 H
+ATOM 1844 HG3 PRO A 120 4.086 2.634 8.467 1.00 98.82 H
+ATOM 1845 CD PRO A 120 3.140 1.164 7.137 1.00 98.82 C
+ATOM 1846 HD2 PRO A 120 3.064 1.970 6.407 1.00 98.82 H
+ATOM 1847 HD3 PRO A 120 3.923 0.467 6.841 1.00 98.82 H
+ATOM 1848 N CYS A 121 -0.689 1.921 7.541 1.00 98.82 N
+ATOM 1849 H CYS A 121 -0.037 2.263 6.851 1.00 98.82 H
+ATOM 1850 CA CYS A 121 -2.108 2.258 7.392 1.00 98.82 C
+ATOM 1851 HA CYS A 121 -2.462 2.707 8.320 1.00 98.82 H
+ATOM 1852 C CYS A 121 -2.971 1.012 7.139 1.00 98.82 C
+ATOM 1853 CB CYS A 121 -2.285 3.281 6.261 1.00 98.82 C
+ATOM 1854 HB2 CYS A 121 -1.864 2.895 5.332 1.00 98.82 H
+ATOM 1855 HB3 CYS A 121 -3.349 3.459 6.106 1.00 98.82 H
+ATOM 1856 O CYS A 121 -3.992 0.826 7.808 1.00 98.82 O
+ATOM 1857 SG CYS A 121 -1.490 4.857 6.682 1.00 98.82 S
+ATOM 1858 HG CYS A 121 -0.224 4.472 6.497 1.00 98.82 H
+ATOM 1859 N LEU A 122 -2.529 0.133 6.230 1.00 98.85 N
+ATOM 1860 H LEU A 122 -1.682 0.361 5.728 1.00 98.85 H
+ATOM 1861 CA LEU A 122 -3.190 -1.138 5.921 1.00 98.85 C
+ATOM 1862 HA LEU A 122 -4.206 -0.935 5.583 1.00 98.85 H
+ATOM 1863 C LEU A 122 -3.284 -2.038 7.161 1.00 98.85 C
+ATOM 1864 CB LEU A 122 -2.417 -1.868 4.804 1.00 98.85 C
+ATOM 1865 HB2 LEU A 122 -1.373 -1.949 5.104 1.00 98.85 H
+ATOM 1866 HB3 LEU A 122 -2.809 -2.882 4.716 1.00 98.85 H
+ATOM 1867 O LEU A 122 -4.335 -2.622 7.424 1.00 98.85 O
+ATOM 1868 CG LEU A 122 -2.484 -1.208 3.415 1.00 98.85 C
+ATOM 1869 HG LEU A 122 -2.232 -0.149 3.484 1.00 98.85 H
+ATOM 1870 CD1 LEU A 122 -1.487 -1.890 2.476 1.00 98.85 C
+ATOM 1871 HD11 LEU A 122 -1.755 -2.938 2.341 1.00 98.85 H
+ATOM 1872 HD12 LEU A 122 -1.499 -1.393 1.506 1.00 98.85 H
+ATOM 1873 HD13 LEU A 122 -0.480 -1.821 2.888 1.00 98.85 H
+ATOM 1874 CD2 LEU A 122 -3.874 -1.325 2.799 1.00 98.85 C
+ATOM 1875 HD21 LEU A 122 -4.604 -0.770 3.389 1.00 98.85 H
+ATOM 1876 HD22 LEU A 122 -4.157 -2.376 2.741 1.00 98.85 H
+ATOM 1877 HD23 LEU A 122 -3.865 -0.919 1.787 1.00 98.85 H
+ATOM 1878 N LEU A 123 -2.217 -2.120 7.956 1.00 98.85 N
+ATOM 1879 H LEU A 123 -1.375 -1.641 7.671 1.00 98.85 H
+ATOM 1880 CA LEU A 123 -2.198 -2.902 9.194 1.00 98.85 C
+ATOM 1881 HA LEU A 123 -2.590 -3.897 8.987 1.00 98.85 H
+ATOM 1882 C LEU A 123 -3.113 -2.286 10.257 1.00 98.85 C
+ATOM 1883 CB LEU A 123 -0.746 -3.026 9.696 1.00 98.85 C
+ATOM 1884 HB2 LEU A 123 -0.743 -3.462 10.695 1.00 98.85 H
+ATOM 1885 HB3 LEU A 123 -0.319 -2.026 9.766 1.00 98.85 H
+ATOM 1886 O LEU A 123 -3.880 -3.001 10.894 1.00 98.85 O
+ATOM 1887 CG LEU A 123 0.134 -3.888 8.772 1.00 98.85 C
+ATOM 1888 HG LEU A 123 -0.021 -3.572 7.740 1.00 98.85 H
+ATOM 1889 CD1 LEU A 123 1.617 -3.710 9.085 1.00 98.85 C
+ATOM 1890 HD11 LEU A 123 1.874 -2.651 9.121 1.00 98.85 H
+ATOM 1891 HD12 LEU A 123 1.880 -4.193 10.026 1.00 98.85 H
+ATOM 1892 HD13 LEU A 123 2.205 -4.181 8.297 1.00 98.85 H
+ATOM 1893 CD2 LEU A 123 -0.211 -5.376 8.882 1.00 98.85 C
+ATOM 1894 HD21 LEU A 123 -1.210 -5.561 8.488 1.00 98.85 H
+ATOM 1895 HD22 LEU A 123 0.499 -5.964 8.300 1.00 98.85 H
+ATOM 1896 HD23 LEU A 123 -0.160 -5.701 9.922 1.00 98.85 H
+ATOM 1897 N LEU A 124 -3.095 -0.964 10.438 1.00 98.86 N
+ATOM 1898 H LEU A 124 -2.449 -0.408 9.897 1.00 98.86 H
+ATOM 1899 CA LEU A 124 -3.905 -0.305 11.462 1.00 98.86 C
+ATOM 1900 HA LEU A 124 -3.695 -0.800 12.410 1.00 98.86 H
+ATOM 1901 C LEU A 124 -5.412 -0.447 11.201 1.00 98.86 C
+ATOM 1902 CB LEU A 124 -3.463 1.163 11.572 1.00 98.86 C
+ATOM 1903 HB2 LEU A 124 -2.396 1.189 11.790 1.00 98.86 H
+ATOM 1904 HB3 LEU A 124 -3.616 1.648 10.608 1.00 98.86 H
+ATOM 1905 O LEU A 124 -6.164 -0.723 12.139 1.00 98.86 O
+ATOM 1906 CG LEU A 124 -4.206 1.966 12.654 1.00 98.86 C
+ATOM 1907 HG LEU A 124 -5.270 1.994 12.419 1.00 98.86 H
+ATOM 1908 CD1 LEU A 124 -4.024 1.373 14.055 1.00 98.86 C
+ATOM 1909 HD11 LEU A 124 -2.963 1.274 14.283 1.00 98.86 H
+ATOM 1910 HD12 LEU A 124 -4.505 0.396 14.107 1.00 98.86 H
+ATOM 1911 HD13 LEU A 124 -4.494 2.025 14.792 1.00 98.86 H
+ATOM 1912 CD2 LEU A 124 -3.686 3.402 12.675 1.00 98.86 C
+ATOM 1913 HD21 LEU A 124 -3.778 3.845 11.683 1.00 98.86 H
+ATOM 1914 HD22 LEU A 124 -2.635 3.416 12.964 1.00 98.86 H
+ATOM 1915 HD23 LEU A 124 -4.264 3.998 13.381 1.00 98.86 H
+ATOM 1916 N GLN A 125 -5.863 -0.327 9.946 1.00 98.71 N
+ATOM 1917 H GLN A 125 -5.214 -0.084 9.211 1.00 98.71 H
+ATOM 1918 CA GLN A 125 -7.283 -0.515 9.623 1.00 98.71 C
+ATOM 1919 HA GLN A 125 -7.852 0.132 10.290 1.00 98.71 H
+ATOM 1920 C GLN A 125 -7.771 -1.945 9.909 1.00 98.71 C
+ATOM 1921 CB GLN A 125 -7.605 -0.047 8.195 1.00 98.71 C
+ATOM 1922 HB2 GLN A 125 -8.686 -0.058 8.062 1.00 98.71 H
+ATOM 1923 HB3 GLN A 125 -7.269 0.985 8.085 1.00 98.71 H
+ATOM 1924 O GLN A 125 -8.909 -2.101 10.356 1.00 98.71 O
+ATOM 1925 CG GLN A 125 -6.974 -0.885 7.081 1.00 98.71 C
+ATOM 1926 HG2 GLN A 125 -7.293 -1.924 7.156 1.00 98.71 H
+ATOM 1927 HG3 GLN A 125 -5.890 -0.822 7.186 1.00 98.71 H
+ATOM 1928 CD GLN A 125 -7.323 -0.339 5.704 1.00 98.71 C
+ATOM 1929 NE2 GLN A 125 -8.233 -0.943 4.976 1.00 98.71 N
+ATOM 1930 HE21 GLN A 125 -8.672 -1.803 5.270 1.00 98.71 H
+ATOM 1931 HE22 GLN A 125 -8.473 -0.489 4.106 1.00 98.71 H
+ATOM 1932 OE1 GLN A 125 -6.788 0.658 5.260 1.00 98.71 O
+ATOM 1933 N LEU A 126 -6.910 -2.965 9.759 1.00 98.85 N
+ATOM 1934 H LEU A 126 -5.988 -2.771 9.396 1.00 98.85 H
+ATOM 1935 CA LEU A 126 -7.202 -4.336 10.198 1.00 98.85 C
+ATOM 1936 HA LEU A 126 -8.108 -4.674 9.695 1.00 98.85 H
+ATOM 1937 C LEU A 126 -7.439 -4.391 11.709 1.00 98.85 C
+ATOM 1938 CB LEU A 126 -6.040 -5.281 9.831 1.00 98.85 C
+ATOM 1939 HB2 LEU A 126 -5.119 -4.911 10.283 1.00 98.85 H
+ATOM 1940 HB3 LEU A 126 -5.886 -5.297 8.752 1.00 98.85 H
+ATOM 1941 O LEU A 126 -8.443 -4.935 12.163 1.00 98.85 O
+ATOM 1942 CG LEU A 126 -6.213 -6.732 10.290 1.00 98.85 C
+ATOM 1943 HG LEU A 126 -6.377 -6.758 11.367 1.00 98.85 H
+ATOM 1944 CD1 LEU A 126 -7.388 -7.405 9.589 1.00 98.85 C
+ATOM 1945 HD11 LEU A 126 -7.236 -7.392 8.510 1.00 98.85 H
+ATOM 1946 HD12 LEU A 126 -8.308 -6.871 9.830 1.00 98.85 H
+ATOM 1947 HD13 LEU A 126 -7.477 -8.437 9.929 1.00 98.85 H
+ATOM 1948 CD2 LEU A 126 -4.938 -7.513 10.001 1.00 98.85 C
+ATOM 1949 HD21 LEU A 126 -4.795 -7.614 8.925 1.00 98.85 H
+ATOM 1950 HD22 LEU A 126 -5.016 -8.499 10.461 1.00 98.85 H
+ATOM 1951 HD23 LEU A 126 -4.077 -6.999 10.429 1.00 98.85 H
+ATOM 1952 N LEU A 127 -6.520 -3.827 12.499 1.00 98.80 N
+ATOM 1953 H LEU A 127 -5.725 -3.382 12.062 1.00 98.80 H
+ATOM 1954 CA LEU A 127 -6.598 -3.887 13.963 1.00 98.80 C
+ATOM 1955 HA LEU A 127 -6.658 -4.932 14.266 1.00 98.80 H
+ATOM 1956 C LEU A 127 -7.855 -3.193 14.506 1.00 98.80 C
+ATOM 1957 CB LEU A 127 -5.347 -3.263 14.598 1.00 98.80 C
+ATOM 1958 HB2 LEU A 127 -5.330 -2.200 14.360 1.00 98.80 H
+ATOM 1959 HB3 LEU A 127 -5.453 -3.361 15.678 1.00 98.80 H
+ATOM 1960 O LEU A 127 -8.450 -3.671 15.474 1.00 98.80 O
+ATOM 1961 CG LEU A 127 -3.990 -3.865 14.197 1.00 98.80 C
+ATOM 1962 HG LEU A 127 -3.771 -3.595 13.164 1.00 98.80 H
+ATOM 1963 CD1 LEU A 127 -2.907 -3.237 15.071 1.00 98.80 C
+ATOM 1964 HD11 LEU A 127 -1.924 -3.559 14.727 1.00 98.80 H
+ATOM 1965 HD12 LEU A 127 -2.957 -2.152 14.980 1.00 98.80 H
+ATOM 1966 HD13 LEU A 127 -3.044 -3.523 16.114 1.00 98.80 H
+ATOM 1967 CD2 LEU A 127 -3.926 -5.390 14.306 1.00 98.80 C
+ATOM 1968 HD21 LEU A 127 -4.621 -5.838 13.597 1.00 98.80 H
+ATOM 1969 HD22 LEU A 127 -2.922 -5.727 14.046 1.00 98.80 H
+ATOM 1970 HD23 LEU A 127 -4.167 -5.717 15.318 1.00 98.80 H
+ATOM 1971 N ILE A 128 -8.275 -2.098 13.865 1.00 98.81 N
+ATOM 1972 H ILE A 128 -7.706 -1.754 13.106 1.00 98.81 H
+ATOM 1973 CA ILE A 128 -9.501 -1.369 14.214 1.00 98.81 C
+ATOM 1974 HA ILE A 128 -9.465 -1.112 15.272 1.00 98.81 H
+ATOM 1975 C ILE A 128 -10.735 -2.255 14.013 1.00 98.81 C
+ATOM 1976 CB ILE A 128 -9.591 -0.058 13.396 1.00 98.81 C
+ATOM 1977 HB ILE A 128 -9.419 -0.295 12.347 1.00 98.81 H
+ATOM 1978 O ILE A 128 -11.565 -2.366 14.919 1.00 98.81 O
+ATOM 1979 CG1 ILE A 128 -8.506 0.938 13.865 1.00 98.81 C
+ATOM 1980 HG12 ILE A 128 -7.555 0.422 13.996 1.00 98.81 H
+ATOM 1981 HG13 ILE A 128 -8.788 1.350 14.834 1.00 98.81 H
+ATOM 1982 CG2 ILE A 128 -10.987 0.588 13.523 1.00 98.81 C
+ATOM 1983 HG21 ILE A 128 -11.744 -0.053 13.070 1.00 98.81 H
+ATOM 1984 HG22 ILE A 128 -11.022 1.543 13.000 1.00 98.81 H
+ATOM 1985 HG23 ILE A 128 -11.233 0.750 14.572 1.00 98.81 H
+ATOM 1986 CD1 ILE A 128 -8.269 2.090 12.882 1.00 98.81 C
+ATOM 1987 HD11 ILE A 128 -7.971 1.696 11.910 1.00 98.81 H
+ATOM 1988 HD12 ILE A 128 -7.471 2.728 13.262 1.00 98.81 H
+ATOM 1989 HD13 ILE A 128 -9.169 2.694 12.767 1.00 98.81 H
+ATOM 1990 N VAL A 129 -10.865 -2.914 12.854 1.00 98.76 N
+ATOM 1991 H VAL A 129 -10.153 -2.817 12.144 1.00 98.76 H
+ATOM 1992 CA VAL A 129 -12.019 -3.794 12.600 1.00 98.76 C
+ATOM 1993 HA VAL A 129 -12.907 -3.286 12.977 1.00 98.76 H
+ATOM 1994 C VAL A 129 -11.955 -5.111 13.378 1.00 98.76 C
+ATOM 1995 CB VAL A 129 -12.279 -4.042 11.107 1.00 98.76 C
+ATOM 1996 HB VAL A 129 -13.182 -4.649 11.046 1.00 98.76 H
+ATOM 1997 O VAL A 129 -12.997 -5.710 13.624 1.00 98.76 O
+ATOM 1998 CG1 VAL A 129 -12.565 -2.729 10.369 1.00 98.76 C
+ATOM 1999 HG11 VAL A 129 -12.920 -2.951 9.363 1.00 98.76 H
+ATOM 2000 HG12 VAL A 129 -13.340 -2.169 10.892 1.00 98.76 H
+ATOM 2001 HG13 VAL A 129 -11.660 -2.125 10.305 1.00 98.76 H
+ATOM 2002 CG2 VAL A 129 -11.166 -4.811 10.395 1.00 98.76 C
+ATOM 2003 HG21 VAL A 129 -10.255 -4.213 10.365 1.00 98.76 H
+ATOM 2004 HG22 VAL A 129 -10.962 -5.753 10.904 1.00 98.76 H
+ATOM 2005 HG23 VAL A 129 -11.479 -5.030 9.375 1.00 98.76 H
+ATOM 2006 N LEU A 130 -10.772 -5.518 13.849 1.00 98.76 N
+ATOM 2007 H LEU A 130 -9.948 -5.031 13.527 1.00 98.76 H
+ATOM 2008 CA LEU A 130 -10.584 -6.606 14.820 1.00 98.76 C
+ATOM 2009 HA LEU A 130 -11.245 -7.430 14.548 1.00 98.76 H
+ATOM 2010 C LEU A 130 -10.979 -6.235 16.257 1.00 98.76 C
+ATOM 2011 CB LEU A 130 -9.121 -7.088 14.787 1.00 98.76 C
+ATOM 2012 HB2 LEU A 130 -8.920 -7.691 15.671 1.00 98.76 H
+ATOM 2013 HB3 LEU A 130 -8.468 -6.216 14.838 1.00 98.76 H
+ATOM 2014 O LEU A 130 -10.769 -7.031 17.168 1.00 98.76 O
+ATOM 2015 CG LEU A 130 -8.735 -7.935 13.570 1.00 98.76 C
+ATOM 2016 HG LEU A 130 -8.917 -7.386 12.646 1.00 98.76 H
+ATOM 2017 CD1 LEU A 130 -7.246 -8.268 13.676 1.00 98.76 C
+ATOM 2018 HD11 LEU A 130 -7.057 -8.872 14.563 1.00 98.76 H
+ATOM 2019 HD12 LEU A 130 -6.928 -8.813 12.787 1.00 98.76 H
+ATOM 2020 HD13 LEU A 130 -6.669 -7.345 13.735 1.00 98.76 H
+ATOM 2021 CD2 LEU A 130 -9.513 -9.249 13.523 1.00 98.76 C
+ATOM 2022 HD21 LEU A 130 -9.140 -9.855 12.697 1.00 98.76 H
+ATOM 2023 HD22 LEU A 130 -10.571 -9.054 13.345 1.00 98.76 H
+ATOM 2024 HD23 LEU A 130 -9.398 -9.799 14.457 1.00 98.76 H
+ATOM 2025 N ASN A 131 -11.538 -5.043 16.482 1.00 98.64 N
+ATOM 2026 H ASN A 131 -11.639 -4.418 15.694 1.00 98.64 H
+ATOM 2027 CA ASN A 131 -11.985 -4.564 17.790 1.00 98.64 C
+ATOM 2028 HA ASN A 131 -12.399 -3.571 17.615 1.00 98.64 H
+ATOM 2029 C ASN A 131 -10.872 -4.344 18.827 1.00 98.64 C
+ATOM 2030 CB ASN A 131 -13.128 -5.459 18.316 1.00 98.64 C
+ATOM 2031 HB2 ASN A 131 -13.482 -5.084 19.277 1.00 98.64 H
+ATOM 2032 HB3 ASN A 131 -12.776 -6.477 18.480 1.00 98.64 H
+ATOM 2033 O ASN A 131 -11.182 -4.126 20.006 1.00 98.64 O
+ATOM 2034 CG ASN A 131 -14.295 -5.466 17.365 1.00 98.64 C
+ATOM 2035 ND2 ASN A 131 -14.712 -6.590 16.850 1.00 98.64 N
+ATOM 2036 HD21 ASN A 131 -14.276 -7.461 17.115 1.00 98.64 H
+ATOM 2037 HD22 ASN A 131 -15.460 -6.555 16.172 1.00 98.64 H
+ATOM 2038 OD1 ASN A 131 -14.862 -4.413 17.135 1.00 98.64 O
+ATOM 2039 N LEU A 132 -9.601 -4.328 18.406 1.00 98.50 N
+ATOM 2040 H LEU A 132 -9.413 -4.438 17.419 1.00 98.50 H
+ATOM 2041 CA LEU A 132 -8.491 -4.005 19.297 1.00 98.50 C
+ATOM 2042 HA LEU A 132 -8.595 -4.614 20.195 1.00 98.50 H
+ATOM 2043 C LEU A 132 -8.562 -2.538 19.722 1.00 98.50 C
+ATOM 2044 CB LEU A 132 -7.130 -4.320 18.655 1.00 98.50 C
+ATOM 2045 HB2 LEU A 132 -6.358 -4.054 19.377 1.00 98.50 H
+ATOM 2046 HB3 LEU A 132 -6.999 -3.687 17.778 1.00 98.50 H
+ATOM 2047 O LEU A 132 -8.870 -1.648 18.930 1.00 98.50 O
+ATOM 2048 CG LEU A 132 -6.914 -5.784 18.237 1.00 98.50 C
+ATOM 2049 HG LEU A 132 -7.492 -5.993 17.337 1.00 98.50 H
+ATOM 2050 CD1 LEU A 132 -5.429 -5.992 17.929 1.00 98.50 C
+ATOM 2051 HD11 LEU A 132 -4.846 -5.960 18.849 1.00 98.50 H
+ATOM 2052 HD12 LEU A 132 -5.294 -6.957 17.441 1.00 98.50 H
+ATOM 2053 HD13 LEU A 132 -5.086 -5.200 17.262 1.00 98.50 H
+ATOM 2054 CD2 LEU A 132 -7.310 -6.774 19.328 1.00 98.50 C
+ATOM 2055 HD21 LEU A 132 -6.910 -6.468 20.294 1.00 98.50 H
+ATOM 2056 HD22 LEU A 132 -8.396 -6.841 19.396 1.00 98.50 H
+ATOM 2057 HD23 LEU A 132 -6.929 -7.767 19.089 1.00 98.50 H
+ATOM 2058 N LYS A 133 -8.254 -2.274 20.992 1.00 97.94 N
+ATOM 2059 H LYS A 133 -7.976 -3.045 21.583 1.00 97.94 H
+ATOM 2060 CA LYS A 133 -8.288 -0.927 21.579 1.00 97.94 C
+ATOM 2061 HA LYS A 133 -8.045 -0.208 20.797 1.00 97.94 H
+ATOM 2062 C LYS A 133 -7.239 -0.763 22.678 1.00 97.94 C
+ATOM 2063 CB LYS A 133 -9.721 -0.631 22.063 1.00 97.94 C
+ATOM 2064 HB2 LYS A 133 -9.790 0.413 22.368 1.00 97.94 H
+ATOM 2065 HB3 LYS A 133 -10.404 -0.777 21.225 1.00 97.94 H
+ATOM 2066 O LYS A 133 -6.661 -1.742 23.150 1.00 97.94 O
+ATOM 2067 CG LYS A 133 -10.152 -1.526 23.237 1.00 97.94 C
+ATOM 2068 HG2 LYS A 133 -9.944 -2.572 23.013 1.00 97.94 H
+ATOM 2069 HG3 LYS A 133 -9.567 -1.250 24.114 1.00 97.94 H
+ATOM 2070 CD LYS A 133 -11.637 -1.391 23.592 1.00 97.94 C
+ATOM 2071 HD2 LYS A 133 -11.777 -1.852 24.570 1.00 97.94 H
+ATOM 2072 HD3 LYS A 133 -11.909 -0.338 23.665 1.00 97.94 H
+ATOM 2073 CE LYS A 133 -12.529 -2.108 22.569 1.00 97.94 C
+ATOM 2074 HE2 LYS A 133 -12.073 -3.068 22.329 1.00 97.94 H
+ATOM 2075 HE3 LYS A 133 -12.559 -1.526 21.648 1.00 97.94 H
+ATOM 2076 NZ LYS A 133 -13.891 -2.324 23.121 1.00 97.94 N
+ATOM 2077 HZ1 LYS A 133 -13.827 -2.854 23.979 1.00 97.94 H
+ATOM 2078 HZ2 LYS A 133 -14.451 -2.865 22.478 1.00 97.94 H
+ATOM 2079 HZ3 LYS A 133 -14.345 -1.445 23.327 1.00 97.94 H
+ATOM 2080 N GLY A 134 -7.008 0.482 23.097 1.00 98.27 N
+ATOM 2081 H GLY A 134 -7.482 1.238 22.625 1.00 98.27 H
+ATOM 2082 CA GLY A 134 -6.139 0.813 24.229 1.00 98.27 C
+ATOM 2083 HA2 GLY A 134 -6.059 1.896 24.321 1.00 98.27 H
+ATOM 2084 HA3 GLY A 134 -6.593 0.430 25.143 1.00 98.27 H
+ATOM 2085 C GLY A 134 -4.724 0.242 24.093 1.00 98.27 C
+ATOM 2086 O GLY A 134 -4.118 0.294 23.021 1.00 98.27 O
+ATOM 2087 N LYS A 135 -4.203 -0.325 25.188 1.00 98.01 N
+ATOM 2088 H LYS A 135 -4.761 -0.335 26.029 1.00 98.01 H
+ATOM 2089 CA LYS A 135 -2.836 -0.859 25.252 1.00 98.01 C
+ATOM 2090 HA LYS A 135 -2.152 -0.045 25.012 1.00 98.01 H
+ATOM 2091 C LYS A 135 -2.576 -1.962 24.229 1.00 98.01 C
+ATOM 2092 CB LYS A 135 -2.554 -1.359 26.681 1.00 98.01 C
+ATOM 2093 HB2 LYS A 135 -2.681 -0.531 27.378 1.00 98.01 H
+ATOM 2094 HB3 LYS A 135 -3.285 -2.125 26.939 1.00 98.01 H
+ATOM 2095 O LYS A 135 -1.485 -1.990 23.664 1.00 98.01 O
+ATOM 2096 CG LYS A 135 -1.148 -1.956 26.880 1.00 98.01 C
+ATOM 2097 HG2 LYS A 135 -1.070 -2.294 27.913 1.00 98.01 H
+ATOM 2098 HG3 LYS A 135 -1.026 -2.829 26.239 1.00 98.01 H
+ATOM 2099 CD LYS A 135 -0.020 -0.945 26.611 1.00 98.01 C
+ATOM 2100 HD2 LYS A 135 -0.154 -0.091 27.275 1.00 98.01 H
+ATOM 2101 HD3 LYS A 135 -0.058 -0.587 25.583 1.00 98.01 H
+ATOM 2102 CE LYS A 135 1.358 -1.558 26.884 1.00 98.01 C
+ATOM 2103 HE2 LYS A 135 2.094 -0.755 26.903 1.00 98.01 H
+ATOM 2104 HE3 LYS A 135 1.348 -2.018 27.872 1.00 98.01 H
+ATOM 2105 NZ LYS A 135 1.729 -2.554 25.849 1.00 98.01 N
+ATOM 2106 HZ1 LYS A 135 1.037 -3.287 25.789 1.00 98.01 H
+ATOM 2107 HZ2 LYS A 135 2.626 -2.967 26.061 1.00 98.01 H
+ATOM 2108 HZ3 LYS A 135 1.776 -2.110 24.943 1.00 98.01 H
+ATOM 2109 N GLU A 136 -3.542 -2.853 24.000 1.00 98.31 N
+ATOM 2110 H GLU A 136 -4.433 -2.747 24.462 1.00 98.31 H
+ATOM 2111 CA GLU A 136 -3.365 -3.959 23.058 1.00 98.31 C
+ATOM 2112 HA GLU A 136 -2.437 -4.474 23.306 1.00 98.31 H
+ATOM 2113 C GLU A 136 -3.230 -3.450 21.623 1.00 98.31 C
+ATOM 2114 CB GLU A 136 -4.509 -4.977 23.172 1.00 98.31 C
+ATOM 2115 HB2 GLU A 136 -4.564 -5.336 24.200 1.00 98.31 H
+ATOM 2116 HB3 GLU A 136 -5.452 -4.504 22.901 1.00 98.31 H
+ATOM 2117 O GLU A 136 -2.305 -3.878 20.929 1.00 98.31 O
+ATOM 2118 CG GLU A 136 -4.222 -6.160 22.230 1.00 98.31 C
+ATOM 2119 HG2 GLU A 136 -4.203 -5.805 21.200 1.00 98.31 H
+ATOM 2120 HG3 GLU A 136 -3.233 -6.555 22.460 1.00 98.31 H
+ATOM 2121 CD GLU A 136 -5.235 -7.301 22.299 1.00 98.31 C
+ATOM 2122 OE1 GLU A 136 -4.897 -8.336 21.669 1.00 98.31 O
+ATOM 2123 OE2 GLU A 136 -6.290 -7.119 22.938 1.00 98.31 O
+ATOM 2124 N LEU A 137 -4.094 -2.514 21.204 1.00 98.55 N
+ATOM 2125 H LEU A 137 -4.815 -2.208 21.842 1.00 98.55 H
+ATOM 2126 CA LEU A 137 -3.996 -1.872 19.891 1.00 98.55 C
+ATOM 2127 HA LEU A 137 -4.089 -2.638 19.121 1.00 98.55 H
+ATOM 2128 C LEU A 137 -2.631 -1.209 19.720 1.00 98.55 C
+ATOM 2129 CB LEU A 137 -5.132 -0.848 19.717 1.00 98.55 C
+ATOM 2130 HB2 LEU A 137 -5.115 -0.156 20.559 1.00 98.55 H
+ATOM 2131 HB3 LEU A 137 -6.079 -1.388 19.733 1.00 98.55 H
+ATOM 2132 O LEU A 137 -1.943 -1.501 18.747 1.00 98.55 O
+ATOM 2133 CG LEU A 137 -5.070 -0.024 18.415 1.00 98.55 C
+ATOM 2134 HG LEU A 137 -4.128 0.523 18.368 1.00 98.55 H
+ATOM 2135 CD1 LEU A 137 -5.197 -0.906 17.176 1.00 98.55 C
+ATOM 2136 HD11 LEU A 137 -6.126 -1.475 17.214 1.00 98.55 H
+ATOM 2137 HD12 LEU A 137 -5.206 -0.280 16.284 1.00 98.55 H
+ATOM 2138 HD13 LEU A 137 -4.344 -1.581 17.108 1.00 98.55 H
+ATOM 2139 CD2 LEU A 137 -6.208 0.995 18.400 1.00 98.55 C
+ATOM 2140 HD21 LEU A 137 -7.170 0.484 18.412 1.00 98.55 H
+ATOM 2141 HD22 LEU A 137 -6.128 1.655 19.264 1.00 98.55 H
+ATOM 2142 HD23 LEU A 137 -6.142 1.600 17.495 1.00 98.55 H
+ATOM 2143 N PHE A 138 -2.222 -0.385 20.691 1.00 98.59 N
+ATOM 2144 H PHE A 138 -2.846 -0.196 21.462 1.00 98.59 H
+ATOM 2145 CA PHE A 138 -0.946 0.324 20.637 1.00 98.59 C
+ATOM 2146 HA PHE A 138 -0.938 0.956 19.750 1.00 98.59 H
+ATOM 2147 C PHE A 138 0.232 -0.645 20.498 1.00 98.59 C
+ATOM 2148 CB PHE A 138 -0.796 1.229 21.866 1.00 98.59 C
+ATOM 2149 HB2 PHE A 138 -1.640 1.918 21.899 1.00 98.59 H
+ATOM 2150 HB3 PHE A 138 -0.833 0.623 22.772 1.00 98.59 H
+ATOM 2151 O PHE A 138 0.965 -0.563 19.521 1.00 98.59 O
+ATOM 2152 CG PHE A 138 0.489 2.035 21.857 1.00 98.59 C
+ATOM 2153 CD1 PHE A 138 1.638 1.550 22.512 1.00 98.59 C
+ATOM 2154 HD1 PHE A 138 1.609 0.603 23.030 1.00 98.59 H
+ATOM 2155 CD2 PHE A 138 0.548 3.257 21.161 1.00 98.59 C
+ATOM 2156 HD2 PHE A 138 -0.322 3.633 20.644 1.00 98.59 H
+ATOM 2157 CE1 PHE A 138 2.837 2.284 22.474 1.00 98.59 C
+ATOM 2158 HE1 PHE A 138 3.725 1.910 22.961 1.00 98.59 H
+ATOM 2159 CE2 PHE A 138 1.746 3.992 21.126 1.00 98.59 C
+ATOM 2160 HE2 PHE A 138 1.792 4.928 20.590 1.00 98.59 H
+ATOM 2161 CZ PHE A 138 2.889 3.507 21.783 1.00 98.59 C
+ATOM 2162 HZ PHE A 138 3.810 4.070 21.748 1.00 98.59 H
+ATOM 2163 N SER A 139 0.385 -1.624 21.401 1.00 98.43 N
+ATOM 2164 H SER A 139 -0.286 -1.721 22.150 1.00 98.43 H
+ATOM 2165 CA SER A 139 1.528 -2.547 21.311 1.00 98.43 C
+ATOM 2166 HA SER A 139 2.436 -1.949 21.234 1.00 98.43 H
+ATOM 2167 C SER A 139 1.499 -3.432 20.073 1.00 98.43 C
+ATOM 2168 CB SER A 139 1.665 -3.442 22.540 1.00 98.43 C
+ATOM 2169 HB2 SER A 139 2.408 -4.213 22.337 1.00 98.43 H
+ATOM 2170 HB3 SER A 139 2.043 -2.825 23.356 1.00 98.43 H
+ATOM 2171 O SER A 139 2.554 -3.734 19.528 1.00 98.43 O
+ATOM 2172 OG SER A 139 0.453 -4.054 22.943 1.00 98.43 O
+ATOM 2173 HG SER A 139 -0.043 -4.314 22.163 1.00 98.43 H
+ATOM 2174 N THR A 140 0.314 -3.861 19.631 1.00 98.61 N
+ATOM 2175 H THR A 140 -0.531 -3.517 20.064 1.00 98.61 H
+ATOM 2176 CA THR A 140 0.196 -4.691 18.426 1.00 98.61 C
+ATOM 2177 HA THR A 140 0.886 -5.531 18.499 1.00 98.61 H
+ATOM 2178 C THR A 140 0.589 -3.888 17.190 1.00 98.61 C
+ATOM 2179 CB THR A 140 -1.224 -5.250 18.272 1.00 98.61 C
+ATOM 2180 HB THR A 140 -1.926 -4.426 18.145 1.00 98.61 H
+ATOM 2181 O THR A 140 1.372 -4.376 16.380 1.00 98.61 O
+ATOM 2182 CG2 THR A 140 -1.358 -6.194 17.084 1.00 98.61 C
+ATOM 2183 HG21 THR A 140 -0.655 -7.022 17.177 1.00 98.61 H
+ATOM 2184 HG22 THR A 140 -2.382 -6.566 17.044 1.00 98.61 H
+ATOM 2185 HG23 THR A 140 -1.158 -5.661 16.154 1.00 98.61 H
+ATOM 2186 OG1 THR A 140 -1.587 -5.978 19.428 1.00 98.61 O
+ATOM 2187 HG1 THR A 140 -1.916 -5.311 20.036 1.00 98.61 H
+ATOM 2188 N ALA A 141 0.105 -2.646 17.074 1.00 98.59 N
+ATOM 2189 H ALA A 141 -0.515 -2.283 17.784 1.00 98.59 H
+ATOM 2190 CA ALA A 141 0.479 -1.739 15.997 1.00 98.59 C
+ATOM 2191 HA ALA A 141 0.255 -2.216 15.042 1.00 98.59 H
+ATOM 2192 C ALA A 141 1.983 -1.434 16.016 1.00 98.59 C
+ATOM 2193 CB ALA A 141 -0.359 -0.460 16.104 1.00 98.59 C
+ATOM 2194 HB1 ALA A 141 -1.421 -0.702 16.066 1.00 98.59 H
+ATOM 2195 HB2 ALA A 141 -0.143 0.054 17.041 1.00 98.59 H
+ATOM 2196 HB3 ALA A 141 -0.118 0.202 15.273 1.00 98.59 H
+ATOM 2197 O ALA A 141 2.615 -1.520 14.972 1.00 98.59 O
+ATOM 2198 N THR A 142 2.578 -1.159 17.183 1.00 98.66 N
+ATOM 2199 H THR A 142 2.008 -1.030 18.007 1.00 98.66 H
+ATOM 2200 CA THR A 142 4.025 -0.914 17.305 1.00 98.66 C
+ATOM 2201 HA THR A 142 4.280 -0.032 16.717 1.00 98.66 H
+ATOM 2202 C THR A 142 4.847 -2.075 16.750 1.00 98.66 C
+ATOM 2203 CB THR A 142 4.431 -0.661 18.766 1.00 98.66 C
+ATOM 2204 HB THR A 142 4.209 -1.548 19.359 1.00 98.66 H
+ATOM 2205 O THR A 142 5.692 -1.856 15.889 1.00 98.66 O
+ATOM 2206 CG2 THR A 142 5.912 -0.322 18.925 1.00 98.66 C
+ATOM 2207 HG21 THR A 142 6.116 -0.038 19.957 1.00 98.66 H
+ATOM 2208 HG22 THR A 142 6.524 -1.190 18.682 1.00 98.66 H
+ATOM 2209 HG23 THR A 142 6.185 0.501 18.264 1.00 98.66 H
+ATOM 2210 OG1 THR A 142 3.717 0.422 19.309 1.00 98.66 O
+ATOM 2211 HG1 THR A 142 3.956 1.215 18.823 1.00 98.66 H
+ATOM 2212 N TRP A 143 4.589 -3.312 17.189 1.00 98.65 N
+ATOM 2213 H TRP A 143 3.877 -3.453 17.891 1.00 98.65 H
+ATOM 2214 CA TRP A 143 5.350 -4.474 16.713 1.00 98.65 C
+ATOM 2215 HA TRP A 143 6.414 -4.275 16.845 1.00 98.65 H
+ATOM 2216 C TRP A 143 5.153 -4.746 15.221 1.00 98.65 C
+ATOM 2217 CB TRP A 143 4.983 -5.711 17.538 1.00 98.65 C
+ATOM 2218 HB2 TRP A 143 5.344 -6.595 17.013 1.00 98.65 H
+ATOM 2219 HB3 TRP A 143 3.898 -5.792 17.615 1.00 98.65 H
+ATOM 2220 O TRP A 143 6.116 -5.065 14.527 1.00 98.65 O
+ATOM 2221 CG TRP A 143 5.595 -5.734 18.901 1.00 98.65 C
+ATOM 2222 CD1 TRP A 143 4.935 -5.725 20.080 1.00 98.65 C
+ATOM 2223 HD1 TRP A 143 3.859 -5.704 20.175 1.00 98.65 H
+ATOM 2224 CD2 TRP A 143 7.015 -5.785 19.237 1.00 98.65 C
+ATOM 2225 CE2 TRP A 143 7.140 -5.792 20.657 1.00 98.65 C
+ATOM 2226 CE3 TRP A 143 8.207 -5.836 18.483 1.00 98.65 C
+ATOM 2227 HE3 TRP A 143 8.157 -5.845 17.404 1.00 98.65 H
+ATOM 2228 NE1 TRP A 143 5.843 -5.755 21.120 1.00 98.65 N
+ATOM 2229 HE1 TRP A 143 5.588 -5.786 22.097 1.00 98.65 H
+ATOM 2230 CH2 TRP A 143 9.552 -5.887 20.524 1.00 98.65 C
+ATOM 2231 HH2 TRP A 143 10.521 -5.927 20.998 1.00 98.65 H
+ATOM 2232 CZ2 TRP A 143 8.383 -5.842 21.303 1.00 98.65 C
+ATOM 2233 HZ2 TRP A 143 8.447 -5.851 22.381 1.00 98.65 H
+ATOM 2234 CZ3 TRP A 143 9.462 -5.884 19.120 1.00 98.65 C
+ATOM 2235 HZ3 TRP A 143 10.364 -5.923 18.528 1.00 98.65 H
+ATOM 2236 N LEU A 144 3.928 -4.580 14.720 1.00 98.76 N
+ATOM 2237 H LEU A 144 3.180 -4.312 15.343 1.00 98.76 H
+ATOM 2238 CA LEU A 144 3.629 -4.717 13.296 1.00 98.76 C
+ATOM 2239 HA LEU A 144 4.003 -5.678 12.945 1.00 98.76 H
+ATOM 2240 C LEU A 144 4.341 -3.658 12.447 1.00 98.76 C
+ATOM 2241 CB LEU A 144 2.106 -4.642 13.106 1.00 98.76 C
+ATOM 2242 HB2 LEU A 144 1.888 -4.339 12.082 1.00 98.76 H
+ATOM 2243 HB3 LEU A 144 1.704 -3.862 13.752 1.00 98.76 H
+ATOM 2244 O LEU A 144 4.903 -3.999 11.413 1.00 98.76 O
+ATOM 2245 CG LEU A 144 1.374 -5.964 13.376 1.00 98.76 C
+ATOM 2246 HG LEU A 144 1.613 -6.311 14.382 1.00 98.76 H
+ATOM 2247 CD1 LEU A 144 -0.132 -5.734 13.289 1.00 98.76 C
+ATOM 2248 HD11 LEU A 144 -0.410 -4.969 14.013 1.00 98.76 H
+ATOM 2249 HD12 LEU A 144 -0.660 -6.660 13.519 1.00 98.76 H
+ATOM 2250 HD13 LEU A 144 -0.405 -5.400 12.288 1.00 98.76 H
+ATOM 2251 CD2 LEU A 144 1.732 -7.056 12.368 1.00 98.76 C
+ATOM 2252 HD21 LEU A 144 1.095 -7.926 12.523 1.00 98.76 H
+ATOM 2253 HD22 LEU A 144 2.767 -7.371 12.498 1.00 98.76 H
+ATOM 2254 HD23 LEU A 144 1.594 -6.690 11.350 1.00 98.76 H
+ATOM 2255 N ILE A 145 4.356 -2.397 12.885 1.00 98.71 N
+ATOM 2256 H ILE A 145 3.867 -2.180 13.742 1.00 98.71 H
+ATOM 2257 CA ILE A 145 5.022 -1.299 12.171 1.00 98.71 C
+ATOM 2258 HA ILE A 145 4.715 -1.327 11.126 1.00 98.71 H
+ATOM 2259 C ILE A 145 6.541 -1.488 12.180 1.00 98.71 C
+ATOM 2260 CB ILE A 145 4.597 0.066 12.757 1.00 98.71 C
+ATOM 2261 HB ILE A 145 4.717 0.034 13.840 1.00 98.71 H
+ATOM 2262 O ILE A 145 7.170 -1.319 11.142 1.00 98.71 O
+ATOM 2263 CG1 ILE A 145 3.110 0.324 12.418 1.00 98.71 C
+ATOM 2264 HG12 ILE A 145 2.513 -0.557 12.654 1.00 98.71 H
+ATOM 2265 HG13 ILE A 145 3.015 0.484 11.344 1.00 98.71 H
+ATOM 2266 CG2 ILE A 145 5.469 1.213 12.209 1.00 98.71 C
+ATOM 2267 HG21 ILE A 145 5.435 1.230 11.119 1.00 98.71 H
+ATOM 2268 HG22 ILE A 145 6.508 1.094 12.519 1.00 98.71 H
+ATOM 2269 HG23 ILE A 145 5.136 2.178 12.591 1.00 98.71 H
+ATOM 2270 CD1 ILE A 145 2.491 1.511 13.168 1.00 98.71 C
+ATOM 2271 HD11 ILE A 145 2.637 1.389 14.241 1.00 98.71 H
+ATOM 2272 HD12 ILE A 145 2.937 2.449 12.840 1.00 98.71 H
+ATOM 2273 HD13 ILE A 145 1.421 1.546 12.959 1.00 98.71 H
+ATOM 2274 N LEU A 146 7.131 -1.895 13.308 1.00 98.70 N
+ATOM 2275 H LEU A 146 6.568 -2.002 14.140 1.00 98.70 H
+ATOM 2276 CA LEU A 146 8.565 -2.192 13.380 1.00 98.70 C
+ATOM 2277 HA LEU A 146 9.125 -1.323 13.034 1.00 98.70 H
+ATOM 2278 C LEU A 146 8.954 -3.349 12.451 1.00 98.70 C
+ATOM 2279 CB LEU A 146 8.959 -2.515 14.832 1.00 98.70 C
+ATOM 2280 HB2 LEU A 146 8.290 -3.289 15.208 1.00 98.70 H
+ATOM 2281 HB3 LEU A 146 9.969 -2.925 14.830 1.00 98.70 H
+ATOM 2282 O LEU A 146 9.948 -3.246 11.736 1.00 98.70 O
+ATOM 2283 CG LEU A 146 8.933 -1.314 15.794 1.00 98.70 C
+ATOM 2284 HG LEU A 146 7.951 -0.840 15.781 1.00 98.70 H
+ATOM 2285 CD1 LEU A 146 9.214 -1.811 17.214 1.00 98.70 C
+ATOM 2286 HD11 LEU A 146 9.172 -0.974 17.911 1.00 98.70 H
+ATOM 2287 HD12 LEU A 146 8.464 -2.548 17.501 1.00 98.70 H
+ATOM 2288 HD13 LEU A 146 10.202 -2.268 17.261 1.00 98.70 H
+ATOM 2289 CD2 LEU A 146 9.971 -0.250 15.437 1.00 98.70 C
+ATOM 2290 HD21 LEU A 146 9.726 0.207 14.478 1.00 98.70 H
+ATOM 2291 HD22 LEU A 146 10.964 -0.697 15.381 1.00 98.70 H
+ATOM 2292 HD23 LEU A 146 9.972 0.534 16.194 1.00 98.70 H
+ATOM 2293 N ALA A 147 8.158 -4.423 12.420 1.00 98.60 N
+ATOM 2294 H ALA A 147 7.363 -4.468 13.042 1.00 98.60 H
+ATOM 2295 CA ALA A 147 8.385 -5.532 11.497 1.00 98.60 C
+ATOM 2296 HA ALA A 147 9.412 -5.874 11.621 1.00 98.60 H
+ATOM 2297 C ALA A 147 8.227 -5.092 10.031 1.00 98.60 C
+ATOM 2298 CB ALA A 147 7.444 -6.687 11.860 1.00 98.60 C
+ATOM 2299 HB1 ALA A 147 7.596 -6.976 12.900 1.00 98.60 H
+ATOM 2300 HB2 ALA A 147 7.663 -7.543 11.222 1.00 98.60 H
+ATOM 2301 HB3 ALA A 147 6.406 -6.385 11.717 1.00 98.60 H
+ATOM 2302 O ALA A 147 9.073 -5.419 9.202 1.00 98.60 O
+ATOM 2303 N ALA A 148 7.198 -4.297 9.719 1.00 98.61 N
+ATOM 2304 H ALA A 148 6.516 -4.082 10.432 1.00 98.61 H
+ATOM 2305 CA ALA A 148 6.984 -3.747 8.384 1.00 98.61 C
+ATOM 2306 HA ALA A 148 6.904 -4.573 7.676 1.00 98.61 H
+ATOM 2307 C ALA A 148 8.154 -2.862 7.934 1.00 98.61 C
+ATOM 2308 CB ALA A 148 5.666 -2.965 8.367 1.00 98.61 C
+ATOM 2309 HB1 ALA A 148 5.704 -2.143 9.083 1.00 98.61 H
+ATOM 2310 HB2 ALA A 148 4.837 -3.625 8.621 1.00 98.61 H
+ATOM 2311 HB3 ALA A 148 5.507 -2.554 7.370 1.00 98.61 H
+ATOM 2312 O ALA A 148 8.666 -3.042 6.835 1.00 98.61 O
+ATOM 2313 N TRP A 149 8.623 -1.938 8.773 1.00 98.79 N
+ATOM 2314 H TRP A 149 8.161 -1.801 9.660 1.00 98.79 H
+ATOM 2315 CA TRP A 149 9.773 -1.092 8.449 1.00 98.79 C
+ATOM 2316 HA TRP A 149 9.606 -0.604 7.489 1.00 98.79 H
+ATOM 2317 C TRP A 149 11.058 -1.901 8.286 1.00 98.79 C
+ATOM 2318 CB TRP A 149 9.933 -0.011 9.518 1.00 98.79 C
+ATOM 2319 HB2 TRP A 149 9.929 -0.480 10.502 1.00 98.79 H
+ATOM 2320 HB3 TRP A 149 10.910 0.453 9.385 1.00 98.79 H
+ATOM 2321 O TRP A 149 11.790 -1.661 7.332 1.00 98.79 O
+ATOM 2322 CG TRP A 149 8.920 1.094 9.507 1.00 98.79 C
+ATOM 2323 CD1 TRP A 149 7.959 1.319 8.577 1.00 98.79 C
+ATOM 2324 HD1 TRP A 149 7.786 0.708 7.703 1.00 98.79 H
+ATOM 2325 CD2 TRP A 149 8.809 2.191 10.459 1.00 98.79 C
+ATOM 2326 CE2 TRP A 149 7.761 3.059 10.031 1.00 98.79 C
+ATOM 2327 CE3 TRP A 149 9.514 2.548 11.629 1.00 98.79 C
+ATOM 2328 HE3 TRP A 149 10.323 1.918 11.967 1.00 98.79 H
+ATOM 2329 NE1 TRP A 149 7.278 2.482 8.875 1.00 98.79 N
+ATOM 2330 HE1 TRP A 149 6.578 2.886 8.269 1.00 98.79 H
+ATOM 2331 CH2 TRP A 149 8.147 4.555 11.894 1.00 98.79 C
+ATOM 2332 HH2 TRP A 149 7.912 5.459 12.437 1.00 98.79 H
+ATOM 2333 CZ2 TRP A 149 7.428 4.227 10.731 1.00 98.79 C
+ATOM 2334 HZ2 TRP A 149 6.640 4.870 10.368 1.00 98.79 H
+ATOM 2335 CZ3 TRP A 149 9.185 3.717 12.341 1.00 98.79 C
+ATOM 2336 HZ3 TRP A 149 9.744 3.982 13.226 1.00 98.79 H
+ATOM 2337 N GLY A 150 11.308 -2.898 9.142 1.00 98.66 N
+ATOM 2338 H GLY A 150 10.682 -3.042 9.922 1.00 98.66 H
+ATOM 2339 CA GLY A 150 12.430 -3.825 8.970 1.00 98.66 C
+ATOM 2340 HA2 GLY A 150 12.391 -4.583 9.752 1.00 98.66 H
+ATOM 2341 HA3 GLY A 150 13.371 -3.280 9.051 1.00 98.66 H
+ATOM 2342 C GLY A 150 12.390 -4.534 7.613 1.00 98.66 C
+ATOM 2343 O GLY A 150 13.382 -4.524 6.884 1.00 98.66 O
+ATOM 2344 N MET A 151 11.223 -5.063 7.229 1.00 98.84 N
+ATOM 2345 H MET A 151 10.455 -5.034 7.883 1.00 98.84 H
+ATOM 2346 CA MET A 151 10.980 -5.685 5.920 1.00 98.84 C
+ATOM 2347 HA MET A 151 11.652 -6.535 5.798 1.00 98.84 H
+ATOM 2348 C MET A 151 11.241 -4.713 4.759 1.00 98.84 C
+ATOM 2349 CB MET A 151 9.530 -6.199 5.884 1.00 98.84 C
+ATOM 2350 HB2 MET A 151 8.855 -5.367 6.085 1.00 98.84 H
+ATOM 2351 HB3 MET A 151 9.382 -6.935 6.674 1.00 98.84 H
+ATOM 2352 O MET A 151 11.955 -5.055 3.818 1.00 98.84 O
+ATOM 2353 CG MET A 151 9.117 -6.841 4.557 1.00 98.84 C
+ATOM 2354 HG2 MET A 151 9.376 -6.188 3.724 1.00 98.84 H
+ATOM 2355 HG3 MET A 151 9.666 -7.775 4.436 1.00 98.84 H
+ATOM 2356 SD MET A 151 7.341 -7.196 4.459 1.00 98.84 S
+ATOM 2357 CE MET A 151 6.666 -5.526 4.255 1.00 98.84 C
+ATOM 2358 HE1 MET A 151 6.872 -4.925 5.141 1.00 98.84 H
+ATOM 2359 HE2 MET A 151 7.117 -5.054 3.382 1.00 98.84 H
+ATOM 2360 HE3 MET A 151 5.588 -5.591 4.109 1.00 98.84 H
+ATOM 2361 N ILE A 152 10.682 -3.503 4.816 1.00 98.72 N
+ATOM 2362 H ILE A 152 10.105 -3.282 5.615 1.00 98.72 H
+ATOM 2363 CA ILE A 152 10.766 -2.525 3.723 1.00 98.72 C
+ATOM 2364 HA ILE A 152 10.509 -3.021 2.787 1.00 98.72 H
+ATOM 2365 C ILE A 152 12.188 -1.984 3.572 1.00 98.72 C
+ATOM 2366 CB ILE A 152 9.766 -1.377 3.953 1.00 98.72 C
+ATOM 2367 HB ILE A 152 9.988 -0.945 4.928 1.00 98.72 H
+ATOM 2368 O ILE A 152 12.683 -1.914 2.454 1.00 98.72 O
+ATOM 2369 CG1 ILE A 152 8.299 -1.866 3.943 1.00 98.72 C
+ATOM 2370 HG12 ILE A 152 8.219 -2.864 4.375 1.00 98.72 H
+ATOM 2371 HG13 ILE A 152 7.928 -1.927 2.919 1.00 98.72 H
+ATOM 2372 CG2 ILE A 152 9.929 -0.279 2.885 1.00 98.72 C
+ATOM 2373 HG21 ILE A 152 10.898 0.212 2.975 1.00 98.72 H
+ATOM 2374 HG22 ILE A 152 9.836 -0.702 1.885 1.00 98.72 H
+ATOM 2375 HG23 ILE A 152 9.167 0.489 3.012 1.00 98.72 H
+ATOM 2376 CD1 ILE A 152 7.412 -0.921 4.761 1.00 98.72 C
+ATOM 2377 HD11 ILE A 152 7.362 0.050 4.268 1.00 98.72 H
+ATOM 2378 HD12 ILE A 152 7.827 -0.781 5.759 1.00 98.72 H
+ATOM 2379 HD13 ILE A 152 6.406 -1.326 4.869 1.00 98.72 H
+ATOM 2380 N ILE A 153 12.860 -1.629 4.672 1.00 98.72 N
+ATOM 2381 H ILE A 153 12.398 -1.714 5.567 1.00 98.72 H
+ATOM 2382 CA ILE A 153 14.223 -1.079 4.644 1.00 98.72 C
+ATOM 2383 HA ILE A 153 14.246 -0.225 3.968 1.00 98.72 H
+ATOM 2384 C ILE A 153 15.199 -2.116 4.087 1.00 98.72 C
+ATOM 2385 CB ILE A 153 14.648 -0.599 6.053 1.00 98.72 C
+ATOM 2386 HB ILE A 153 14.450 -1.402 6.763 1.00 98.72 H
+ATOM 2387 O ILE A 153 15.981 -1.804 3.197 1.00 98.72 O
+ATOM 2388 CG1 ILE A 153 13.827 0.647 6.461 1.00 98.72 C
+ATOM 2389 HG12 ILE A 153 12.772 0.484 6.237 1.00 98.72 H
+ATOM 2390 HG13 ILE A 153 14.153 1.506 5.873 1.00 98.72 H
+ATOM 2391 CG2 ILE A 153 16.155 -0.275 6.109 1.00 98.72 C
+ATOM 2392 HG21 ILE A 153 16.405 0.477 5.360 1.00 98.72 H
+ATOM 2393 HG22 ILE A 153 16.753 -1.168 5.924 1.00 98.72 H
+ATOM 2394 HG23 ILE A 153 16.435 0.096 7.094 1.00 98.72 H
+ATOM 2395 CD1 ILE A 153 13.930 0.991 7.953 1.00 98.72 C
+ATOM 2396 HD11 ILE A 153 13.657 0.125 8.555 1.00 98.72 H
+ATOM 2397 HD12 ILE A 153 14.941 1.310 8.207 1.00 98.72 H
+ATOM 2398 HD13 ILE A 153 13.246 1.809 8.181 1.00 98.72 H
+ATOM 2399 N THR A 154 15.136 -3.356 4.573 1.00 98.58 N
+ATOM 2400 H THR A 154 14.448 -3.567 5.281 1.00 98.58 H
+ATOM 2401 CA THR A 154 16.016 -4.436 4.094 1.00 98.58 C
+ATOM 2402 HA THR A 154 17.053 -4.105 4.158 1.00 98.58 H
+ATOM 2403 C THR A 154 15.753 -4.760 2.624 1.00 98.58 C
+ATOM 2404 CB THR A 154 15.869 -5.697 4.956 1.00 98.58 C
+ATOM 2405 HB THR A 154 16.420 -6.519 4.500 1.00 98.58 H
+ATOM 2406 O THR A 154 16.700 -4.868 1.850 1.00 98.58 O
+ATOM 2407 CG2 THR A 154 16.377 -5.484 6.385 1.00 98.58 C
+ATOM 2408 HG21 THR A 154 16.269 -4.444 6.695 1.00 98.58 H
+ATOM 2409 HG22 THR A 154 17.429 -5.766 6.435 1.00 98.58 H
+ATOM 2410 HG23 THR A 154 15.822 -6.111 7.082 1.00 98.58 H
+ATOM 2411 OG1 THR A 154 14.523 -6.076 5.062 1.00 98.58 O
+ATOM 2412 HG1 THR A 154 14.123 -5.524 5.738 1.00 98.58 H
+ATOM 2413 N GLY A 155 14.485 -4.808 2.201 1.00 98.56 N
+ATOM 2414 H GLY A 155 13.745 -4.733 2.885 1.00 98.56 H
+ATOM 2415 CA GLY A 155 14.123 -4.974 0.791 1.00 98.56 C
+ATOM 2416 HA2 GLY A 155 14.571 -5.891 0.408 1.00 98.56 H
+ATOM 2417 HA3 GLY A 155 13.039 -5.057 0.716 1.00 98.56 H
+ATOM 2418 C GLY A 155 14.582 -3.805 -0.090 1.00 98.56 C
+ATOM 2419 O GLY A 155 15.076 -4.030 -1.192 1.00 98.56 O
+ATOM 2420 N TYR A 156 14.480 -2.568 0.407 1.00 98.37 N
+ATOM 2421 H TYR A 156 14.042 -2.444 1.308 1.00 98.37 H
+ATOM 2422 CA TYR A 156 14.960 -1.369 -0.284 1.00 98.37 C
+ATOM 2423 HA TYR A 156 14.507 -1.329 -1.274 1.00 98.37 H
+ATOM 2424 C TYR A 156 16.479 -1.384 -0.463 1.00 98.37 C
+ATOM 2425 CB TYR A 156 14.546 -0.104 0.479 1.00 98.37 C
+ATOM 2426 HB2 TYR A 156 13.461 -0.009 0.450 1.00 98.37 H
+ATOM 2427 HB3 TYR A 156 14.835 -0.202 1.525 1.00 98.37 H
+ATOM 2428 O TYR A 156 16.962 -1.054 -1.541 1.00 98.37 O
+ATOM 2429 CG TYR A 156 15.175 1.160 -0.080 1.00 98.37 C
+ATOM 2430 CD1 TYR A 156 16.309 1.716 0.544 1.00 98.37 C
+ATOM 2431 HD1 TYR A 156 16.715 1.255 1.433 1.00 98.37 H
+ATOM 2432 CD2 TYR A 156 14.676 1.733 -1.266 1.00 98.37 C
+ATOM 2433 HD2 TYR A 156 13.842 1.278 -1.779 1.00 98.37 H
+ATOM 2434 CE1 TYR A 156 16.934 2.852 -0.004 1.00 98.37 C
+ATOM 2435 HE1 TYR A 156 17.811 3.268 0.470 1.00 98.37 H
+ATOM 2436 CE2 TYR A 156 15.290 2.878 -1.810 1.00 98.37 C
+ATOM 2437 HE2 TYR A 156 14.919 3.321 -2.722 1.00 98.37 H
+ATOM 2438 OH TYR A 156 17.018 4.538 -1.707 1.00 98.37 O
+ATOM 2439 HH TYR A 156 17.790 4.795 -1.199 1.00 98.37 H
+ATOM 2440 CZ TYR A 156 16.420 3.438 -1.181 1.00 98.37 C
+ATOM 2441 N VAL A 157 17.235 -1.782 0.565 1.00 98.25 N
+ATOM 2442 H VAL A 157 16.786 -2.010 1.440 1.00 98.25 H
+ATOM 2443 CA VAL A 157 18.692 -1.934 0.448 1.00 98.25 C
+ATOM 2444 HA VAL A 157 19.111 -1.006 0.060 1.00 98.25 H
+ATOM 2445 C VAL A 157 19.022 -3.023 -0.569 1.00 98.25 C
+ATOM 2446 CB VAL A 157 19.347 -2.226 1.810 1.00 98.25 C
+ATOM 2447 HB VAL A 157 18.864 -3.087 2.273 1.00 98.25 H
+ATOM 2448 O VAL A 157 19.863 -2.805 -1.431 1.00 98.25 O
+ATOM 2449 CG1 VAL A 157 20.845 -2.513 1.668 1.00 98.25 C
+ATOM 2450 HG11 VAL A 157 20.998 -3.434 1.105 1.00 98.25 H
+ATOM 2451 HG12 VAL A 157 21.338 -1.694 1.144 1.00 98.25 H
+ATOM 2452 HG13 VAL A 157 21.296 -2.636 2.653 1.00 98.25 H
+ATOM 2453 CG2 VAL A 157 19.222 -1.018 2.749 1.00 98.25 C
+ATOM 2454 HG21 VAL A 157 18.179 -0.723 2.863 1.00 98.25 H
+ATOM 2455 HG22 VAL A 157 19.779 -0.173 2.343 1.00 98.25 H
+ATOM 2456 HG23 VAL A 157 19.621 -1.275 3.730 1.00 98.25 H
+ATOM 2457 N GLY A 158 18.331 -4.162 -0.521 1.00 98.31 N
+ATOM 2458 H GLY A 158 17.667 -4.299 0.227 1.00 98.31 H
+ATOM 2459 CA GLY A 158 18.577 -5.263 -1.445 1.00 98.31 C
+ATOM 2460 HA2 GLY A 158 17.954 -6.102 -1.135 1.00 98.31 H
+ATOM 2461 HA3 GLY A 158 19.621 -5.568 -1.370 1.00 98.31 H
+ATOM 2462 C GLY A 158 18.282 -4.941 -2.913 1.00 98.31 C
+ATOM 2463 O GLY A 158 19.037 -5.379 -3.772 1.00 98.31 O
+ATOM 2464 N GLN A 159 17.231 -4.166 -3.222 1.00 96.99 N
+ATOM 2465 H GLN A 159 16.622 -3.832 -2.490 1.00 96.99 H
+ATOM 2466 CA GLN A 159 16.944 -3.792 -4.622 1.00 96.99 C
+ATOM 2467 HA GLN A 159 17.014 -4.700 -5.221 1.00 96.99 H
+ATOM 2468 C GLN A 159 17.990 -2.843 -5.219 1.00 96.99 C
+ATOM 2469 CB GLN A 159 15.507 -3.268 -4.825 1.00 96.99 C
+ATOM 2470 HB2 GLN A 159 15.314 -3.205 -5.896 1.00 96.99 H
+ATOM 2471 HB3 GLN A 159 14.810 -4.007 -4.431 1.00 96.99 H
+ATOM 2472 O GLN A 159 18.097 -2.757 -6.431 1.00 96.99 O
+ATOM 2473 CG GLN A 159 15.158 -1.918 -4.192 1.00 96.99 C
+ATOM 2474 HG2 GLN A 159 15.489 -1.930 -3.153 1.00 96.99 H
+ATOM 2475 HG3 GLN A 159 14.072 -1.825 -4.176 1.00 96.99 H
+ATOM 2476 CD GLN A 159 15.688 -0.691 -4.929 1.00 96.99 C
+ATOM 2477 NE2 GLN A 159 16.325 0.224 -4.238 1.00 96.99 N
+ATOM 2478 HE21 GLN A 159 16.603 0.019 -3.289 1.00 96.99 H
+ATOM 2479 HE22 GLN A 159 16.728 0.973 -4.782 1.00 96.99 H
+ATOM 2480 OE1 GLN A 159 15.462 -0.479 -6.105 1.00 96.99 O
+ATOM 2481 N LEU A 160 18.819 -2.180 -4.399 1.00 97.40 N
+ATOM 2482 H LEU A 160 18.751 -2.327 -3.403 1.00 97.40 H
+ATOM 2483 CA LEU A 160 19.939 -1.378 -4.912 1.00 97.40 C
+ATOM 2484 HA LEU A 160 19.564 -0.723 -5.699 1.00 97.40 H
+ATOM 2485 C LEU A 160 21.035 -2.227 -5.571 1.00 97.40 C
+ATOM 2486 CB LEU A 160 20.563 -0.531 -3.788 1.00 97.40 C
+ATOM 2487 HB2 LEU A 160 21.418 0.010 -4.193 1.00 97.40 H
+ATOM 2488 HB3 LEU A 160 20.949 -1.206 -3.024 1.00 97.40 H
+ATOM 2489 O LEU A 160 21.925 -1.644 -6.182 1.00 97.40 O
+ATOM 2490 CG LEU A 160 19.618 0.487 -3.140 1.00 97.40 C
+ATOM 2491 HG LEU A 160 18.718 -0.021 -2.796 1.00 97.40 H
+ATOM 2492 CD1 LEU A 160 20.293 1.137 -1.930 1.00 97.40 C
+ATOM 2493 HD11 LEU A 160 21.179 1.687 -2.248 1.00 97.40 H
+ATOM 2494 HD12 LEU A 160 20.585 0.360 -1.224 1.00 97.40 H
+ATOM 2495 HD13 LEU A 160 19.590 1.813 -1.445 1.00 97.40 H
+ATOM 2496 CD2 LEU A 160 19.215 1.598 -4.110 1.00 97.40 C
+ATOM 2497 HD21 LEU A 160 18.523 2.285 -3.623 1.00 97.40 H
+ATOM 2498 HD22 LEU A 160 20.100 2.146 -4.431 1.00 97.40 H
+ATOM 2499 HD23 LEU A 160 18.738 1.177 -4.994 1.00 97.40 H
+ATOM 2500 N TYR A 161 20.977 -3.553 -5.418 1.00 97.62 N
+ATOM 2501 H TYR A 161 20.211 -3.942 -4.888 1.00 97.62 H
+ATOM 2502 CA TYR A 161 21.950 -4.503 -5.953 1.00 97.62 C
+ATOM 2503 HA TYR A 161 22.781 -3.930 -6.365 1.00 97.62 H
+ATOM 2504 C TYR A 161 21.394 -5.360 -7.098 1.00 97.62 C
+ATOM 2505 CB TYR A 161 22.502 -5.361 -4.811 1.00 97.62 C
+ATOM 2506 HB2 TYR A 161 21.690 -5.923 -4.350 1.00 97.62 H
+ATOM 2507 HB3 TYR A 161 23.203 -6.083 -5.229 1.00 97.62 H
+ATOM 2508 O TYR A 161 21.982 -6.374 -7.470 1.00 97.62 O
+ATOM 2509 CG TYR A 161 23.238 -4.560 -3.762 1.00 97.62 C
+ATOM 2510 CD1 TYR A 161 24.557 -4.138 -4.011 1.00 97.62 C
+ATOM 2511 HD1 TYR A 161 25.028 -4.386 -4.951 1.00 97.62 H
+ATOM 2512 CD2 TYR A 161 22.589 -4.192 -2.570 1.00 97.62 C
+ATOM 2513 HD2 TYR A 161 21.565 -4.495 -2.408 1.00 97.62 H
+ATOM 2514 CE1 TYR A 161 25.241 -3.362 -3.057 1.00 97.62 C
+ATOM 2515 HE1 TYR A 161 26.255 -3.043 -3.248 1.00 97.62 H
+ATOM 2516 CE2 TYR A 161 23.266 -3.415 -1.613 1.00 97.62 C
+ATOM 2517 HE2 TYR A 161 22.765 -3.139 -0.697 1.00 97.62 H
+ATOM 2518 OH TYR A 161 25.270 -2.304 -0.904 1.00 97.62 O
+ATOM 2519 HH TYR A 161 24.809 -2.392 -0.066 1.00 97.62 H
+ATOM 2520 CZ TYR A 161 24.597 -3.004 -1.856 1.00 97.62 C
+ATOM 2521 N GLU A 162 20.224 -5.011 -7.649 1.00 97.91 N
+ATOM 2522 H GLU A 162 19.778 -4.149 -7.370 1.00 97.91 H
+ATOM 2523 CA GLU A 162 19.540 -5.878 -8.617 1.00 97.91 C
+ATOM 2524 HA GLU A 162 19.577 -6.892 -8.217 1.00 97.91 H
+ATOM 2525 C GLU A 162 20.230 -5.988 -9.983 1.00 97.91 C
+ATOM 2526 CB GLU A 162 18.058 -5.498 -8.743 1.00 97.91 C
+ATOM 2527 HB2 GLU A 162 17.571 -6.308 -9.285 1.00 97.91 H
+ATOM 2528 HB3 GLU A 162 17.612 -5.433 -7.750 1.00 97.91 H
+ATOM 2529 O GLU A 162 19.915 -6.898 -10.749 1.00 97.91 O
+ATOM 2530 CG GLU A 162 17.754 -4.196 -9.477 1.00 97.91 C
+ATOM 2531 HG2 GLU A 162 18.267 -4.194 -10.438 1.00 97.91 H
+ATOM 2532 HG3 GLU A 162 18.117 -3.359 -8.881 1.00 97.91 H
+ATOM 2533 CD GLU A 162 16.246 -4.037 -9.703 1.00 97.91 C
+ATOM 2534 OE1 GLU A 162 15.827 -3.957 -10.882 1.00 97.91 O
+ATOM 2535 OE2 GLU A 162 15.457 -4.084 -8.735 1.00 97.91 O
+ATOM 2536 N VAL A 163 21.178 -5.094 -10.271 1.00 97.30 N
+ATOM 2537 H VAL A 163 21.349 -4.372 -9.586 1.00 97.30 H
+ATOM 2538 CA VAL A 163 21.998 -5.103 -11.491 1.00 97.30 C
+ATOM 2539 HA VAL A 163 21.524 -5.733 -12.243 1.00 97.30 H
+ATOM 2540 C VAL A 163 23.391 -5.685 -11.241 1.00 97.30 C
+ATOM 2541 CB VAL A 163 22.096 -3.674 -12.065 1.00 97.30 C
+ATOM 2542 HB VAL A 163 22.440 -3.001 -11.279 1.00 97.30 H
+ATOM 2543 O VAL A 163 23.872 -6.480 -12.046 1.00 97.30 O
+ATOM 2544 CG1 VAL A 163 23.075 -3.567 -13.241 1.00 97.30 C
+ATOM 2545 HG11 VAL A 163 24.094 -3.741 -12.898 1.00 97.30 H
+ATOM 2546 HG12 VAL A 163 22.827 -4.300 -14.009 1.00 97.30 H
+ATOM 2547 HG13 VAL A 163 23.032 -2.562 -13.661 1.00 97.30 H
+ATOM 2548 CG2 VAL A 163 20.727 -3.184 -12.548 1.00 97.30 C
+ATOM 2549 HG21 VAL A 163 20.012 -3.201 -11.725 1.00 97.30 H
+ATOM 2550 HG22 VAL A 163 20.809 -2.163 -12.920 1.00 97.30 H
+ATOM 2551 HG23 VAL A 163 20.355 -3.826 -13.346 1.00 97.30 H
+ATOM 2552 N ASP A 164 24.055 -5.281 -10.155 1.00 96.38 N
+ATOM 2553 H ASP A 164 23.589 -4.710 -9.464 1.00 96.38 H
+ATOM 2554 CA ASP A 164 25.491 -5.491 -9.934 1.00 96.38 C
+ATOM 2555 HA ASP A 164 25.945 -5.774 -10.884 1.00 96.38 H
+ATOM 2556 C ASP A 164 25.829 -6.639 -8.963 1.00 96.38 C
+ATOM 2557 CB ASP A 164 26.147 -4.154 -9.520 1.00 96.38 C
+ATOM 2558 HB2 ASP A 164 26.015 -3.443 -10.335 1.00 96.38 H
+ATOM 2559 HB3 ASP A 164 27.218 -4.317 -9.400 1.00 96.38 H
+ATOM 2560 O ASP A 164 26.918 -7.205 -9.065 1.00 96.38 O
+ATOM 2561 CG ASP A 164 25.599 -3.516 -8.233 1.00 96.38 C
+ATOM 2562 OD1 ASP A 164 24.609 -4.046 -7.687 1.00 96.38 O
+ATOM 2563 OD2 ASP A 164 26.154 -2.472 -7.817 1.00 96.38 O
+ATOM 2564 N ASP A 165 24.917 -7.033 -8.064 1.00 97.79 N
+ATOM 2565 H ASP A 165 24.077 -6.481 -7.978 1.00 97.79 H
+ATOM 2566 CA ASP A 165 25.152 -8.094 -7.074 1.00 97.79 C
+ATOM 2567 HA ASP A 165 25.808 -8.838 -7.525 1.00 97.79 H
+ATOM 2568 C ASP A 165 23.854 -8.832 -6.672 1.00 97.79 C
+ATOM 2569 CB ASP A 165 25.920 -7.507 -5.873 1.00 97.79 C
+ATOM 2570 HB2 ASP A 165 26.801 -6.983 -6.242 1.00 97.79 H
+ATOM 2571 HB3 ASP A 165 25.296 -6.774 -5.360 1.00 97.79 H
+ATOM 2572 O ASP A 165 23.262 -8.630 -5.605 1.00 97.79 O
+ATOM 2573 CG ASP A 165 26.391 -8.553 -4.856 1.00 97.79 C
+ATOM 2574 OD1 ASP A 165 26.018 -9.748 -4.978 1.00 97.79 O
+ATOM 2575 OD2 ASP A 165 27.087 -8.141 -3.895 1.00 97.79 O
+ATOM 2576 N ILE A 166 23.425 -9.774 -7.523 1.00 98.00 N
+ATOM 2577 H ILE A 166 23.895 -9.830 -8.415 1.00 98.00 H
+ATOM 2578 CA ILE A 166 22.247 -10.628 -7.275 1.00 98.00 C
+ATOM 2579 HA ILE A 166 21.387 -9.971 -7.141 1.00 98.00 H
+ATOM 2580 C ILE A 166 22.377 -11.449 -5.980 1.00 98.00 C
+ATOM 2581 CB ILE A 166 21.983 -11.546 -8.496 1.00 98.00 C
+ATOM 2582 HB ILE A 166 22.917 -12.054 -8.734 1.00 98.00 H
+ATOM 2583 O ILE A 166 21.366 -11.743 -5.337 1.00 98.00 O
+ATOM 2584 CG1 ILE A 166 21.564 -10.750 -9.752 1.00 98.00 C
+ATOM 2585 HG12 ILE A 166 21.512 -11.438 -10.597 1.00 98.00 H
+ATOM 2586 HG13 ILE A 166 22.334 -10.015 -9.988 1.00 98.00 H
+ATOM 2587 CG2 ILE A 166 20.939 -12.645 -8.212 1.00 98.00 C
+ATOM 2588 HG21 ILE A 166 20.680 -13.161 -9.137 1.00 98.00 H
+ATOM 2589 HG22 ILE A 166 20.040 -12.208 -7.778 1.00 98.00 H
+ATOM 2590 HG23 ILE A 166 21.349 -13.379 -7.518 1.00 98.00 H
+ATOM 2591 CD1 ILE A 166 20.218 -10.019 -9.655 1.00 98.00 C
+ATOM 2592 HD11 ILE A 166 19.410 -10.717 -9.438 1.00 98.00 H
+ATOM 2593 HD12 ILE A 166 20.256 -9.245 -8.887 1.00 98.00 H
+ATOM 2594 HD13 ILE A 166 20.009 -9.545 -10.614 1.00 98.00 H
+ATOM 2595 N ALA A 167 23.593 -11.813 -5.556 1.00 98.17 N
+ATOM 2596 H ALA A 167 24.402 -11.399 -5.995 1.00 98.17 H
+ATOM 2597 CA ALA A 167 23.781 -12.530 -4.296 1.00 98.17 C
+ATOM 2598 HA ALA A 167 23.116 -13.394 -4.282 1.00 98.17 H
+ATOM 2599 C ALA A 167 23.401 -11.634 -3.109 1.00 98.17 C
+ATOM 2600 CB ALA A 167 25.226 -13.033 -4.203 1.00 98.17 C
+ATOM 2601 HB1 ALA A 167 25.920 -12.193 -4.202 1.00 98.17 H
+ATOM 2602 HB2 ALA A 167 25.358 -13.601 -3.282 1.00 98.17 H
+ATOM 2603 HB3 ALA A 167 25.449 -13.677 -5.055 1.00 98.17 H
+ATOM 2604 O ALA A 167 22.666 -12.063 -2.216 1.00 98.17 O
+ATOM 2605 N GLN A 168 23.826 -10.371 -3.127 1.00 98.19 N
+ATOM 2606 H GLN A 168 24.439 -10.076 -3.873 1.00 98.19 H
+ATOM 2607 CA GLN A 168 23.447 -9.392 -2.117 1.00 98.19 C
+ATOM 2608 HA GLN A 168 23.648 -9.831 -1.140 1.00 98.19 H
+ATOM 2609 C GLN A 168 21.951 -9.056 -2.153 1.00 98.19 C
+ATOM 2610 CB GLN A 168 24.358 -8.178 -2.271 1.00 98.19 C
+ATOM 2611 HB2 GLN A 168 24.218 -7.709 -3.245 1.00 98.19 H
+ATOM 2612 HB3 GLN A 168 25.374 -8.561 -2.181 1.00 98.19 H
+ATOM 2613 O GLN A 168 21.336 -8.973 -1.085 1.00 98.19 O
+ATOM 2614 CG GLN A 168 24.134 -7.147 -1.169 1.00 98.19 C
+ATOM 2615 HG2 GLN A 168 23.997 -7.665 -0.220 1.00 98.19 H
+ATOM 2616 HG3 GLN A 168 23.229 -6.589 -1.408 1.00 98.19 H
+ATOM 2617 CD GLN A 168 25.268 -6.149 -0.980 1.00 98.19 C
+ATOM 2618 NE2 GLN A 168 26.436 -6.312 -1.563 1.00 98.19 N
+ATOM 2619 HE21 GLN A 168 26.563 -7.002 -2.290 1.00 98.19 H
+ATOM 2620 HE22 GLN A 168 27.090 -5.546 -1.488 1.00 98.19 H
+ATOM 2621 OE1 GLN A 168 25.123 -5.228 -0.193 1.00 98.19 O
+ATOM 2622 N LEU A 169 21.336 -8.978 -3.340 1.00 98.36 N
+ATOM 2623 H LEU A 169 21.906 -8.980 -4.173 1.00 98.36 H
+ATOM 2624 CA LEU A 169 19.876 -8.917 -3.482 1.00 98.36 C
+ATOM 2625 HA LEU A 169 19.523 -8.000 -3.010 1.00 98.36 H
+ATOM 2626 C LEU A 169 19.199 -10.092 -2.758 1.00 98.36 C
+ATOM 2627 CB LEU A 169 19.513 -8.850 -4.978 1.00 98.36 C
+ATOM 2628 HB2 LEU A 169 19.932 -9.707 -5.507 1.00 98.36 H
+ATOM 2629 HB3 LEU A 169 19.988 -7.956 -5.381 1.00 98.36 H
+ATOM 2630 O LEU A 169 18.311 -9.890 -1.933 1.00 98.36 O
+ATOM 2631 CG LEU A 169 17.998 -8.790 -5.261 1.00 98.36 C
+ATOM 2632 HG LEU A 169 17.511 -8.241 -4.455 1.00 98.36 H
+ATOM 2633 CD1 LEU A 169 17.732 -8.020 -6.538 1.00 98.36 C
+ATOM 2634 HD11 LEU A 169 16.659 -7.914 -6.694 1.00 98.36 H
+ATOM 2635 HD12 LEU A 169 18.188 -8.522 -7.391 1.00 98.36 H
+ATOM 2636 HD13 LEU A 169 18.160 -7.025 -6.412 1.00 98.36 H
+ATOM 2637 CD2 LEU A 169 17.332 -10.162 -5.425 1.00 98.36 C
+ATOM 2638 HD21 LEU A 169 17.349 -10.716 -4.486 1.00 98.36 H
+ATOM 2639 HD22 LEU A 169 16.291 -10.023 -5.716 1.00 98.36 H
+ATOM 2640 HD23 LEU A 169 17.847 -10.733 -6.198 1.00 98.36 H
+ATOM 2641 N MET A 170 19.637 -11.331 -2.996 1.00 98.53 N
+ATOM 2642 H MET A 170 20.369 -11.455 -3.681 1.00 98.53 H
+ATOM 2643 CA MET A 170 19.038 -12.513 -2.363 1.00 98.53 C
+ATOM 2644 HA MET A 170 17.966 -12.508 -2.563 1.00 98.53 H
+ATOM 2645 C MET A 170 19.202 -12.521 -0.839 1.00 98.53 C
+ATOM 2646 CB MET A 170 19.633 -13.797 -2.952 1.00 98.53 C
+ATOM 2647 HB2 MET A 170 19.330 -14.641 -2.332 1.00 98.53 H
+ATOM 2648 HB3 MET A 170 20.721 -13.741 -2.946 1.00 98.53 H
+ATOM 2649 O MET A 170 18.258 -12.868 -0.127 1.00 98.53 O
+ATOM 2650 CG MET A 170 19.146 -14.067 -4.377 1.00 98.53 C
+ATOM 2651 HG2 MET A 170 19.458 -13.253 -5.031 1.00 98.53 H
+ATOM 2652 HG3 MET A 170 18.057 -14.104 -4.377 1.00 98.53 H
+ATOM 2653 SD MET A 170 19.778 -15.630 -5.040 1.00 98.53 S
+ATOM 2654 CE MET A 170 19.038 -15.572 -6.690 1.00 98.53 C
+ATOM 2655 HE1 MET A 170 19.357 -14.665 -7.203 1.00 98.53 H
+ATOM 2656 HE2 MET A 170 17.951 -15.572 -6.606 1.00 98.53 H
+ATOM 2657 HE3 MET A 170 19.357 -16.441 -7.265 1.00 98.53 H
+ATOM 2658 N ILE A 171 20.366 -12.121 -0.318 1.00 98.64 N
+ATOM 2659 H ILE A 171 21.108 -11.866 -0.954 1.00 98.64 H
+ATOM 2660 CA ILE A 171 20.618 -12.075 1.130 1.00 98.64 C
+ATOM 2661 HA ILE A 171 20.318 -13.030 1.560 1.00 98.64 H
+ATOM 2662 C ILE A 171 19.739 -11.021 1.811 1.00 98.64 C
+ATOM 2663 CB ILE A 171 22.123 -11.863 1.412 1.00 98.64 C
+ATOM 2664 HB ILE A 171 22.457 -11.001 0.835 1.00 98.64 H
+ATOM 2665 O ILE A 171 19.075 -11.328 2.805 1.00 98.64 O
+ATOM 2666 CG1 ILE A 171 22.975 -13.078 0.969 1.00 98.64 C
+ATOM 2667 HG12 ILE A 171 24.027 -12.834 1.114 1.00 98.64 H
+ATOM 2668 HG13 ILE A 171 22.832 -13.250 -0.098 1.00 98.64 H
+ATOM 2669 CG2 ILE A 171 22.390 -11.550 2.897 1.00 98.64 C
+ATOM 2670 HG21 ILE A 171 21.996 -10.566 3.149 1.00 98.64 H
+ATOM 2671 HG22 ILE A 171 21.922 -12.298 3.537 1.00 98.64 H
+ATOM 2672 HG23 ILE A 171 23.464 -11.535 3.082 1.00 98.64 H
+ATOM 2673 CD1 ILE A 171 22.685 -14.408 1.678 1.00 98.64 C
+ATOM 2674 HD11 ILE A 171 21.661 -14.731 1.490 1.00 98.64 H
+ATOM 2675 HD12 ILE A 171 22.850 -14.313 2.752 1.00 98.64 H
+ATOM 2676 HD13 ILE A 171 23.361 -15.170 1.291 1.00 98.64 H
+ATOM 2677 N TRP A 172 19.661 -9.804 1.269 1.00 98.70 N
+ATOM 2678 H TRP A 172 20.206 -9.593 0.445 1.00 98.70 H
+ATOM 2679 CA TRP A 172 18.752 -8.780 1.791 1.00 98.70 C
+ATOM 2680 HA TRP A 172 18.936 -8.654 2.858 1.00 98.70 H
+ATOM 2681 C TRP A 172 17.281 -9.180 1.641 1.00 98.70 C
+ATOM 2682 CB TRP A 172 19.030 -7.450 1.097 1.00 98.70 C
+ATOM 2683 HB2 TRP A 172 18.161 -6.804 1.227 1.00 98.70 H
+ATOM 2684 HB3 TRP A 172 19.154 -7.628 0.029 1.00 98.70 H
+ATOM 2685 O TRP A 172 16.488 -8.953 2.558 1.00 98.70 O
+ATOM 2686 CG TRP A 172 20.218 -6.711 1.626 1.00 98.70 C
+ATOM 2687 CD1 TRP A 172 21.352 -6.456 0.942 1.00 98.70 C
+ATOM 2688 HD1 TRP A 172 21.524 -6.754 -0.082 1.00 98.70 H
+ATOM 2689 CD2 TRP A 172 20.408 -6.116 2.944 1.00 98.70 C
+ATOM 2690 CE2 TRP A 172 21.710 -5.532 2.991 1.00 98.70 C
+ATOM 2691 CE3 TRP A 172 19.610 -6.013 4.105 1.00 98.70 C
+ATOM 2692 HE3 TRP A 172 18.626 -6.458 4.094 1.00 98.70 H
+ATOM 2693 NE1 TRP A 172 22.248 -5.777 1.743 1.00 98.70 N
+ATOM 2694 HE1 TRP A 172 23.162 -5.496 1.419 1.00 98.70 H
+ATOM 2695 CH2 TRP A 172 21.370 -4.776 5.265 1.00 98.70 C
+ATOM 2696 HH2 TRP A 172 21.730 -4.269 6.148 1.00 98.70 H
+ATOM 2697 CZ2 TRP A 172 22.191 -4.871 4.130 1.00 98.70 C
+ATOM 2698 HZ2 TRP A 172 23.182 -4.440 4.123 1.00 98.70 H
+ATOM 2699 CZ3 TRP A 172 20.087 -5.348 5.253 1.00 98.70 C
+ATOM 2700 HZ3 TRP A 172 19.479 -5.276 6.143 1.00 98.70 H
+ATOM 2701 N GLY A 173 16.925 -9.852 0.544 1.00 98.62 N
+ATOM 2702 H GLY A 173 17.595 -9.927 -0.208 1.00 98.62 H
+ATOM 2703 CA GLY A 173 15.613 -10.461 0.341 1.00 98.62 C
+ATOM 2704 HA2 GLY A 173 14.847 -9.685 0.344 1.00 98.62 H
+ATOM 2705 HA3 GLY A 173 15.610 -10.952 -0.632 1.00 98.62 H
+ATOM 2706 C GLY A 173 15.270 -11.513 1.399 1.00 98.62 C
+ATOM 2707 O GLY A 173 14.149 -11.530 1.910 1.00 98.62 O
+ATOM 2708 N ALA A 174 16.230 -12.351 1.802 1.00 98.68 N
+ATOM 2709 H ALA A 174 17.114 -12.333 1.315 1.00 98.68 H
+ATOM 2710 CA ALA A 174 16.048 -13.333 2.870 1.00 98.68 C
+ATOM 2711 HA ALA A 174 15.161 -13.925 2.647 1.00 98.68 H
+ATOM 2712 C ALA A 174 15.824 -12.660 4.236 1.00 98.68 C
+ATOM 2713 CB ALA A 174 17.256 -14.279 2.889 1.00 98.68 C
+ATOM 2714 HB1 ALA A 174 18.166 -13.730 3.130 1.00 98.68 H
+ATOM 2715 HB2 ALA A 174 17.101 -15.056 3.638 1.00 98.68 H
+ATOM 2716 HB3 ALA A 174 17.373 -14.747 1.912 1.00 98.68 H
+ATOM 2717 O ALA A 174 14.918 -13.051 4.977 1.00 98.68 O
+ATOM 2718 N VAL A 175 16.585 -11.603 4.548 1.00 98.71 N
+ATOM 2719 H VAL A 175 17.322 -11.346 3.907 1.00 98.71 H
+ATOM 2720 CA VAL A 175 16.381 -10.798 5.766 1.00 98.71 C
+ATOM 2721 HA VAL A 175 16.408 -11.464 6.628 1.00 98.71 H
+ATOM 2722 C VAL A 175 14.997 -10.136 5.756 1.00 98.71 C
+ATOM 2723 CB VAL A 175 17.501 -9.750 5.939 1.00 98.71 C
+ATOM 2724 HB VAL A 175 17.543 -9.111 5.057 1.00 98.71 H
+ATOM 2725 O VAL A 175 14.261 -10.238 6.738 1.00 98.71 O
+ATOM 2726 CG1 VAL A 175 17.264 -8.869 7.171 1.00 98.71 C
+ATOM 2727 HG11 VAL A 175 16.334 -8.311 7.057 1.00 98.71 H
+ATOM 2728 HG12 VAL A 175 17.202 -9.486 8.068 1.00 98.71 H
+ATOM 2729 HG13 VAL A 175 18.083 -8.157 7.277 1.00 98.71 H
+ATOM 2730 CG2 VAL A 175 18.870 -10.416 6.135 1.00 98.71 C
+ATOM 2731 HG21 VAL A 175 18.871 -11.019 7.042 1.00 98.71 H
+ATOM 2732 HG22 VAL A 175 19.109 -11.059 5.288 1.00 98.71 H
+ATOM 2733 HG23 VAL A 175 19.644 -9.652 6.206 1.00 98.71 H
+ATOM 2734 N SER A 176 14.600 -9.522 4.638 1.00 98.68 N
+ATOM 2735 H SER A 176 15.258 -9.449 3.875 1.00 98.68 H
+ATOM 2736 CA SER A 176 13.268 -8.927 4.458 1.00 98.68 C
+ATOM 2737 HA SER A 176 13.125 -8.149 5.208 1.00 98.68 H
+ATOM 2738 C SER A 176 12.150 -9.958 4.640 1.00 98.68 C
+ATOM 2739 CB SER A 176 13.187 -8.290 3.066 1.00 98.68 C
+ATOM 2740 HB2 SER A 176 14.015 -7.595 2.927 1.00 98.68 H
+ATOM 2741 HB3 SER A 176 13.257 -9.067 2.305 1.00 98.68 H
+ATOM 2742 O SER A 176 11.169 -9.715 5.349 1.00 98.68 O
+ATOM 2743 OG SER A 176 11.966 -7.599 2.911 1.00 98.68 O
+ATOM 2744 HG SER A 176 12.096 -6.689 3.190 1.00 98.68 H
+ATOM 2745 N THR A 177 12.343 -11.161 4.097 1.00 98.75 N
+ATOM 2746 H THR A 177 13.162 -11.287 3.518 1.00 98.75 H
+ATOM 2747 CA THR A 177 11.405 -12.283 4.225 1.00 98.75 C
+ATOM 2748 HA THR A 177 10.431 -11.953 3.862 1.00 98.75 H
+ATOM 2749 C THR A 177 11.236 -12.728 5.679 1.00 98.75 C
+ATOM 2750 CB THR A 177 11.844 -13.466 3.351 1.00 98.75 C
+ATOM 2751 HB THR A 177 12.834 -13.807 3.651 1.00 98.75 H
+ATOM 2752 O THR A 177 10.117 -13.026 6.094 1.00 98.75 O
+ATOM 2753 CG2 THR A 177 10.868 -14.641 3.413 1.00 98.75 C
+ATOM 2754 HG21 THR A 177 9.860 -14.299 3.183 1.00 98.75 H
+ATOM 2755 HG22 THR A 177 10.886 -15.097 4.403 1.00 98.75 H
+ATOM 2756 HG23 THR A 177 11.166 -15.393 2.682 1.00 98.75 H
+ATOM 2757 OG1 THR A 177 11.881 -13.064 2.003 1.00 98.75 O
+ATOM 2758 HG1 THR A 177 12.646 -12.497 1.879 1.00 98.75 H
+ATOM 2759 N ALA A 178 12.295 -12.723 6.494 1.00 98.73 N
+ATOM 2760 H ALA A 178 13.203 -12.488 6.119 1.00 98.73 H
+ATOM 2761 CA ALA A 178 12.178 -13.043 7.918 1.00 98.73 C
+ATOM 2762 HA ALA A 178 11.742 -14.037 8.011 1.00 98.73 H
+ATOM 2763 C ALA A 178 11.242 -12.060 8.650 1.00 98.73 C
+ATOM 2764 CB ALA A 178 13.579 -13.077 8.541 1.00 98.73 C
+ATOM 2765 HB1 ALA A 178 14.033 -12.087 8.513 1.00 98.73 H
+ATOM 2766 HB2 ALA A 178 14.211 -13.774 7.990 1.00 98.73 H
+ATOM 2767 HB3 ALA A 178 13.509 -13.404 9.578 1.00 98.73 H
+ATOM 2768 O ALA A 178 10.350 -12.485 9.389 1.00 98.73 O
+ATOM 2769 N PHE A 179 11.375 -10.755 8.387 1.00 98.74 N
+ATOM 2770 H PHE A 179 12.110 -10.464 7.757 1.00 98.74 H
+ATOM 2771 CA PHE A 179 10.451 -9.745 8.913 1.00 98.74 C
+ATOM 2772 HA PHE A 179 10.410 -9.836 9.999 1.00 98.74 H
+ATOM 2773 C PHE A 179 9.020 -9.936 8.392 1.00 98.74 C
+ATOM 2774 CB PHE A 179 10.948 -8.340 8.563 1.00 98.74 C
+ATOM 2775 HB2 PHE A 179 10.126 -7.645 8.734 1.00 98.74 H
+ATOM 2776 HB3 PHE A 179 11.201 -8.294 7.504 1.00 98.74 H
+ATOM 2777 O PHE A 179 8.072 -9.853 9.177 1.00 98.74 O
+ATOM 2778 CG PHE A 179 12.120 -7.854 9.384 1.00 98.74 C
+ATOM 2779 CD1 PHE A 179 11.912 -7.438 10.711 1.00 98.74 C
+ATOM 2780 HD1 PHE A 179 10.922 -7.484 11.140 1.00 98.74 H
+ATOM 2781 CD2 PHE A 179 13.407 -7.790 8.822 1.00 98.74 C
+ATOM 2782 HD2 PHE A 179 13.569 -8.088 7.797 1.00 98.74 H
+ATOM 2783 CE1 PHE A 179 12.990 -6.964 11.479 1.00 98.74 C
+ATOM 2784 HE1 PHE A 179 12.830 -6.642 12.498 1.00 98.74 H
+ATOM 2785 CE2 PHE A 179 14.487 -7.330 9.595 1.00 98.74 C
+ATOM 2786 HE2 PHE A 179 15.478 -7.293 9.167 1.00 98.74 H
+ATOM 2787 CZ PHE A 179 14.279 -6.915 10.921 1.00 98.74 C
+ATOM 2788 HZ PHE A 179 15.112 -6.559 11.510 1.00 98.74 H
+ATOM 2789 N PHE A 180 8.858 -10.241 7.101 1.00 98.73 N
+ATOM 2790 H PHE A 180 9.675 -10.249 6.507 1.00 98.73 H
+ATOM 2791 CA PHE A 180 7.557 -10.523 6.487 1.00 98.73 C
+ATOM 2792 HA PHE A 180 6.924 -9.642 6.597 1.00 98.73 H
+ATOM 2793 C PHE A 180 6.841 -11.699 7.166 1.00 98.73 C
+ATOM 2794 CB PHE A 180 7.754 -10.797 4.989 1.00 98.73 C
+ATOM 2795 HB2 PHE A 180 8.463 -11.617 4.873 1.00 98.73 H
+ATOM 2796 HB3 PHE A 180 8.205 -9.923 4.520 1.00 98.73 H
+ATOM 2797 O PHE A 180 5.674 -11.583 7.545 1.00 98.73 O
+ATOM 2798 CG PHE A 180 6.490 -11.155 4.231 1.00 98.73 C
+ATOM 2799 CD1 PHE A 180 6.406 -12.373 3.526 1.00 98.73 C
+ATOM 2800 HD1 PHE A 180 7.240 -13.058 3.529 1.00 98.73 H
+ATOM 2801 CD2 PHE A 180 5.403 -10.264 4.199 1.00 98.73 C
+ATOM 2802 HD2 PHE A 180 5.458 -9.322 4.723 1.00 98.73 H
+ATOM 2803 CE1 PHE A 180 5.255 -12.683 2.778 1.00 98.73 C
+ATOM 2804 HE1 PHE A 180 5.209 -13.601 2.210 1.00 98.73 H
+ATOM 2805 CE2 PHE A 180 4.254 -10.582 3.455 1.00 98.73 C
+ATOM 2806 HE2 PHE A 180 3.424 -9.891 3.418 1.00 98.73 H
+ATOM 2807 CZ PHE A 180 4.182 -11.781 2.730 1.00 98.73 C
+ATOM 2808 HZ PHE A 180 3.312 -12.010 2.133 1.00 98.73 H
+ATOM 2809 N VAL A 181 7.546 -12.810 7.397 1.00 98.71 N
+ATOM 2810 H VAL A 181 8.497 -12.843 7.057 1.00 98.71 H
+ATOM 2811 CA VAL A 181 6.999 -14.000 8.068 1.00 98.71 C
+ATOM 2812 HA VAL A 181 6.100 -14.314 7.537 1.00 98.71 H
+ATOM 2813 C VAL A 181 6.576 -13.684 9.504 1.00 98.71 C
+ATOM 2814 CB VAL A 181 8.012 -15.162 8.017 1.00 98.71 C
+ATOM 2815 HB VAL A 181 8.984 -14.808 8.362 1.00 98.71 H
+ATOM 2816 O VAL A 181 5.471 -14.049 9.909 1.00 98.71 O
+ATOM 2817 CG1 VAL A 181 7.591 -16.350 8.894 1.00 98.71 C
+ATOM 2818 HG11 VAL A 181 8.288 -17.176 8.750 1.00 98.71 H
+ATOM 2819 HG12 VAL A 181 6.587 -16.678 8.626 1.00 98.71 H
+ATOM 2820 HG13 VAL A 181 7.616 -16.073 9.948 1.00 98.71 H
+ATOM 2821 CG2 VAL A 181 8.153 -15.688 6.582 1.00 98.71 C
+ATOM 2822 HG21 VAL A 181 8.422 -14.883 5.899 1.00 98.71 H
+ATOM 2823 HG22 VAL A 181 7.214 -16.129 6.247 1.00 98.71 H
+ATOM 2824 HG23 VAL A 181 8.938 -16.443 6.542 1.00 98.71 H
+ATOM 2825 N VAL A 182 7.403 -12.962 10.268 1.00 98.68 N
+ATOM 2826 H VAL A 182 8.297 -12.690 9.885 1.00 98.68 H
+ATOM 2827 CA VAL A 182 7.065 -12.554 11.645 1.00 98.68 C
+ATOM 2828 HA VAL A 182 6.792 -13.443 12.213 1.00 98.68 H
+ATOM 2829 C VAL A 182 5.851 -11.621 11.668 1.00 98.68 C
+ATOM 2830 CB VAL A 182 8.280 -11.903 12.336 1.00 98.68 C
+ATOM 2831 HB VAL A 182 8.683 -11.119 11.695 1.00 98.68 H
+ATOM 2832 O VAL A 182 4.940 -11.812 12.477 1.00 98.68 O
+ATOM 2833 CG1 VAL A 182 7.922 -11.283 13.695 1.00 98.68 C
+ATOM 2834 HG11 VAL A 182 8.827 -10.922 14.182 1.00 98.68 H
+ATOM 2835 HG12 VAL A 182 7.253 -10.433 13.560 1.00 98.68 H
+ATOM 2836 HG13 VAL A 182 7.444 -12.027 14.332 1.00 98.68 H
+ATOM 2837 CG2 VAL A 182 9.374 -12.949 12.590 1.00 98.68 C
+ATOM 2838 HG21 VAL A 182 10.256 -12.466 13.010 1.00 98.68 H
+ATOM 2839 HG22 VAL A 182 9.015 -13.711 13.282 1.00 98.68 H
+ATOM 2840 HG23 VAL A 182 9.665 -13.433 11.658 1.00 98.68 H
+ATOM 2841 N MET A 183 5.788 -10.643 10.763 1.00 98.73 N
+ATOM 2842 H MET A 183 6.560 -10.530 10.121 1.00 98.73 H
+ATOM 2843 CA MET A 183 4.642 -9.741 10.630 1.00 98.73 C
+ATOM 2844 HA MET A 183 4.496 -9.213 11.573 1.00 98.73 H
+ATOM 2845 C MET A 183 3.355 -10.520 10.317 1.00 98.73 C
+ATOM 2846 CB MET A 183 4.960 -8.716 9.537 1.00 98.73 C
+ATOM 2847 HB2 MET A 183 5.124 -9.251 8.602 1.00 98.73 H
+ATOM 2848 HB3 MET A 183 5.879 -8.188 9.792 1.00 98.73 H
+ATOM 2849 O MET A 183 2.336 -10.320 10.982 1.00 98.73 O
+ATOM 2850 CG MET A 183 3.845 -7.684 9.348 1.00 98.73 C
+ATOM 2851 HG2 MET A 183 3.705 -7.147 10.286 1.00 98.73 H
+ATOM 2852 HG3 MET A 183 2.916 -8.197 9.099 1.00 98.73 H
+ATOM 2853 SD MET A 183 4.172 -6.465 8.051 1.00 98.73 S
+ATOM 2854 CE MET A 183 4.491 -7.567 6.644 1.00 98.73 C
+ATOM 2855 HE1 MET A 183 3.748 -8.363 6.605 1.00 98.73 H
+ATOM 2856 HE2 MET A 183 5.484 -8.004 6.748 1.00 98.73 H
+ATOM 2857 HE3 MET A 183 4.464 -6.994 5.717 1.00 98.73 H
+ATOM 2858 N ASN A 184 3.408 -11.459 9.369 1.00 98.58 N
+ATOM 2859 H ASN A 184 4.261 -11.551 8.836 1.00 98.58 H
+ATOM 2860 CA ASN A 184 2.272 -12.305 8.996 1.00 98.58 C
+ATOM 2861 HA ASN A 184 1.424 -11.666 8.750 1.00 98.58 H
+ATOM 2862 C ASN A 184 1.831 -13.227 10.137 1.00 98.58 C
+ATOM 2863 CB ASN A 184 2.643 -13.125 7.754 1.00 98.58 C
+ATOM 2864 HB2 ASN A 184 3.586 -13.644 7.926 1.00 98.58 H
+ATOM 2865 HB3 ASN A 184 1.871 -13.871 7.567 1.00 98.58 H
+ATOM 2866 O ASN A 184 0.632 -13.439 10.329 1.00 98.58 O
+ATOM 2867 CG ASN A 184 2.762 -12.278 6.504 1.00 98.58 C
+ATOM 2868 ND2 ASN A 184 3.369 -12.822 5.481 1.00 98.58 N
+ATOM 2869 HD21 ASN A 184 3.564 -12.221 4.693 1.00 98.58 H
+ATOM 2870 HD22 ASN A 184 3.796 -13.734 5.551 1.00 98.58 H
+ATOM 2871 OD1 ASN A 184 2.283 -11.156 6.424 1.00 98.58 O
+ATOM 2872 N TRP A 185 2.772 -13.733 10.936 1.00 98.71 N
+ATOM 2873 H TRP A 185 3.741 -13.585 10.694 1.00 98.71 H
+ATOM 2874 CA TRP A 185 2.462 -14.496 12.143 1.00 98.71 C
+ATOM 2875 HA TRP A 185 1.821 -15.335 11.872 1.00 98.71 H
+ATOM 2876 C TRP A 185 1.689 -13.657 13.171 1.00 98.71 C
+ATOM 2877 CB TRP A 185 3.755 -15.062 12.737 1.00 98.71 C
+ATOM 2878 HB2 TRP A 185 4.505 -14.274 12.797 1.00 98.71 H
+ATOM 2879 HB3 TRP A 185 4.144 -15.832 12.070 1.00 98.71 H
+ATOM 2880 O TRP A 185 0.693 -14.135 13.728 1.00 98.71 O
+ATOM 2881 CG TRP A 185 3.584 -15.641 14.104 1.00 98.71 C
+ATOM 2882 CD1 TRP A 185 2.956 -16.802 14.392 1.00 98.71 C
+ATOM 2883 HD1 TRP A 185 2.532 -17.470 13.657 1.00 98.71 H
+ATOM 2884 CD2 TRP A 185 3.993 -15.073 15.385 1.00 98.71 C
+ATOM 2885 CE2 TRP A 185 3.568 -15.957 16.421 1.00 98.71 C
+ATOM 2886 CE3 TRP A 185 4.685 -13.907 15.775 1.00 98.71 C
+ATOM 2887 HE3 TRP A 185 5.045 -13.233 15.011 1.00 98.71 H
+ATOM 2888 NE1 TRP A 185 2.946 -16.993 15.759 1.00 98.71 N
+ATOM 2889 HE1 TRP A 185 2.552 -17.812 16.199 1.00 98.71 H
+ATOM 2890 CH2 TRP A 185 4.512 -14.530 18.132 1.00 98.71 C
+ATOM 2891 HH2 TRP A 185 4.739 -14.326 19.168 1.00 98.71 H
+ATOM 2892 CZ2 TRP A 185 3.818 -15.700 17.777 1.00 98.71 C
+ATOM 2893 HZ2 TRP A 185 3.505 -16.406 18.532 1.00 98.71 H
+ATOM 2894 CZ3 TRP A 185 4.940 -13.636 17.133 1.00 98.71 C
+ATOM 2895 HZ3 TRP A 185 5.493 -12.749 17.406 1.00 98.71 H
+ATOM 2896 N ILE A 186 2.077 -12.393 13.387 1.00 98.71 N
+ATOM 2897 H ILE A 186 2.908 -12.066 12.915 1.00 98.71 H
+ATOM 2898 CA ILE A 186 1.340 -11.470 14.265 1.00 98.71 C
+ATOM 2899 HA ILE A 186 1.213 -11.954 15.233 1.00 98.71 H
+ATOM 2900 C ILE A 186 -0.061 -11.204 13.700 1.00 98.71 C
+ATOM 2901 CB ILE A 186 2.117 -10.150 14.493 1.00 98.71 C
+ATOM 2902 HB ILE A 186 2.319 -9.695 13.523 1.00 98.71 H
+ATOM 2903 O ILE A 186 -1.044 -11.334 14.435 1.00 98.71 O
+ATOM 2904 CG1 ILE A 186 3.466 -10.395 15.204 1.00 98.71 C
+ATOM 2905 HG12 ILE A 186 3.291 -10.664 16.245 1.00 98.71 H
+ATOM 2906 HG13 ILE A 186 3.979 -11.234 14.732 1.00 98.71 H
+ATOM 2907 CG2 ILE A 186 1.266 -9.173 15.335 1.00 98.71 C
+ATOM 2908 HG21 ILE A 186 0.374 -8.871 14.787 1.00 98.71 H
+ATOM 2909 HG22 ILE A 186 0.974 -9.648 16.272 1.00 98.71 H
+ATOM 2910 HG23 ILE A 186 1.832 -8.269 15.558 1.00 98.71 H
+ATOM 2911 CD1 ILE A 186 4.423 -9.196 15.143 1.00 98.71 C
+ATOM 2912 HD11 ILE A 186 4.029 -8.351 15.708 1.00 98.71 H
+ATOM 2913 HD12 ILE A 186 5.383 -9.482 15.573 1.00 98.71 H
+ATOM 2914 HD13 ILE A 186 4.580 -8.898 14.106 1.00 98.71 H
+ATOM 2915 N VAL A 187 -0.170 -10.881 12.405 1.00 98.71 N
+ATOM 2916 H VAL A 187 0.683 -10.795 11.870 1.00 98.71 H
+ATOM 2917 CA VAL A 187 -1.451 -10.653 11.710 1.00 98.71 C
+ATOM 2918 HA VAL A 187 -1.955 -9.801 12.166 1.00 98.71 H
+ATOM 2919 C VAL A 187 -2.378 -11.858 11.870 1.00 98.71 C
+ATOM 2920 CB VAL A 187 -1.218 -10.332 10.216 1.00 98.71 C
+ATOM 2921 HB VAL A 187 -0.506 -11.047 9.804 1.00 98.71 H
+ATOM 2922 O VAL A 187 -3.496 -11.708 12.364 1.00 98.71 O
+ATOM 2923 CG1 VAL A 187 -2.497 -10.411 9.375 1.00 98.71 C
+ATOM 2924 HG11 VAL A 187 -3.254 -9.736 9.774 1.00 98.71 H
+ATOM 2925 HG12 VAL A 187 -2.884 -11.430 9.363 1.00 98.71 H
+ATOM 2926 HG13 VAL A 187 -2.275 -10.137 8.344 1.00 98.71 H
+ATOM 2927 CG2 VAL A 187 -0.650 -8.919 10.043 1.00 98.71 C
+ATOM 2928 HG21 VAL A 187 -0.469 -8.721 8.986 1.00 98.71 H
+ATOM 2929 HG22 VAL A 187 0.304 -8.833 10.563 1.00 98.71 H
+ATOM 2930 HG23 VAL A 187 -1.345 -8.176 10.434 1.00 98.71 H
+ATOM 2931 N GLY A 188 -1.909 -13.058 11.521 1.00 98.53 N
+ATOM 2932 H GLY A 188 -0.978 -13.114 11.132 1.00 98.53 H
+ATOM 2933 CA GLY A 188 -2.684 -14.291 11.627 1.00 98.53 C
+ATOM 2934 HA2 GLY A 188 -2.073 -15.126 11.284 1.00 98.53 H
+ATOM 2935 HA3 GLY A 188 -3.571 -14.223 10.998 1.00 98.53 H
+ATOM 2936 C GLY A 188 -3.118 -14.560 13.064 1.00 98.53 C
+ATOM 2937 O GLY A 188 -4.306 -14.744 13.330 1.00 98.53 O
+ATOM 2938 N THR A 189 -2.189 -14.484 14.020 1.00 98.71 N
+ATOM 2939 H THR A 189 -1.233 -14.302 13.747 1.00 98.71 H
+ATOM 2940 CA THR A 189 -2.491 -14.678 15.447 1.00 98.71 C
+ATOM 2941 HA THR A 189 -2.852 -15.697 15.590 1.00 98.71 H
+ATOM 2942 C THR A 189 -3.584 -13.724 15.926 1.00 98.71 C
+ATOM 2943 CB THR A 189 -1.232 -14.491 16.307 1.00 98.71 C
+ATOM 2944 HB THR A 189 -0.812 -13.498 16.147 1.00 98.71 H
+ATOM 2945 O THR A 189 -4.512 -14.148 16.619 1.00 98.71 O
+ATOM 2946 CG2 THR A 189 -1.505 -14.687 17.801 1.00 98.71 C
+ATOM 2947 HG21 THR A 189 -2.128 -13.876 18.178 1.00 98.71 H
+ATOM 2948 HG22 THR A 189 -0.556 -14.678 18.338 1.00 98.71 H
+ATOM 2949 HG23 THR A 189 -2.000 -15.645 17.958 1.00 98.71 H
+ATOM 2950 OG1 THR A 189 -0.275 -15.460 15.965 1.00 98.71 O
+ATOM 2951 HG1 THR A 189 0.205 -15.138 15.199 1.00 98.71 H
+ATOM 2952 N LYS A 190 -3.506 -12.440 15.559 1.00 98.62 N
+ATOM 2953 H LYS A 190 -2.742 -12.155 14.964 1.00 98.62 H
+ATOM 2954 CA LYS A 190 -4.488 -11.430 15.972 1.00 98.62 C
+ATOM 2955 HA LYS A 190 -4.708 -11.576 17.030 1.00 98.62 H
+ATOM 2956 C LYS A 190 -5.832 -11.605 15.284 1.00 98.62 C
+ATOM 2957 CB LYS A 190 -3.921 -10.020 15.755 1.00 98.62 C
+ATOM 2958 HB2 LYS A 190 -4.714 -9.286 15.896 1.00 98.62 H
+ATOM 2959 HB3 LYS A 190 -3.561 -9.929 14.731 1.00 98.62 H
+ATOM 2960 O LYS A 190 -6.840 -11.497 15.980 1.00 98.62 O
+ATOM 2961 CG LYS A 190 -2.773 -9.692 16.724 1.00 98.62 C
+ATOM 2962 HG2 LYS A 190 -2.365 -8.722 16.440 1.00 98.62 H
+ATOM 2963 HG3 LYS A 190 -1.976 -10.429 16.629 1.00 98.62 H
+ATOM 2964 CD LYS A 190 -3.234 -9.651 18.188 1.00 98.62 C
+ATOM 2965 HD2 LYS A 190 -4.090 -8.981 18.277 1.00 98.62 H
+ATOM 2966 HD3 LYS A 190 -3.527 -10.648 18.515 1.00 98.62 H
+ATOM 2967 CE LYS A 190 -2.115 -9.153 19.101 1.00 98.62 C
+ATOM 2968 HE2 LYS A 190 -1.831 -8.154 18.769 1.00 98.62 H
+ATOM 2969 HE3 LYS A 190 -1.244 -9.801 18.999 1.00 98.62 H
+ATOM 2970 NZ LYS A 190 -2.567 -9.095 20.515 1.00 98.62 N
+ATOM 2971 HZ1 LYS A 190 -1.921 -8.568 21.086 1.00 98.62 H
+ATOM 2972 HZ2 LYS A 190 -3.461 -8.636 20.617 1.00 98.62 H
+ATOM 2973 HZ3 LYS A 190 -2.716 -10.010 20.916 1.00 98.62 H
+ATOM 2974 N ILE A 191 -5.861 -11.937 13.993 1.00 98.55 N
+ATOM 2975 H ILE A 191 -4.989 -11.991 13.486 1.00 98.55 H
+ATOM 2976 CA ILE A 191 -7.104 -12.265 13.289 1.00 98.55 C
+ATOM 2977 HA ILE A 191 -7.791 -11.426 13.401 1.00 98.55 H
+ATOM 2978 C ILE A 191 -7.778 -13.456 13.966 1.00 98.55 C
+ATOM 2979 CB ILE A 191 -6.866 -12.486 11.774 1.00 98.55 C
+ATOM 2980 HB ILE A 191 -5.995 -13.128 11.639 1.00 98.55 H
+ATOM 2981 O ILE A 191 -8.895 -13.319 14.457 1.00 98.55 O
+ATOM 2982 CG1 ILE A 191 -6.591 -11.120 11.105 1.00 98.55 C
+ATOM 2983 HG12 ILE A 191 -7.473 -10.488 11.202 1.00 98.55 H
+ATOM 2984 HG13 ILE A 191 -5.765 -10.630 11.620 1.00 98.55 H
+ATOM 2985 CG2 ILE A 191 -8.079 -13.180 11.118 1.00 98.55 C
+ATOM 2986 HG21 ILE A 191 -8.184 -14.201 11.485 1.00 98.55 H
+ATOM 2987 HG22 ILE A 191 -7.951 -13.247 10.038 1.00 98.55 H
+ATOM 2988 HG23 ILE A 191 -8.987 -12.618 11.335 1.00 98.55 H
+ATOM 2989 CD1 ILE A 191 -6.225 -11.199 9.621 1.00 98.55 C
+ATOM 2990 HD11 ILE A 191 -5.439 -11.941 9.483 1.00 98.55 H
+ATOM 2991 HD12 ILE A 191 -7.103 -11.454 9.027 1.00 98.55 H
+ATOM 2992 HD13 ILE A 191 -5.860 -10.233 9.272 1.00 98.55 H
+ATOM 2993 N PHE A 192 -7.097 -14.601 14.063 1.00 98.43 N
+ATOM 2994 H PHE A 192 -6.164 -14.645 13.681 1.00 98.43 H
+ATOM 2995 CA PHE A 192 -7.717 -15.840 14.533 1.00 98.43 C
+ATOM 2996 HA PHE A 192 -8.624 -15.996 13.949 1.00 98.43 H
+ATOM 2997 C PHE A 192 -8.164 -15.782 15.997 1.00 98.43 C
+ATOM 2998 CB PHE A 192 -6.792 -17.036 14.264 1.00 98.43 C
+ATOM 2999 HB2 PHE A 192 -5.806 -16.829 14.679 1.00 98.43 H
+ATOM 3000 HB3 PHE A 192 -7.190 -17.909 14.781 1.00 98.43 H
+ATOM 3001 O PHE A 192 -9.228 -16.322 16.305 1.00 98.43 O
+ATOM 3002 CG PHE A 192 -6.677 -17.388 12.791 1.00 98.43 C
+ATOM 3003 CD1 PHE A 192 -7.812 -17.825 12.080 1.00 98.43 C
+ATOM 3004 HD1 PHE A 192 -8.758 -17.939 12.587 1.00 98.43 H
+ATOM 3005 CD2 PHE A 192 -5.442 -17.290 12.123 1.00 98.43 C
+ATOM 3006 HD2 PHE A 192 -4.547 -17.028 12.666 1.00 98.43 H
+ATOM 3007 CE1 PHE A 192 -7.719 -18.120 10.708 1.00 98.43 C
+ATOM 3008 HE1 PHE A 192 -8.587 -18.460 10.163 1.00 98.43 H
+ATOM 3009 CE2 PHE A 192 -5.355 -17.553 10.746 1.00 98.43 C
+ATOM 3010 HE2 PHE A 192 -4.409 -17.457 10.233 1.00 98.43 H
+ATOM 3011 CZ PHE A 192 -6.493 -17.968 10.037 1.00 98.43 C
+ATOM 3012 HZ PHE A 192 -6.417 -18.183 8.982 1.00 98.43 H
+ATOM 3013 N LYS A 193 -7.418 -15.095 16.876 1.00 98.38 N
+ATOM 3014 H LYS A 193 -6.547 -14.696 16.555 1.00 98.38 H
+ATOM 3015 CA LYS A 193 -7.797 -14.924 18.290 1.00 98.38 C
+ATOM 3016 HA LYS A 193 -8.168 -15.876 18.671 1.00 98.38 H
+ATOM 3017 C LYS A 193 -8.951 -13.943 18.508 1.00 98.38 C
+ATOM 3018 CB LYS A 193 -6.582 -14.505 19.136 1.00 98.38 C
+ATOM 3019 HB2 LYS A 193 -6.074 -13.662 18.667 1.00 98.38 H
+ATOM 3020 HB3 LYS A 193 -6.944 -14.177 20.111 1.00 98.38 H
+ATOM 3021 O LYS A 193 -9.699 -14.123 19.460 1.00 98.38 O
+ATOM 3022 CG LYS A 193 -5.603 -15.668 19.360 1.00 98.38 C
+ATOM 3023 HG2 LYS A 193 -6.154 -16.511 19.776 1.00 98.38 H
+ATOM 3024 HG3 LYS A 193 -5.163 -15.976 18.411 1.00 98.38 H
+ATOM 3025 CD LYS A 193 -4.490 -15.273 20.341 1.00 98.38 C
+ATOM 3026 HD2 LYS A 193 -4.946 -14.895 21.257 1.00 98.38 H
+ATOM 3027 HD3 LYS A 193 -3.876 -14.491 19.895 1.00 98.38 H
+ATOM 3028 CE LYS A 193 -3.632 -16.502 20.669 1.00 98.38 C
+ATOM 3029 HE2 LYS A 193 -4.295 -17.306 20.989 1.00 98.38 H
+ATOM 3030 HE3 LYS A 193 -3.133 -16.832 19.758 1.00 98.38 H
+ATOM 3031 NZ LYS A 193 -2.634 -16.224 21.734 1.00 98.38 N
+ATOM 3032 HZ1 LYS A 193 -2.106 -17.061 21.939 1.00 98.38 H
+ATOM 3033 HZ2 LYS A 193 -3.093 -15.931 22.585 1.00 98.38 H
+ATOM 3034 HZ3 LYS A 193 -1.984 -15.509 21.440 1.00 98.38 H
+ATOM 3035 N ASN A 194 -9.119 -12.933 17.649 1.00 98.43 N
+ATOM 3036 H ASN A 194 -8.476 -12.834 16.877 1.00 98.43 H
+ATOM 3037 CA ASN A 194 -10.146 -11.899 17.837 1.00 98.43 C
+ATOM 3038 HA ASN A 194 -10.482 -11.929 18.873 1.00 98.43 H
+ATOM 3039 C ASN A 194 -11.424 -12.120 17.016 1.00 98.43 C
+ATOM 3040 CB ASN A 194 -9.545 -10.501 17.634 1.00 98.43 C
+ATOM 3041 HB2 ASN A 194 -9.046 -10.431 16.667 1.00 98.43 H
+ATOM 3042 HB3 ASN A 194 -10.338 -9.753 17.654 1.00 98.43 H
+ATOM 3043 O ASN A 194 -12.364 -11.341 17.168 1.00 98.43 O
+ATOM 3044 CG ASN A 194 -8.591 -10.155 18.754 1.00 98.43 C
+ATOM 3045 ND2 ASN A 194 -7.308 -10.339 18.559 1.00 98.43 N
+ATOM 3046 HD21 ASN A 194 -7.001 -10.675 17.657 1.00 98.43 H
+ATOM 3047 HD22 ASN A 194 -6.720 -10.058 19.331 1.00 98.43 H
+ATOM 3048 OD1 ASN A 194 -8.985 -9.770 19.836 1.00 98.43 O
+ATOM 3049 N ARG A 195 -11.517 -13.189 16.208 1.00 98.28 N
+ATOM 3050 H ARG A 195 -10.683 -13.740 16.064 1.00 98.28 H
+ATOM 3051 CA ARG A 195 -12.726 -13.502 15.415 1.00 98.28 C
+ATOM 3052 HA ARG A 195 -12.872 -12.728 14.662 1.00 98.28 H
+ATOM 3053 C ARG A 195 -14.005 -13.514 16.246 1.00 98.28 C
+ATOM 3054 CB ARG A 195 -12.610 -14.864 14.721 1.00 98.28 C
+ATOM 3055 HB2 ARG A 195 -12.398 -15.639 15.457 1.00 98.28 H
+ATOM 3056 HB3 ARG A 195 -13.570 -15.090 14.255 1.00 98.28 H
+ATOM 3057 O ARG A 195 -14.996 -12.938 15.827 1.00 98.28 O
+ATOM 3058 CG ARG A 195 -11.541 -14.877 13.633 1.00 98.28 C
+ATOM 3059 HG2 ARG A 195 -10.564 -14.933 14.113 1.00 98.28 H
+ATOM 3060 HG3 ARG A 195 -11.608 -13.968 13.036 1.00 98.28 H
+ATOM 3061 CD ARG A 195 -11.684 -16.086 12.716 1.00 98.28 C
+ATOM 3062 HD2 ARG A 195 -12.691 -16.091 12.297 1.00 98.28 H
+ATOM 3063 HD3 ARG A 195 -10.964 -15.973 11.906 1.00 98.28 H
+ATOM 3064 NE ARG A 195 -11.405 -17.343 13.436 1.00 98.28 N
+ATOM 3065 HE ARG A 195 -10.936 -17.263 14.326 1.00 98.28 H
+ATOM 3066 NH1 ARG A 195 -12.425 -18.754 11.943 1.00 98.28 N
+ATOM 3067 HH11 ARG A 195 -12.802 -17.948 11.466 1.00 98.28 H
+ATOM 3068 HH12 ARG A 195 -12.744 -19.679 11.693 1.00 98.28 H
+ATOM 3069 NH2 ARG A 195 -11.394 -19.596 13.737 1.00 98.28 N
+ATOM 3070 HH21 ARG A 195 -11.673 -20.521 13.442 1.00 98.28 H
+ATOM 3071 HH22 ARG A 195 -10.898 -19.479 14.608 1.00 98.28 H
+ATOM 3072 CZ ARG A 195 -11.742 -18.555 13.035 1.00 98.28 C
+ATOM 3073 N ALA A 196 -13.962 -14.104 17.440 1.00 97.77 N
+ATOM 3074 H ALA A 196 -13.098 -14.539 17.730 1.00 97.77 H
+ATOM 3075 CA ALA A 196 -15.125 -14.212 18.324 1.00 97.77 C
+ATOM 3076 HA ALA A 196 -15.937 -14.688 17.774 1.00 97.77 H
+ATOM 3077 C ALA A 196 -15.663 -12.853 18.819 1.00 97.77 C
+ATOM 3078 CB ALA A 196 -14.738 -15.118 19.499 1.00 97.77 C
+ATOM 3079 HB1 ALA A 196 -13.932 -14.665 20.076 1.00 97.77 H
+ATOM 3080 HB2 ALA A 196 -15.603 -15.255 20.149 1.00 97.77 H
+ATOM 3081 HB3 ALA A 196 -14.423 -16.094 19.131 1.00 97.77 H
+ATOM 3082 O ALA A 196 -16.772 -12.785 19.334 1.00 97.77 O
+ATOM 3083 N THR A 197 -14.893 -11.769 18.672 1.00 98.09 N
+ATOM 3084 H THR A 197 -14.002 -11.870 18.209 1.00 98.09 H
+ATOM 3085 CA THR A 197 -15.331 -10.410 19.032 1.00 98.09 C
+ATOM 3086 HA THR A 197 -16.005 -10.472 19.886 1.00 98.09 H
+ATOM 3087 C THR A 197 -16.101 -9.712 17.911 1.00 98.09 C
+ATOM 3088 CB THR A 197 -14.144 -9.520 19.437 1.00 98.09 C
+ATOM 3089 HB THR A 197 -14.546 -8.623 19.908 1.00 98.09 H
+ATOM 3090 O THR A 197 -16.662 -8.638 18.130 1.00 98.09 O
+ATOM 3091 CG2 THR A 197 -13.190 -10.187 20.431 1.00 98.09 C
+ATOM 3092 HG21 THR A 197 -12.689 -11.042 19.976 1.00 98.09 H
+ATOM 3093 HG22 THR A 197 -12.434 -9.466 20.741 1.00 98.09 H
+ATOM 3094 HG23 THR A 197 -13.747 -10.518 21.307 1.00 98.09 H
+ATOM 3095 OG1 THR A 197 -13.399 -9.112 18.309 1.00 98.09 O
+ATOM 3096 HG1 THR A 197 -12.964 -9.882 17.935 1.00 98.09 H
+ATOM 3097 N MET A 198 -16.075 -10.271 16.699 1.00 98.51 N
+ATOM 3098 H MET A 198 -15.703 -11.205 16.596 1.00 98.51 H
+ATOM 3099 CA MET A 198 -16.583 -9.624 15.498 1.00 98.51 C
+ATOM 3100 HA MET A 198 -16.414 -8.552 15.598 1.00 98.51 H
+ATOM 3101 C MET A 198 -18.088 -9.833 15.340 1.00 98.51 C
+ATOM 3102 CB MET A 198 -15.807 -10.097 14.269 1.00 98.51 C
+ATOM 3103 HB2 MET A 198 -15.924 -11.173 14.138 1.00 98.51 H
+ATOM 3104 HB3 MET A 198 -16.224 -9.597 13.395 1.00 98.51 H
+ATOM 3105 O MET A 198 -18.626 -10.897 15.630 1.00 98.51 O
+ATOM 3106 CG MET A 198 -14.322 -9.740 14.364 1.00 98.51 C
+ATOM 3107 HG2 MET A 198 -13.871 -10.329 15.162 1.00 98.51 H
+ATOM 3108 HG3 MET A 198 -14.225 -8.686 14.625 1.00 98.51 H
+ATOM 3109 SD MET A 198 -13.384 -10.035 12.848 1.00 98.51 S
+ATOM 3110 CE MET A 198 -14.079 -8.745 11.786 1.00 98.51 C
+ATOM 3111 HE1 MET A 198 -15.113 -8.991 11.546 1.00 98.51 H
+ATOM 3112 HE2 MET A 198 -14.041 -7.786 12.302 1.00 98.51 H
+ATOM 3113 HE3 MET A 198 -13.507 -8.678 10.861 1.00 98.51 H
+ATOM 3114 N LEU A 199 -18.777 -8.790 14.883 1.00 97.76 N
+ATOM 3115 H LEU A 199 -18.253 -7.961 14.640 1.00 97.76 H
+ATOM 3116 CA LEU A 199 -20.240 -8.726 14.863 1.00 97.76 C
+ATOM 3117 HA LEU A 199 -20.638 -9.493 15.527 1.00 97.76 H
+ATOM 3118 C LEU A 199 -20.802 -8.992 13.457 1.00 97.76 C
+ATOM 3119 CB LEU A 199 -20.684 -7.353 15.399 1.00 97.76 C
+ATOM 3120 HB2 LEU A 199 -21.773 -7.315 15.409 1.00 97.76 H
+ATOM 3121 HB3 LEU A 199 -20.337 -6.596 14.696 1.00 97.76 H
+ATOM 3122 O LEU A 199 -20.130 -8.750 12.452 1.00 97.76 O
+ATOM 3123 CG LEU A 199 -20.169 -6.988 16.806 1.00 97.76 C
+ATOM 3124 HG LEU A 199 -19.131 -7.293 16.932 1.00 97.76 H
+ATOM 3125 CD1 LEU A 199 -20.221 -5.470 16.981 1.00 97.76 C
+ATOM 3126 HD11 LEU A 199 -19.572 -4.999 16.243 1.00 97.76 H
+ATOM 3127 HD12 LEU A 199 -21.244 -5.121 16.842 1.00 97.76 H
+ATOM 3128 HD13 LEU A 199 -19.881 -5.209 17.983 1.00 97.76 H
+ATOM 3129 CD2 LEU A 199 -21.017 -7.637 17.898 1.00 97.76 C
+ATOM 3130 HD21 LEU A 199 -20.973 -8.722 17.798 1.00 97.76 H
+ATOM 3131 HD22 LEU A 199 -22.054 -7.309 17.825 1.00 97.76 H
+ATOM 3132 HD23 LEU A 199 -20.622 -7.370 18.879 1.00 97.76 H
+ATOM 3133 N GLY A 200 -22.057 -9.443 13.372 1.00 96.67 N
+ATOM 3134 H GLY A 200 -22.551 -9.652 14.227 1.00 96.67 H
+ATOM 3135 CA GLY A 200 -22.801 -9.515 12.107 1.00 96.67 C
+ATOM 3136 HA2 GLY A 200 -22.866 -8.516 11.676 1.00 96.67 H
+ATOM 3137 HA3 GLY A 200 -23.812 -9.863 12.315 1.00 96.67 H
+ATOM 3138 C GLY A 200 -22.197 -10.452 11.051 1.00 96.67 C
+ATOM 3139 O GLY A 200 -22.217 -10.109 9.874 1.00 96.67 O
+ATOM 3140 N GLY A 201 -21.614 -11.586 11.462 1.00 96.14 N
+ATOM 3141 H GLY A 201 -21.608 -11.797 12.450 1.00 96.14 H
+ATOM 3142 CA GLY A 201 -21.027 -12.596 10.562 1.00 96.14 C
+ATOM 3143 HA2 GLY A 201 -21.701 -12.766 9.723 1.00 96.14 H
+ATOM 3144 HA3 GLY A 201 -20.924 -13.532 11.111 1.00 96.14 H
+ATOM 3145 C GLY A 201 -19.645 -12.239 9.996 1.00 96.14 C
+ATOM 3146 O GLY A 201 -19.105 -12.944 9.139 1.00 96.14 O
+ATOM 3147 N THR A 202 -19.048 -11.131 10.447 1.00 98.40 N
+ATOM 3148 H THR A 202 -19.531 -10.582 11.144 1.00 98.40 H
+ATOM 3149 CA THR A 202 -17.744 -10.667 9.944 1.00 98.40 C
+ATOM 3150 HA THR A 202 -17.747 -10.798 8.862 1.00 98.40 H
+ATOM 3151 C THR A 202 -16.551 -11.483 10.451 1.00 98.40 C
+ATOM 3152 CB THR A 202 -17.526 -9.176 10.205 1.00 98.40 C
+ATOM 3153 HB THR A 202 -16.533 -8.910 9.844 1.00 98.40 H
+ATOM 3154 O THR A 202 -15.466 -11.395 9.873 1.00 98.40 O
+ATOM 3155 CG2 THR A 202 -18.546 -8.311 9.481 1.00 98.40 C
+ATOM 3156 HG21 THR A 202 -19.555 -8.546 9.819 1.00 98.40 H
+ATOM 3157 HG22 THR A 202 -18.334 -7.262 9.688 1.00 98.40 H
+ATOM 3158 HG23 THR A 202 -18.481 -8.482 8.406 1.00 98.40 H
+ATOM 3159 OG1 THR A 202 -17.619 -8.848 11.566 1.00 98.40 O
+ATOM 3160 HG1 THR A 202 -18.547 -8.834 11.809 1.00 98.40 H
+ATOM 3161 N ASP A 203 -16.759 -12.348 11.445 1.00 97.76 N
+ATOM 3162 H ASP A 203 -17.698 -12.439 11.806 1.00 97.76 H
+ATOM 3163 CA ASP A 203 -15.823 -13.382 11.899 1.00 97.76 C
+ATOM 3164 HA ASP A 203 -14.904 -12.906 12.243 1.00 97.76 H
+ATOM 3165 C ASP A 203 -15.468 -14.387 10.783 1.00 97.76 C
+ATOM 3166 CB ASP A 203 -16.474 -14.118 13.082 1.00 97.76 C
+ATOM 3167 HB2 ASP A 203 -16.739 -13.399 13.857 1.00 97.76 H
+ATOM 3168 HB3 ASP A 203 -15.757 -14.823 13.501 1.00 97.76 H
+ATOM 3169 O ASP A 203 -14.341 -14.889 10.715 1.00 97.76 O
+ATOM 3170 CG ASP A 203 -17.736 -14.865 12.645 1.00 97.76 C
+ATOM 3171 OD1 ASP A 203 -18.723 -14.166 12.316 1.00 97.76 O
+ATOM 3172 OD2 ASP A 203 -17.645 -16.104 12.513 1.00 97.76 O
+ATOM 3173 N SER A 204 -16.397 -14.633 9.853 1.00 97.78 N
+ATOM 3174 H SER A 204 -17.325 -14.270 10.015 1.00 97.78 H
+ATOM 3175 CA SER A 204 -16.142 -15.428 8.652 1.00 97.78 C
+ATOM 3176 HA SER A 204 -15.542 -16.296 8.927 1.00 97.78 H
+ATOM 3177 C SER A 204 -15.371 -14.619 7.612 1.00 97.78 C
+ATOM 3178 CB SER A 204 -17.464 -15.934 8.075 1.00 97.78 C
+ATOM 3179 HB2 SER A 204 -17.964 -16.549 8.824 1.00 97.78 H
+ATOM 3180 HB3 SER A 204 -18.107 -15.087 7.838 1.00 97.78 H
+ATOM 3181 O SER A 204 -14.384 -15.110 7.057 1.00 97.78 O
+ATOM 3182 OG SER A 204 -17.248 -16.703 6.898 1.00 97.78 O
+ATOM 3183 HG SER A 204 -18.117 -17.033 6.662 1.00 97.78 H
+ATOM 3184 N THR A 205 -15.776 -13.374 7.358 1.00 98.18 N
+ATOM 3185 H THR A 205 -16.612 -13.042 7.816 1.00 98.18 H
+ATOM 3186 CA THR A 205 -15.173 -12.502 6.336 1.00 98.18 C
+ATOM 3187 HA THR A 205 -15.226 -13.004 5.370 1.00 98.18 H
+ATOM 3188 C THR A 205 -13.709 -12.191 6.630 1.00 98.18 C
+ATOM 3189 CB THR A 205 -15.948 -11.183 6.228 1.00 98.18 C
+ATOM 3190 HB THR A 205 -15.752 -10.570 7.108 1.00 98.18 H
+ATOM 3191 O THR A 205 -12.877 -12.231 5.724 1.00 98.18 O
+ATOM 3192 CG2 THR A 205 -15.577 -10.408 4.966 1.00 98.18 C
+ATOM 3193 HG21 THR A 205 -16.096 -9.450 4.968 1.00 98.18 H
+ATOM 3194 HG22 THR A 205 -14.505 -10.212 4.934 1.00 98.18 H
+ATOM 3195 HG23 THR A 205 -15.864 -10.974 4.080 1.00 98.18 H
+ATOM 3196 OG1 THR A 205 -17.325 -11.461 6.163 1.00 98.18 O
+ATOM 3197 HG1 THR A 205 -17.810 -10.640 6.271 1.00 98.18 H
+ATOM 3198 N ILE A 206 -13.353 -11.954 7.895 1.00 98.45 N
+ATOM 3199 H ILE A 206 -14.071 -11.921 8.605 1.00 98.45 H
+ATOM 3200 CA ILE A 206 -11.981 -11.594 8.281 1.00 98.45 C
+ATOM 3201 HA ILE A 206 -11.701 -10.727 7.683 1.00 98.45 H
+ATOM 3202 C ILE A 206 -10.958 -12.699 7.975 1.00 98.45 C
+ATOM 3203 CB ILE A 206 -11.961 -11.187 9.766 1.00 98.45 C
+ATOM 3204 HB ILE A 206 -12.842 -10.572 9.950 1.00 98.45 H
+ATOM 3205 O ILE A 206 -9.786 -12.418 7.742 1.00 98.45 O
+ATOM 3206 CG1 ILE A 206 -10.733 -10.350 10.151 1.00 98.45 C
+ATOM 3207 HG12 ILE A 206 -10.772 -10.185 11.228 1.00 98.45 H
+ATOM 3208 HG13 ILE A 206 -9.814 -10.889 9.920 1.00 98.45 H
+ATOM 3209 CG2 ILE A 206 -12.052 -12.411 10.689 1.00 98.45 C
+ATOM 3210 HG21 ILE A 206 -12.987 -12.932 10.486 1.00 98.45 H
+ATOM 3211 HG22 ILE A 206 -12.059 -12.095 11.732 1.00 98.45 H
+ATOM 3212 HG23 ILE A 206 -11.207 -13.086 10.551 1.00 98.45 H
+ATOM 3213 CD1 ILE A 206 -10.687 -8.973 9.485 1.00 98.45 C
+ATOM 3214 HD11 ILE A 206 -9.897 -8.389 9.959 1.00 98.45 H
+ATOM 3215 HD12 ILE A 206 -10.479 -9.059 8.418 1.00 98.45 H
+ATOM 3216 HD13 ILE A 206 -11.627 -8.445 9.642 1.00 98.45 H
+ATOM 3217 N THR A 207 -11.387 -13.965 7.907 1.00 98.34 N
+ATOM 3218 H THR A 207 -12.356 -14.152 8.118 1.00 98.34 H
+ATOM 3219 CA THR A 207 -10.498 -15.062 7.482 1.00 98.34 C
+ATOM 3220 HA THR A 207 -9.554 -14.971 8.018 1.00 98.34 H
+ATOM 3221 C THR A 207 -10.159 -14.989 5.996 1.00 98.34 C
+ATOM 3222 CB THR A 207 -11.068 -16.452 7.794 1.00 98.34 C
+ATOM 3223 HB THR A 207 -10.327 -17.194 7.496 1.00 98.34 H
+ATOM 3224 O THR A 207 -9.050 -15.338 5.606 1.00 98.34 O
+ATOM 3225 CG2 THR A 207 -11.345 -16.639 9.281 1.00 98.34 C
+ATOM 3226 HG21 THR A 207 -12.109 -15.940 9.620 1.00 98.34 H
+ATOM 3227 HG22 THR A 207 -10.418 -16.475 9.832 1.00 98.34 H
+ATOM 3228 HG23 THR A 207 -11.683 -17.661 9.449 1.00 98.34 H
+ATOM 3229 OG1 THR A 207 -12.263 -16.725 7.094 1.00 98.34 O
+ATOM 3230 HG1 THR A 207 -12.927 -16.073 7.328 1.00 98.34 H
+ATOM 3231 N LYS A 208 -11.075 -14.488 5.158 1.00 98.59 N
+ATOM 3232 H LYS A 208 -11.935 -14.130 5.547 1.00 98.59 H
+ATOM 3233 CA LYS A 208 -10.811 -14.259 3.729 1.00 98.59 C
+ATOM 3234 HA LYS A 208 -10.266 -15.107 3.315 1.00 98.59 H
+ATOM 3235 C LYS A 208 -9.893 -13.053 3.555 1.00 98.59 C
+ATOM 3236 CB LYS A 208 -12.107 -14.071 2.919 1.00 98.59 C
+ATOM 3237 HB2 LYS A 208 -11.828 -13.710 1.929 1.00 98.59 H
+ATOM 3238 HB3 LYS A 208 -12.723 -13.300 3.381 1.00 98.59 H
+ATOM 3239 O LYS A 208 -9.022 -13.092 2.699 1.00 98.59 O
+ATOM 3240 CG LYS A 208 -12.958 -15.332 2.700 1.00 98.59 C
+ATOM 3241 HG2 LYS A 208 -13.796 -15.060 2.058 1.00 98.59 H
+ATOM 3242 HG3 LYS A 208 -12.366 -16.090 2.187 1.00 98.59 H
+ATOM 3243 CD LYS A 208 -13.507 -15.911 4.006 1.00 98.59 C
+ATOM 3244 HD2 LYS A 208 -12.701 -16.436 4.519 1.00 98.59 H
+ATOM 3245 HD3 LYS A 208 -13.863 -15.085 4.621 1.00 98.59 H
+ATOM 3246 CE LYS A 208 -14.662 -16.887 3.783 1.00 98.59 C
+ATOM 3247 HE2 LYS A 208 -15.476 -16.366 3.280 1.00 98.59 H
+ATOM 3248 HE3 LYS A 208 -14.319 -17.691 3.132 1.00 98.59 H
+ATOM 3249 NZ LYS A 208 -15.126 -17.439 5.081 1.00 98.59 N
+ATOM 3250 HZ1 LYS A 208 -15.842 -18.138 4.948 1.00 98.59 H
+ATOM 3251 HZ2 LYS A 208 -14.354 -17.842 5.593 1.00 98.59 H
+ATOM 3252 HZ3 LYS A 208 -15.524 -16.720 5.668 1.00 98.59 H
+ATOM 3253 N VAL A 209 -10.028 -12.035 4.413 1.00 98.74 N
+ATOM 3254 H VAL A 209 -10.804 -12.056 5.059 1.00 98.74 H
+ATOM 3255 CA VAL A 209 -9.079 -10.910 4.471 1.00 98.74 C
+ATOM 3256 HA VAL A 209 -9.044 -10.436 3.490 1.00 98.74 H
+ATOM 3257 C VAL A 209 -7.664 -11.407 4.773 1.00 98.74 C
+ATOM 3258 CB VAL A 209 -9.515 -9.844 5.495 1.00 98.74 C
+ATOM 3259 HB VAL A 209 -9.626 -10.301 6.479 1.00 98.74 H
+ATOM 3260 O VAL A 209 -6.736 -11.012 4.077 1.00 98.74 O
+ATOM 3261 CG1 VAL A 209 -8.499 -8.708 5.618 1.00 98.74 C
+ATOM 3262 HG11 VAL A 209 -7.549 -9.078 6.004 1.00 98.74 H
+ATOM 3263 HG12 VAL A 209 -8.338 -8.254 4.641 1.00 98.74 H
+ATOM 3264 HG13 VAL A 209 -8.868 -7.949 6.309 1.00 98.74 H
+ATOM 3265 CG2 VAL A 209 -10.855 -9.219 5.097 1.00 98.74 C
+ATOM 3266 HG21 VAL A 209 -10.769 -8.783 4.102 1.00 98.74 H
+ATOM 3267 HG22 VAL A 209 -11.125 -8.436 5.805 1.00 98.74 H
+ATOM 3268 HG23 VAL A 209 -11.642 -9.974 5.097 1.00 98.74 H
+ATOM 3269 N PHE A 210 -7.492 -12.320 5.738 1.00 98.72 N
+ATOM 3270 H PHE A 210 -8.280 -12.573 6.317 1.00 98.72 H
+ATOM 3271 CA PHE A 210 -6.186 -12.936 6.006 1.00 98.72 C
+ATOM 3272 HA PHE A 210 -5.486 -12.155 6.303 1.00 98.72 H
+ATOM 3273 C PHE A 210 -5.598 -13.609 4.757 1.00 98.72 C
+ATOM 3274 CB PHE A 210 -6.300 -13.955 7.149 1.00 98.72 C
+ATOM 3275 HB2 PHE A 210 -7.085 -14.675 6.918 1.00 98.72 H
+ATOM 3276 HB3 PHE A 210 -6.599 -13.445 8.065 1.00 98.72 H
+ATOM 3277 O PHE A 210 -4.459 -13.333 4.390 1.00 98.72 O
+ATOM 3278 CG PHE A 210 -5.016 -14.718 7.409 1.00 98.72 C
+ATOM 3279 CD1 PHE A 210 -4.895 -16.058 6.993 1.00 98.72 C
+ATOM 3280 HD1 PHE A 210 -5.715 -16.553 6.496 1.00 98.72 H
+ATOM 3281 CD2 PHE A 210 -3.916 -14.070 8.000 1.00 98.72 C
+ATOM 3282 HD2 PHE A 210 -3.983 -13.024 8.260 1.00 98.72 H
+ATOM 3283 CE1 PHE A 210 -3.685 -16.747 7.187 1.00 98.72 C
+ATOM 3284 HE1 PHE A 210 -3.583 -17.765 6.839 1.00 98.72 H
+ATOM 3285 CE2 PHE A 210 -2.709 -14.760 8.200 1.00 98.72 C
+ATOM 3286 HE2 PHE A 210 -1.854 -14.252 8.620 1.00 98.72 H
+ATOM 3287 CZ PHE A 210 -2.595 -16.101 7.796 1.00 98.72 C
+ATOM 3288 HZ PHE A 210 -1.656 -16.621 7.914 1.00 98.72 H
+ATOM 3289 N TRP A 211 -6.376 -14.452 4.074 1.00 98.64 N
+ATOM 3290 H TRP A 211 -7.297 -14.667 4.427 1.00 98.64 H
+ATOM 3291 CA TRP A 211 -5.905 -15.141 2.869 1.00 98.64 C
+ATOM 3292 HA TRP A 211 -4.952 -15.618 3.098 1.00 98.64 H
+ATOM 3293 C TRP A 211 -5.628 -14.194 1.700 1.00 98.64 C
+ATOM 3294 CB TRP A 211 -6.901 -16.233 2.478 1.00 98.64 C
+ATOM 3295 HB2 TRP A 211 -6.649 -16.591 1.480 1.00 98.64 H
+ATOM 3296 HB3 TRP A 211 -7.907 -15.815 2.435 1.00 98.64 H
+ATOM 3297 O TRP A 211 -4.639 -14.387 0.997 1.00 98.64 O
+ATOM 3298 CG TRP A 211 -6.878 -17.416 3.393 1.00 98.64 C
+ATOM 3299 CD1 TRP A 211 -7.905 -17.867 4.147 1.00 98.64 C
+ATOM 3300 HD1 TRP A 211 -8.887 -17.418 4.175 1.00 98.64 H
+ATOM 3301 CD2 TRP A 211 -5.761 -18.318 3.655 1.00 98.64 C
+ATOM 3302 CE2 TRP A 211 -6.189 -19.302 4.595 1.00 98.64 C
+ATOM 3303 CE3 TRP A 211 -4.432 -18.409 3.186 1.00 98.64 C
+ATOM 3304 HE3 TRP A 211 -4.075 -17.697 2.456 1.00 98.64 H
+ATOM 3305 NE1 TRP A 211 -7.503 -18.981 4.858 1.00 98.64 N
+ATOM 3306 HE1 TRP A 211 -8.117 -19.521 5.451 1.00 98.64 H
+ATOM 3307 CH2 TRP A 211 -4.028 -20.385 4.564 1.00 98.64 C
+ATOM 3308 HH2 TRP A 211 -3.364 -21.172 4.890 1.00 98.64 H
+ATOM 3309 CZ2 TRP A 211 -5.345 -20.325 5.049 1.00 98.64 C
+ATOM 3310 HZ2 TRP A 211 -5.704 -21.064 5.750 1.00 98.64 H
+ATOM 3311 CZ3 TRP A 211 -3.575 -19.429 3.638 1.00 98.64 C
+ATOM 3312 HZ3 TRP A 211 -2.565 -19.489 3.258 1.00 98.64 H
+ATOM 3313 N LEU A 212 -6.431 -13.140 1.531 1.00 98.64 N
+ATOM 3314 H LEU A 212 -7.250 -13.056 2.116 1.00 98.64 H
+ATOM 3315 CA LEU A 212 -6.162 -12.078 0.564 1.00 98.64 C
+ATOM 3316 HA LEU A 212 -6.084 -12.524 -0.428 1.00 98.64 H
+ATOM 3317 C LEU A 212 -4.829 -11.384 0.863 1.00 98.64 C
+ATOM 3318 CB LEU A 212 -7.325 -11.069 0.567 1.00 98.64 C
+ATOM 3319 HB2 LEU A 212 -8.232 -11.574 0.234 1.00 98.64 H
+ATOM 3320 HB3 LEU A 212 -7.487 -10.725 1.588 1.00 98.64 H
+ATOM 3321 O LEU A 212 -4.054 -11.160 -0.060 1.00 98.64 O
+ATOM 3322 CG LEU A 212 -7.078 -9.831 -0.320 1.00 98.64 C
+ATOM 3323 HG LEU A 212 -6.174 -9.315 0.002 1.00 98.64 H
+ATOM 3324 CD1 LEU A 212 -6.946 -10.189 -1.801 1.00 98.64 C
+ATOM 3325 HD11 LEU A 212 -7.822 -10.744 -2.136 1.00 98.64 H
+ATOM 3326 HD12 LEU A 212 -6.856 -9.277 -2.391 1.00 98.64 H
+ATOM 3327 HD13 LEU A 212 -6.051 -10.790 -1.964 1.00 98.64 H
+ATOM 3328 CD2 LEU A 212 -8.235 -8.853 -0.164 1.00 98.64 C
+ATOM 3329 HD21 LEU A 212 -8.029 -7.958 -0.750 1.00 98.64 H
+ATOM 3330 HD22 LEU A 212 -9.156 -9.313 -0.522 1.00 98.64 H
+ATOM 3331 HD23 LEU A 212 -8.349 -8.573 0.884 1.00 98.64 H
+ATOM 3332 N MET A 213 -4.543 -11.069 2.132 1.00 98.74 N
+ATOM 3333 H MET A 213 -5.230 -11.260 2.847 1.00 98.74 H
+ATOM 3334 CA MET A 213 -3.256 -10.486 2.523 1.00 98.74 C
+ATOM 3335 HA MET A 213 -3.092 -9.573 1.951 1.00 98.74 H
+ATOM 3336 C MET A 213 -2.102 -11.433 2.193 1.00 98.74 C
+ATOM 3337 CB MET A 213 -3.229 -10.133 4.017 1.00 98.74 C
+ATOM 3338 HB2 MET A 213 -2.209 -9.855 4.284 1.00 98.74 H
+ATOM 3339 HB3 MET A 213 -3.504 -11.007 4.608 1.00 98.74 H
+ATOM 3340 O MET A 213 -1.137 -10.997 1.578 1.00 98.74 O
+ATOM 3341 CG MET A 213 -4.155 -8.971 4.384 1.00 98.74 C
+ATOM 3342 HG2 MET A 213 -3.788 -8.060 3.909 1.00 98.74 H
+ATOM 3343 HG3 MET A 213 -5.153 -9.167 3.992 1.00 98.74 H
+ATOM 3344 SD MET A 213 -4.292 -8.692 6.173 1.00 98.74 S
+ATOM 3345 CE MET A 213 -2.643 -8.007 6.503 1.00 98.74 C
+ATOM 3346 HE1 MET A 213 -2.571 -7.716 7.551 1.00 98.74 H
+ATOM 3347 HE2 MET A 213 -1.875 -8.749 6.284 1.00 98.74 H
+ATOM 3348 HE3 MET A 213 -2.479 -7.129 5.878 1.00 98.74 H
+ATOM 3349 N MET A 214 -2.209 -12.724 2.533 1.00 98.64 N
+ATOM 3350 H MET A 214 -3.028 -13.027 3.040 1.00 98.64 H
+ATOM 3351 CA MET A 214 -1.162 -13.706 2.212 1.00 98.64 C
+ATOM 3352 HA MET A 214 -0.219 -13.376 2.648 1.00 98.64 H
+ATOM 3353 C MET A 214 -0.923 -13.809 0.703 1.00 98.64 C
+ATOM 3354 CB MET A 214 -1.502 -15.092 2.781 1.00 98.64 C
+ATOM 3355 HB2 MET A 214 -0.734 -15.792 2.453 1.00 98.64 H
+ATOM 3356 HB3 MET A 214 -2.455 -15.428 2.372 1.00 98.64 H
+ATOM 3357 O MET A 214 0.224 -13.791 0.266 1.00 98.64 O
+ATOM 3358 CG MET A 214 -1.572 -15.167 4.311 1.00 98.64 C
+ATOM 3359 HG2 MET A 214 -2.440 -14.610 4.666 1.00 98.64 H
+ATOM 3360 HG3 MET A 214 -1.741 -16.211 4.575 1.00 98.64 H
+ATOM 3361 SD MET A 214 -0.111 -14.604 5.233 1.00 98.64 S
+ATOM 3362 CE MET A 214 -0.510 -12.845 5.450 1.00 98.64 C
+ATOM 3363 HE1 MET A 214 0.056 -12.442 6.290 1.00 98.64 H
+ATOM 3364 HE2 MET A 214 -1.574 -12.730 5.660 1.00 98.64 H
+ATOM 3365 HE3 MET A 214 -0.251 -12.285 4.552 1.00 98.64 H
+ATOM 3366 N PHE A 215 -1.991 -13.867 -0.094 1.00 98.63 N
+ATOM 3367 H PHE A 215 -2.908 -13.889 0.327 1.00 98.63 H
+ATOM 3368 CA PHE A 215 -1.905 -13.908 -1.553 1.00 98.63 C
+ATOM 3369 HA PHE A 215 -1.259 -14.733 -1.851 1.00 98.63 H
+ATOM 3370 C PHE A 215 -1.279 -12.629 -2.121 1.00 98.63 C
+ATOM 3371 CB PHE A 215 -3.308 -14.158 -2.128 1.00 98.63 C
+ATOM 3372 HB2 PHE A 215 -4.025 -13.515 -1.617 1.00 98.63 H
+ATOM 3373 HB3 PHE A 215 -3.594 -15.190 -1.927 1.00 98.63 H
+ATOM 3374 O PHE A 215 -0.233 -12.682 -2.762 1.00 98.63 O
+ATOM 3375 CG PHE A 215 -3.410 -13.896 -3.618 1.00 98.63 C
+ATOM 3376 CD1 PHE A 215 -4.044 -12.729 -4.090 1.00 98.63 C
+ATOM 3377 HD1 PHE A 215 -4.486 -12.031 -3.395 1.00 98.63 H
+ATOM 3378 CD2 PHE A 215 -2.819 -14.788 -4.533 1.00 98.63 C
+ATOM 3379 HD2 PHE A 215 -2.316 -15.676 -4.180 1.00 98.63 H
+ATOM 3380 CE1 PHE A 215 -4.088 -12.456 -5.468 1.00 98.63 C
+ATOM 3381 HE1 PHE A 215 -4.564 -11.557 -5.829 1.00 98.63 H
+ATOM 3382 CE2 PHE A 215 -2.867 -14.516 -5.911 1.00 98.63 C
+ATOM 3383 HE2 PHE A 215 -2.406 -15.195 -6.613 1.00 98.63 H
+ATOM 3384 CZ PHE A 215 -3.500 -13.351 -6.378 1.00 98.63 C
+ATOM 3385 HZ PHE A 215 -3.527 -13.139 -7.437 1.00 98.63 H
+ATOM 3386 N ALA A 216 -1.890 -11.473 -1.854 1.00 98.36 N
+ATOM 3387 H ALA A 216 -2.710 -11.485 -1.266 1.00 98.36 H
+ATOM 3388 CA ALA A 216 -1.501 -10.210 -2.466 1.00 98.36 C
+ATOM 3389 HA ALA A 216 -1.463 -10.343 -3.547 1.00 98.36 H
+ATOM 3390 C ALA A 216 -0.114 -9.749 -2.008 1.00 98.36 C
+ATOM 3391 CB ALA A 216 -2.570 -9.161 -2.139 1.00 98.36 C
+ATOM 3392 HB1 ALA A 216 -3.544 -9.515 -2.476 1.00 98.36 H
+ATOM 3393 HB2 ALA A 216 -2.609 -8.985 -1.064 1.00 98.36 H
+ATOM 3394 HB3 ALA A 216 -2.326 -8.229 -2.650 1.00 98.36 H
+ATOM 3395 O ALA A 216 0.656 -9.238 -2.815 1.00 98.36 O
+ATOM 3396 N TRP A 217 0.227 -9.930 -0.726 1.00 98.58 N
+ATOM 3397 H TRP A 217 -0.413 -10.383 -0.089 1.00 98.58 H
+ATOM 3398 CA TRP A 217 1.511 -9.457 -0.206 1.00 98.58 C
+ATOM 3399 HA TRP A 217 1.685 -8.467 -0.626 1.00 98.58 H
+ATOM 3400 C TRP A 217 2.681 -10.337 -0.657 1.00 98.58 C
+ATOM 3401 CB TRP A 217 1.494 -9.276 1.316 1.00 98.58 C
+ATOM 3402 HB2 TRP A 217 2.520 -9.048 1.606 1.00 98.58 H
+ATOM 3403 HB3 TRP A 217 1.225 -10.212 1.803 1.00 98.58 H
+ATOM 3404 O TRP A 217 3.796 -9.839 -0.765 1.00 98.58 O
+ATOM 3405 CG TRP A 217 0.657 -8.152 1.863 1.00 98.58 C
+ATOM 3406 CD1 TRP A 217 -0.388 -7.552 1.245 1.00 98.58 C
+ATOM 3407 HD1 TRP A 217 -0.770 -7.824 0.272 1.00 98.58 H
+ATOM 3408 CD2 TRP A 217 0.818 -7.441 3.132 1.00 98.58 C
+ATOM 3409 CE2 TRP A 217 -0.144 -6.387 3.179 1.00 98.58 C
+ATOM 3410 CE3 TRP A 217 1.663 -7.567 4.256 1.00 98.58 C
+ATOM 3411 HE3 TRP A 217 2.391 -8.364 4.300 1.00 98.58 H
+ATOM 3412 NE1 TRP A 217 -0.868 -6.520 2.022 1.00 98.58 N
+ATOM 3413 HE1 TRP A 217 -1.636 -5.922 1.752 1.00 98.58 H
+ATOM 3414 CH2 TRP A 217 0.631 -5.630 5.327 1.00 98.58 C
+ATOM 3415 HH2 TRP A 217 0.579 -4.943 6.158 1.00 98.58 H
+ATOM 3416 CZ2 TRP A 217 -0.235 -5.481 4.240 1.00 98.58 C
+ATOM 3417 HZ2 TRP A 217 -0.968 -4.688 4.222 1.00 98.58 H
+ATOM 3418 CZ3 TRP A 217 1.552 -6.682 5.343 1.00 98.58 C
+ATOM 3419 HZ3 TRP A 217 2.164 -6.807 6.225 1.00 98.58 H
+ATOM 3420 N THR A 218 2.436 -11.609 -0.991 1.00 98.75 N
+ATOM 3421 H THR A 218 1.496 -11.965 -0.894 1.00 98.75 H
+ATOM 3422 CA THR A 218 3.468 -12.513 -1.534 1.00 98.75 C
+ATOM 3423 HA THR A 218 4.379 -12.386 -0.949 1.00 98.75 H
+ATOM 3424 C THR A 218 3.831 -12.187 -2.989 1.00 98.75 C
+ATOM 3425 CB THR A 218 3.032 -13.979 -1.385 1.00 98.75 C
+ATOM 3426 HB THR A 218 2.103 -14.143 -1.931 1.00 98.75 H
+ATOM 3427 O THR A 218 4.907 -12.551 -3.452 1.00 98.75 O
+ATOM 3428 CG2 THR A 218 4.073 -14.992 -1.858 1.00 98.75 C
+ATOM 3429 HG21 THR A 218 5.046 -14.761 -1.424 1.00 98.75 H
+ATOM 3430 HG22 THR A 218 4.146 -14.971 -2.945 1.00 98.75 H
+ATOM 3431 HG23 THR A 218 3.773 -15.995 -1.555 1.00 98.75 H
+ATOM 3432 OG1 THR A 218 2.813 -14.260 -0.020 1.00 98.75 O
+ATOM 3433 HG1 THR A 218 1.876 -14.121 0.137 1.00 98.75 H
+ATOM 3434 N LEU A 219 3.003 -11.430 -3.714 1.00 98.63 N
+ATOM 3435 H LEU A 219 2.124 -11.135 -3.314 1.00 98.63 H
+ATOM 3436 CA LEU A 219 3.343 -10.983 -5.070 1.00 98.63 C
+ATOM 3437 HA LEU A 219 3.675 -11.841 -5.656 1.00 98.63 H
+ATOM 3438 C LEU A 219 4.511 -9.981 -5.092 1.00 98.63 C
+ATOM 3439 CB LEU A 219 2.097 -10.391 -5.742 1.00 98.63 C
+ATOM 3440 HB2 LEU A 219 1.755 -9.554 -5.133 1.00 98.63 H
+ATOM 3441 HB3 LEU A 219 2.383 -10.000 -6.718 1.00 98.63 H
+ATOM 3442 O LEU A 219 5.280 -9.975 -6.050 1.00 98.63 O
+ATOM 3443 CG LEU A 219 0.925 -11.370 -5.933 1.00 98.63 C
+ATOM 3444 HG LEU A 219 0.618 -11.761 -4.963 1.00 98.63 H
+ATOM 3445 CD1 LEU A 219 -0.264 -10.625 -6.537 1.00 98.63 C
+ATOM 3446 HD11 LEU A 219 -0.555 -9.808 -5.877 1.00 98.63 H
+ATOM 3447 HD12 LEU A 219 -1.107 -11.306 -6.647 1.00 98.63 H
+ATOM 3448 HD13 LEU A 219 0.009 -10.220 -7.512 1.00 98.63 H
+ATOM 3449 CD2 LEU A 219 1.275 -12.544 -6.848 1.00 98.63 C
+ATOM 3450 HD21 LEU A 219 0.391 -13.161 -7.006 1.00 98.63 H
+ATOM 3451 HD22 LEU A 219 1.634 -12.177 -7.809 1.00 98.63 H
+ATOM 3452 HD23 LEU A 219 2.042 -13.164 -6.383 1.00 98.63 H
+ATOM 3453 N TYR A 220 4.695 -9.176 -4.039 1.00 98.73 N
+ATOM 3454 H TYR A 220 4.047 -9.234 -3.266 1.00 98.73 H
+ATOM 3455 CA TYR A 220 5.806 -8.218 -3.951 1.00 98.73 C
+ATOM 3456 HA TYR A 220 5.788 -7.616 -4.859 1.00 98.73 H
+ATOM 3457 C TYR A 220 7.196 -8.884 -3.912 1.00 98.73 C
+ATOM 3458 CB TYR A 220 5.618 -7.255 -2.769 1.00 98.73 C
+ATOM 3459 HB2 TYR A 220 6.495 -6.612 -2.707 1.00 98.73 H
+ATOM 3460 HB3 TYR A 220 5.566 -7.821 -1.839 1.00 98.73 H
+ATOM 3461 O TYR A 220 8.046 -8.473 -4.700 1.00 98.73 O
+ATOM 3462 CG TYR A 220 4.394 -6.368 -2.880 1.00 98.73 C
+ATOM 3463 CD1 TYR A 220 4.420 -5.222 -3.693 1.00 98.73 C
+ATOM 3464 HD1 TYR A 220 5.323 -4.963 -4.226 1.00 98.73 H
+ATOM 3465 CD2 TYR A 220 3.230 -6.688 -2.164 1.00 98.73 C
+ATOM 3466 HD2 TYR A 220 3.245 -7.556 -1.523 1.00 98.73 H
+ATOM 3467 CE1 TYR A 220 3.273 -4.415 -3.817 1.00 98.73 C
+ATOM 3468 HE1 TYR A 220 3.284 -3.550 -4.463 1.00 98.73 H
+ATOM 3469 CE2 TYR A 220 2.082 -5.880 -2.266 1.00 98.73 C
+ATOM 3470 HE2 TYR A 220 1.181 -6.128 -1.724 1.00 98.73 H
+ATOM 3471 OH TYR A 220 1.005 -3.960 -3.236 1.00 98.73 O
+ATOM 3472 HH TYR A 220 1.135 -3.317 -3.936 1.00 98.73 H
+ATOM 3473 CZ TYR A 220 2.104 -4.745 -3.103 1.00 98.73 C
+ATOM 3474 N PRO A 221 7.471 -9.913 -3.081 1.00 98.56 N
+ATOM 3475 CA PRO A 221 8.746 -10.627 -3.141 1.00 98.56 C
+ATOM 3476 HA PRO A 221 9.559 -9.904 -3.075 1.00 98.56 H
+ATOM 3477 C PRO A 221 8.933 -11.429 -4.439 1.00 98.56 C
+ATOM 3478 CB PRO A 221 8.802 -11.510 -1.891 1.00 98.56 C
+ATOM 3479 HB2 PRO A 221 9.294 -12.464 -2.080 1.00 98.56 H
+ATOM 3480 HB3 PRO A 221 9.320 -10.974 -1.096 1.00 98.56 H
+ATOM 3481 O PRO A 221 10.066 -11.608 -4.874 1.00 98.56 O
+ATOM 3482 CG PRO A 221 7.340 -11.696 -1.503 1.00 98.56 C
+ATOM 3483 HG2 PRO A 221 6.930 -12.534 -2.067 1.00 98.56 H
+ATOM 3484 HG3 PRO A 221 7.224 -11.865 -0.432 1.00 98.56 H
+ATOM 3485 CD PRO A 221 6.702 -10.378 -1.937 1.00 98.56 C
+ATOM 3486 HD2 PRO A 221 5.652 -10.536 -2.184 1.00 98.56 H
+ATOM 3487 HD3 PRO A 221 6.786 -9.654 -1.127 1.00 98.56 H
+ATOM 3488 N ILE A 222 7.857 -11.867 -5.108 1.00 98.71 N
+ATOM 3489 H ILE A 222 6.939 -11.730 -4.710 1.00 98.71 H
+ATOM 3490 CA ILE A 222 7.971 -12.463 -6.452 1.00 98.71 C
+ATOM 3491 HA ILE A 222 8.743 -13.233 -6.425 1.00 98.71 H
+ATOM 3492 C ILE A 222 8.445 -11.403 -7.458 1.00 98.71 C
+ATOM 3493 CB ILE A 222 6.648 -13.136 -6.888 1.00 98.71 C
+ATOM 3494 HB ILE A 222 5.845 -12.401 -6.833 1.00 98.71 H
+ATOM 3495 O ILE A 222 9.390 -11.651 -8.204 1.00 98.71 O
+ATOM 3496 CG1 ILE A 222 6.307 -14.326 -5.961 1.00 98.71 C
+ATOM 3497 HG12 ILE A 222 6.973 -15.159 -6.186 1.00 98.71 H
+ATOM 3498 HG13 ILE A 222 6.476 -14.051 -4.920 1.00 98.71 H
+ATOM 3499 CG2 ILE A 222 6.750 -13.641 -8.342 1.00 98.71 C
+ATOM 3500 HG21 ILE A 222 7.557 -14.368 -8.431 1.00 98.71 H
+ATOM 3501 HG22 ILE A 222 5.815 -14.103 -8.660 1.00 98.71 H
+ATOM 3502 HG23 ILE A 222 6.953 -12.820 -9.029 1.00 98.71 H
+ATOM 3503 CD1 ILE A 222 4.854 -14.807 -6.074 1.00 98.71 C
+ATOM 3504 HD11 ILE A 222 4.178 -14.012 -5.759 1.00 98.71 H
+ATOM 3505 HD12 ILE A 222 4.615 -15.105 -7.094 1.00 98.71 H
+ATOM 3506 HD13 ILE A 222 4.710 -15.667 -5.419 1.00 98.71 H
+ATOM 3507 N ALA A 223 7.846 -10.206 -7.439 1.00 98.69 N
+ATOM 3508 H ALA A 223 7.061 -10.067 -6.820 1.00 98.69 H
+ATOM 3509 CA ALA A 223 8.259 -9.081 -8.281 1.00 98.69 C
+ATOM 3510 HA ALA A 223 8.208 -9.389 -9.325 1.00 98.69 H
+ATOM 3511 C ALA A 223 9.709 -8.640 -7.996 1.00 98.69 C
+ATOM 3512 CB ALA A 223 7.263 -7.933 -8.070 1.00 98.69 C
+ATOM 3513 HB1 ALA A 223 6.247 -8.282 -8.257 1.00 98.69 H
+ATOM 3514 HB2 ALA A 223 7.328 -7.564 -7.047 1.00 98.69 H
+ATOM 3515 HB3 ALA A 223 7.485 -7.116 -8.756 1.00 98.69 H
+ATOM 3516 O ALA A 223 10.459 -8.344 -8.924 1.00 98.69 O
+ATOM 3517 N TYR A 224 10.121 -8.663 -6.726 1.00 98.74 N
+ATOM 3518 H TYR A 224 9.431 -8.857 -6.014 1.00 98.74 H
+ATOM 3519 CA TYR A 224 11.493 -8.389 -6.288 1.00 98.74 C
+ATOM 3520 HA TYR A 224 11.780 -7.384 -6.600 1.00 98.74 H
+ATOM 3521 C TYR A 224 12.529 -9.363 -6.864 1.00 98.74 C
+ATOM 3522 CB TYR A 224 11.520 -8.464 -4.760 1.00 98.74 C
+ATOM 3523 HB2 TYR A 224 10.853 -7.702 -4.356 1.00 98.74 H
+ATOM 3524 HB3 TYR A 224 11.139 -9.437 -4.451 1.00 98.74 H
+ATOM 3525 O TYR A 224 13.654 -8.962 -7.138 1.00 98.74 O
+ATOM 3526 CG TYR A 224 12.885 -8.293 -4.139 1.00 98.74 C
+ATOM 3527 CD1 TYR A 224 13.613 -9.410 -3.680 1.00 98.74 C
+ATOM 3528 HD1 TYR A 224 13.218 -10.407 -3.809 1.00 98.74 H
+ATOM 3529 CD2 TYR A 224 13.431 -7.005 -4.036 1.00 98.74 C
+ATOM 3530 HD2 TYR A 224 12.936 -6.175 -4.519 1.00 98.74 H
+ATOM 3531 CE1 TYR A 224 14.863 -9.221 -3.063 1.00 98.74 C
+ATOM 3532 HE1 TYR A 224 15.454 -10.059 -2.723 1.00 98.74 H
+ATOM 3533 CE2 TYR A 224 14.649 -6.808 -3.374 1.00 98.74 C
+ATOM 3534 HE2 TYR A 224 15.059 -5.815 -3.267 1.00 98.74 H
+ATOM 3535 OH TYR A 224 16.519 -7.705 -2.230 1.00 98.74 O
+ATOM 3536 HH TYR A 224 16.803 -6.796 -2.352 1.00 98.74 H
+ATOM 3537 CZ TYR A 224 15.358 -7.916 -2.882 1.00 98.74 C
+ATOM 3538 N LEU A 225 12.165 -10.634 -7.065 1.00 98.68 N
+ATOM 3539 H LEU A 225 11.228 -10.910 -6.808 1.00 98.68 H
+ATOM 3540 CA LEU A 225 13.070 -11.665 -7.585 1.00 98.68 C
+ATOM 3541 HA LEU A 225 14.085 -11.423 -7.271 1.00 98.68 H
+ATOM 3542 C LEU A 225 13.140 -11.719 -9.116 1.00 98.68 C
+ATOM 3543 CB LEU A 225 12.687 -13.032 -6.994 1.00 98.68 C
+ATOM 3544 HB2 LEU A 225 13.209 -13.816 -7.543 1.00 98.68 H
+ATOM 3545 HB3 LEU A 225 11.617 -13.184 -7.138 1.00 98.68 H
+ATOM 3546 O LEU A 225 13.966 -12.459 -9.645 1.00 98.68 O
+ATOM 3547 CG LEU A 225 13.028 -13.196 -5.503 1.00 98.68 C
+ATOM 3548 HG LEU A 225 12.563 -12.398 -4.924 1.00 98.68 H
+ATOM 3549 CD1 LEU A 225 12.476 -14.535 -5.011 1.00 98.68 C
+ATOM 3550 HD11 LEU A 225 12.933 -15.354 -5.566 1.00 98.68 H
+ATOM 3551 HD12 LEU A 225 12.689 -14.651 -3.949 1.00 98.68 H
+ATOM 3552 HD13 LEU A 225 11.396 -14.554 -5.155 1.00 98.68 H
+ATOM 3553 CD2 LEU A 225 14.537 -13.176 -5.235 1.00 98.68 C
+ATOM 3554 HD21 LEU A 225 14.943 -12.187 -5.449 1.00 98.68 H
+ATOM 3555 HD22 LEU A 225 15.040 -13.914 -5.860 1.00 98.68 H
+ATOM 3556 HD23 LEU A 225 14.731 -13.397 -4.186 1.00 98.68 H
+ATOM 3557 N VAL A 226 12.346 -10.919 -9.835 1.00 98.71 N
+ATOM 3558 H VAL A 226 11.699 -10.324 -9.339 1.00 98.71 H
+ATOM 3559 CA VAL A 226 12.402 -10.821 -11.307 1.00 98.71 C
+ATOM 3560 HA VAL A 226 12.048 -11.764 -11.725 1.00 98.71 H
+ATOM 3561 C VAL A 226 13.824 -10.637 -11.869 1.00 98.71 C
+ATOM 3562 CB VAL A 226 11.455 -9.721 -11.812 1.00 98.71 C
+ATOM 3563 HB VAL A 226 11.639 -8.807 -11.248 1.00 98.71 H
+ATOM 3564 O VAL A 226 14.149 -11.377 -12.798 1.00 98.71 O
+ATOM 3565 CG1 VAL A 226 11.655 -9.397 -13.292 1.00 98.71 C
+ATOM 3566 HG11 VAL A 226 10.970 -8.594 -13.565 1.00 98.71 H
+ATOM 3567 HG12 VAL A 226 12.663 -9.034 -13.496 1.00 98.71 H
+ATOM 3568 HG13 VAL A 226 11.460 -10.272 -13.911 1.00 98.71 H
+ATOM 3569 CG2 VAL A 226 9.989 -10.139 -11.624 1.00 98.71 C
+ATOM 3570 HG21 VAL A 226 9.754 -10.969 -12.289 1.00 98.71 H
+ATOM 3571 HG22 VAL A 226 9.332 -9.302 -11.862 1.00 98.71 H
+ATOM 3572 HG23 VAL A 226 9.812 -10.448 -10.594 1.00 98.71 H
+ATOM 3573 N PRO A 227 14.710 -9.763 -11.329 1.00 98.45 N
+ATOM 3574 CA PRO A 227 16.094 -9.671 -11.810 1.00 98.45 C
+ATOM 3575 HA PRO A 227 16.104 -9.285 -12.830 1.00 98.45 H
+ATOM 3576 C PRO A 227 16.853 -11.004 -11.777 1.00 98.45 C
+ATOM 3577 CB PRO A 227 16.827 -8.695 -10.883 1.00 98.45 C
+ATOM 3578 HB2 PRO A 227 17.538 -9.225 -10.249 1.00 98.45 H
+ATOM 3579 HB3 PRO A 227 17.363 -7.935 -11.452 1.00 98.45 H
+ATOM 3580 O PRO A 227 17.756 -11.219 -12.574 1.00 98.45 O
+ATOM 3581 CG PRO A 227 15.776 -8.068 -9.987 1.00 98.45 C
+ATOM 3582 HG2 PRO A 227 15.639 -7.026 -10.276 1.00 98.45 H
+ATOM 3583 HG3 PRO A 227 16.103 -8.088 -8.947 1.00 98.45 H
+ATOM 3584 CD PRO A 227 14.534 -8.937 -10.142 1.00 98.45 C
+ATOM 3585 HD2 PRO A 227 14.521 -9.599 -9.276 1.00 98.45 H
+ATOM 3586 HD3 PRO A 227 13.618 -8.346 -10.159 1.00 98.45 H
+ATOM 3587 N ALA A 228 16.514 -11.908 -10.854 1.00 98.20 N
+ATOM 3588 H ALA A 228 15.723 -11.724 -10.253 1.00 98.20 H
+ATOM 3589 CA ALA A 228 17.222 -13.172 -10.689 1.00 98.20 C
+ATOM 3590 HA ALA A 228 18.280 -13.007 -10.890 1.00 98.20 H
+ATOM 3591 C ALA A 228 16.749 -14.268 -11.659 1.00 98.20 C
+ATOM 3592 CB ALA A 228 17.090 -13.616 -9.227 1.00 98.20 C
+ATOM 3593 HB1 ALA A 228 17.460 -12.831 -8.567 1.00 98.20 H
+ATOM 3594 HB2 ALA A 228 17.684 -14.517 -9.075 1.00 98.20 H
+ATOM 3595 HB3 ALA A 228 16.050 -13.834 -8.987 1.00 98.20 H
+ATOM 3596 O ALA A 228 17.528 -15.168 -11.966 1.00 98.20 O
+ATOM 3597 N PHE A 229 15.495 -14.226 -12.131 1.00 98.20 N
+ATOM 3598 H PHE A 229 14.902 -13.460 -11.844 1.00 98.20 H
+ATOM 3599 CA PHE A 229 14.932 -15.285 -12.986 1.00 98.20 C
+ATOM 3600 HA PHE A 229 15.704 -16.034 -13.165 1.00 98.20 H
+ATOM 3601 C PHE A 229 14.509 -14.832 -14.393 1.00 98.20 C
+ATOM 3602 CB PHE A 229 13.800 -16.016 -12.243 1.00 98.20 C
+ATOM 3603 HB2 PHE A 229 14.162 -16.313 -11.259 1.00 98.20 H
+ATOM 3604 HB3 PHE A 229 13.578 -16.934 -12.787 1.00 98.20 H
+ATOM 3605 O PHE A 229 14.308 -15.681 -15.259 1.00 98.20 O
+ATOM 3606 CG PHE A 229 12.505 -15.239 -12.089 1.00 98.20 C
+ATOM 3607 CD1 PHE A 229 12.180 -14.630 -10.864 1.00 98.20 C
+ATOM 3608 HD1 PHE A 229 12.859 -14.709 -10.028 1.00 98.20 H
+ATOM 3609 CD2 PHE A 229 11.604 -15.150 -13.167 1.00 98.20 C
+ATOM 3610 HD2 PHE A 229 11.833 -15.638 -14.103 1.00 98.20 H
+ATOM 3611 CE1 PHE A 229 10.975 -13.917 -10.724 1.00 98.20 C
+ATOM 3612 HE1 PHE A 229 10.731 -13.442 -9.785 1.00 98.20 H
+ATOM 3613 CE2 PHE A 229 10.411 -14.418 -13.037 1.00 98.20 C
+ATOM 3614 HE2 PHE A 229 9.737 -14.331 -13.877 1.00 98.20 H
+ATOM 3615 CZ PHE A 229 10.096 -13.802 -11.815 1.00 98.20 C
+ATOM 3616 HZ PHE A 229 9.178 -13.242 -11.710 1.00 98.20 H
+ATOM 3617 N MET A 230 14.366 -13.528 -14.647 1.00 98.29 N
+ATOM 3618 H MET A 230 14.500 -12.871 -13.892 1.00 98.29 H
+ATOM 3619 CA MET A 230 13.964 -12.971 -15.945 1.00 98.29 C
+ATOM 3620 HA MET A 230 14.369 -13.605 -16.735 1.00 98.29 H
+ATOM 3621 C MET A 230 14.564 -11.566 -16.134 1.00 98.29 C
+ATOM 3622 CB MET A 230 12.426 -12.999 -16.052 1.00 98.29 C
+ATOM 3623 HB2 MET A 230 11.990 -12.260 -15.379 1.00 98.29 H
+ATOM 3624 HB3 MET A 230 12.079 -13.984 -15.740 1.00 98.29 H
+ATOM 3625 O MET A 230 13.852 -10.568 -16.152 1.00 98.29 O
+ATOM 3626 CG MET A 230 11.916 -12.764 -17.478 1.00 98.29 C
+ATOM 3627 HG2 MET A 230 12.379 -13.490 -18.147 1.00 98.29 H
+ATOM 3628 HG3 MET A 230 12.223 -11.769 -17.801 1.00 98.29 H
+ATOM 3629 SD MET A 230 10.111 -12.880 -17.659 1.00 98.29 S
+ATOM 3630 CE MET A 230 9.837 -14.651 -17.394 1.00 98.29 C
+ATOM 3631 HE1 MET A 230 10.109 -14.922 -16.374 1.00 98.29 H
+ATOM 3632 HE2 MET A 230 8.783 -14.878 -17.557 1.00 98.29 H
+ATOM 3633 HE3 MET A 230 10.441 -15.223 -18.098 1.00 98.29 H
+ATOM 3634 N ASN A 231 15.894 -11.474 -16.240 1.00 98.39 N
+ATOM 3635 H ASN A 231 16.447 -12.316 -16.174 1.00 98.39 H
+ATOM 3636 CA ASN A 231 16.607 -10.201 -16.420 1.00 98.39 C
+ATOM 3637 HA ASN A 231 16.076 -9.438 -15.850 1.00 98.39 H
+ATOM 3638 C ASN A 231 16.607 -9.738 -17.891 1.00 98.39 C
+ATOM 3639 CB ASN A 231 18.027 -10.311 -15.834 1.00 98.39 C
+ATOM 3640 HB2 ASN A 231 17.994 -10.857 -14.892 1.00 98.39 H
+ATOM 3641 HB3 ASN A 231 18.678 -10.859 -16.515 1.00 98.39 H
+ATOM 3642 O ASN A 231 17.605 -9.868 -18.599 1.00 98.39 O
+ATOM 3643 CG ASN A 231 18.635 -8.944 -15.566 1.00 98.39 C
+ATOM 3644 ND2 ASN A 231 19.826 -8.888 -15.021 1.00 98.39 N
+ATOM 3645 HD21 ASN A 231 20.300 -9.728 -14.719 1.00 98.39 H
+ATOM 3646 HD22 ASN A 231 20.170 -7.964 -14.804 1.00 98.39 H
+ATOM 3647 OD1 ASN A 231 18.039 -7.912 -15.809 1.00 98.39 O
+ATOM 3648 N ASN A 232 15.451 -9.286 -18.373 1.00 98.38 N
+ATOM 3649 H ASN A 232 14.670 -9.223 -17.736 1.00 98.38 H
+ATOM 3650 CA ASN A 232 15.237 -8.736 -19.715 1.00 98.38 C
+ATOM 3651 HA ASN A 232 16.109 -8.151 -20.007 1.00 98.38 H
+ATOM 3652 C ASN A 232 14.026 -7.775 -19.711 1.00 98.38 C
+ATOM 3653 CB ASN A 232 15.096 -9.898 -20.720 1.00 98.38 C
+ATOM 3654 HB2 ASN A 232 16.033 -10.456 -20.733 1.00 98.38 H
+ATOM 3655 HB3 ASN A 232 14.937 -9.502 -21.723 1.00 98.38 H
+ATOM 3656 O ASN A 232 13.328 -7.655 -18.699 1.00 98.38 O
+ATOM 3657 CG ASN A 232 13.956 -10.845 -20.402 1.00 98.38 C
+ATOM 3658 ND2 ASN A 232 14.170 -12.136 -20.488 1.00 98.38 N
+ATOM 3659 HD21 ASN A 232 13.351 -12.716 -20.377 1.00 98.38 H
+ATOM 3660 HD22 ASN A 232 15.070 -12.481 -20.793 1.00 98.38 H
+ATOM 3661 OD1 ASN A 232 12.854 -10.449 -20.083 1.00 98.38 O
+ATOM 3662 N ALA A 233 13.748 -7.118 -20.842 1.00 98.43 N
+ATOM 3663 H ALA A 233 14.387 -7.192 -21.621 1.00 98.43 H
+ATOM 3664 CA ALA A 233 12.631 -6.175 -20.971 1.00 98.43 C
+ATOM 3665 HA ALA A 233 12.772 -5.375 -20.245 1.00 98.43 H
+ATOM 3666 C ALA A 233 11.246 -6.808 -20.692 1.00 98.43 C
+ATOM 3667 CB ALA A 233 12.684 -5.556 -22.373 1.00 98.43 C
+ATOM 3668 HB1 ALA A 233 13.636 -5.046 -22.522 1.00 98.43 H
+ATOM 3669 HB2 ALA A 233 11.884 -4.823 -22.480 1.00 98.43 H
+ATOM 3670 HB3 ALA A 233 12.562 -6.326 -23.134 1.00 98.43 H
+ATOM 3671 O ALA A 233 10.386 -6.163 -20.092 1.00 98.43 O
+ATOM 3672 N ASP A 234 11.025 -8.081 -21.042 1.00 98.66 N
+ATOM 3673 H ASP A 234 11.757 -8.603 -21.504 1.00 98.66 H
+ATOM 3674 CA ASP A 234 9.773 -8.785 -20.711 1.00 98.66 C
+ATOM 3675 HA ASP A 234 8.931 -8.156 -20.999 1.00 98.66 H
+ATOM 3676 C ASP A 234 9.643 -9.055 -19.204 1.00 98.66 C
+ATOM 3677 CB ASP A 234 9.670 -10.101 -21.494 1.00 98.66 C
+ATOM 3678 HB2 ASP A 234 10.535 -10.728 -21.276 1.00 98.66 H
+ATOM 3679 HB3 ASP A 234 8.779 -10.636 -21.164 1.00 98.66 H
+ATOM 3680 O ASP A 234 8.546 -9.007 -18.643 1.00 98.66 O
+ATOM 3681 CG ASP A 234 9.556 -9.871 -23.000 1.00 98.66 C
+ATOM 3682 OD1 ASP A 234 8.703 -9.044 -23.401 1.00 98.66 O
+ATOM 3683 OD2 ASP A 234 10.336 -10.508 -23.740 1.00 98.66 O
+ATOM 3684 N GLY A 235 10.765 -9.271 -18.515 1.00 98.67 N
+ATOM 3685 H GLY A 235 11.628 -9.338 -19.034 1.00 98.67 H
+ATOM 3686 CA GLY A 235 10.826 -9.333 -17.059 1.00 98.67 C
+ATOM 3687 HA2 GLY A 235 11.855 -9.544 -16.767 1.00 98.67 H
+ATOM 3688 HA3 GLY A 235 10.177 -10.129 -16.694 1.00 98.67 H
+ATOM 3689 C GLY A 235 10.426 -8.017 -16.402 1.00 98.67 C
+ATOM 3690 O GLY A 235 9.646 -8.020 -15.449 1.00 98.67 O
+ATOM 3691 N VAL A 236 10.877 -6.881 -16.938 1.00 98.71 N
+ATOM 3692 H VAL A 236 11.520 -6.945 -17.715 1.00 98.71 H
+ATOM 3693 CA VAL A 236 10.439 -5.551 -16.481 1.00 98.71 C
+ATOM 3694 HA VAL A 236 10.685 -5.442 -15.424 1.00 98.71 H
+ATOM 3695 C VAL A 236 8.921 -5.403 -16.606 1.00 98.71 C
+ATOM 3696 CB VAL A 236 11.169 -4.437 -17.253 1.00 98.71 C
+ATOM 3697 HB VAL A 236 11.087 -4.615 -18.325 1.00 98.71 H
+ATOM 3698 O VAL A 236 8.255 -5.014 -15.641 1.00 98.71 O
+ATOM 3699 CG1 VAL A 236 10.555 -3.067 -16.959 1.00 98.71 C
+ATOM 3700 HG11 VAL A 236 9.558 -3.002 -17.394 1.00 98.71 H
+ATOM 3701 HG12 VAL A 236 10.481 -2.908 -15.883 1.00 98.71 H
+ATOM 3702 HG13 VAL A 236 11.158 -2.283 -17.418 1.00 98.71 H
+ATOM 3703 CG2 VAL A 236 12.654 -4.432 -16.881 1.00 98.71 C
+ATOM 3704 HG21 VAL A 236 12.766 -4.205 -15.821 1.00 98.71 H
+ATOM 3705 HG22 VAL A 236 13.174 -3.673 -17.466 1.00 98.71 H
+ATOM 3706 HG23 VAL A 236 13.111 -5.397 -17.102 1.00 98.71 H
+ATOM 3707 N VAL A 237 8.352 -5.793 -17.751 1.00 98.83 N
+ATOM 3708 H VAL A 237 8.955 -6.086 -18.507 1.00 98.83 H
+ATOM 3709 CA VAL A 237 6.896 -5.814 -17.959 1.00 98.83 C
+ATOM 3710 HA VAL A 237 6.511 -4.804 -17.823 1.00 98.83 H
+ATOM 3711 C VAL A 237 6.200 -6.705 -16.922 1.00 98.83 C
+ATOM 3712 CB VAL A 237 6.557 -6.267 -19.393 1.00 98.83 C
+ATOM 3713 HB VAL A 237 7.067 -7.204 -19.617 1.00 98.83 H
+ATOM 3714 O VAL A 237 5.241 -6.273 -16.274 1.00 98.83 O
+ATOM 3715 CG1 VAL A 237 5.052 -6.497 -19.553 1.00 98.83 C
+ATOM 3716 HG11 VAL A 237 4.766 -7.434 -19.075 1.00 98.83 H
+ATOM 3717 HG12 VAL A 237 4.515 -5.675 -19.078 1.00 98.83 H
+ATOM 3718 HG13 VAL A 237 4.787 -6.560 -20.608 1.00 98.83 H
+ATOM 3719 CG2 VAL A 237 6.995 -5.229 -20.429 1.00 98.83 C
+ATOM 3720 HG21 VAL A 237 6.439 -4.300 -20.300 1.00 98.83 H
+ATOM 3721 HG22 VAL A 237 6.800 -5.618 -21.429 1.00 98.83 H
+ATOM 3722 HG23 VAL A 237 8.062 -5.025 -20.343 1.00 98.83 H
+ATOM 3723 N LEU A 238 6.702 -7.926 -16.705 1.00 98.81 N
+ATOM 3724 H LEU A 238 7.474 -8.228 -17.282 1.00 98.81 H
+ATOM 3725 CA LEU A 238 6.174 -8.858 -15.705 1.00 98.81 C
+ATOM 3726 HA LEU A 238 5.134 -9.066 -15.955 1.00 98.81 H
+ATOM 3727 C LEU A 238 6.201 -8.255 -14.294 1.00 98.81 C
+ATOM 3728 CB LEU A 238 6.974 -10.174 -15.772 1.00 98.81 C
+ATOM 3729 HB2 LEU A 238 6.829 -10.624 -16.754 1.00 98.81 H
+ATOM 3730 HB3 LEU A 238 8.035 -9.945 -15.672 1.00 98.81 H
+ATOM 3731 O LEU A 238 5.224 -8.378 -13.554 1.00 98.81 O
+ATOM 3732 CG LEU A 238 6.610 -11.200 -14.682 1.00 98.81 C
+ATOM 3733 HG LEU A 238 6.760 -10.760 -13.696 1.00 98.81 H
+ATOM 3734 CD1 LEU A 238 5.158 -11.673 -14.793 1.00 98.81 C
+ATOM 3735 HD11 LEU A 238 4.481 -10.836 -14.624 1.00 98.81 H
+ATOM 3736 HD12 LEU A 238 4.961 -12.435 -14.039 1.00 98.81 H
+ATOM 3737 HD13 LEU A 238 4.981 -12.088 -15.785 1.00 98.81 H
+ATOM 3738 CD2 LEU A 238 7.529 -12.417 -14.780 1.00 98.81 C
+ATOM 3739 HD21 LEU A 238 7.294 -13.128 -13.988 1.00 98.81 H
+ATOM 3740 HD22 LEU A 238 7.408 -12.896 -15.752 1.00 98.81 H
+ATOM 3741 HD23 LEU A 238 8.565 -12.097 -14.675 1.00 98.81 H
+ATOM 3742 N ARG A 239 7.288 -7.577 -13.913 1.00 98.76 N
+ATOM 3743 H ARG A 239 8.054 -7.519 -14.568 1.00 98.76 H
+ATOM 3744 CA ARG A 239 7.417 -6.921 -12.607 1.00 98.76 C
+ATOM 3745 HA ARG A 239 7.287 -7.668 -11.823 1.00 98.76 H
+ATOM 3746 C ARG A 239 6.337 -5.861 -12.400 1.00 98.76 C
+ATOM 3747 CB ARG A 239 8.818 -6.309 -12.490 1.00 98.76 C
+ATOM 3748 HB2 ARG A 239 8.932 -5.511 -13.223 1.00 98.76 H
+ATOM 3749 HB3 ARG A 239 9.564 -7.075 -12.703 1.00 98.76 H
+ATOM 3750 O ARG A 239 5.678 -5.862 -11.358 1.00 98.76 O
+ATOM 3751 CG ARG A 239 9.066 -5.741 -11.088 1.00 98.76 C
+ATOM 3752 HG2 ARG A 239 9.093 -6.553 -10.361 1.00 98.76 H
+ATOM 3753 HG3 ARG A 239 8.263 -5.054 -10.823 1.00 98.76 H
+ATOM 3754 CD ARG A 239 10.374 -4.960 -11.035 1.00 98.76 C
+ATOM 3755 HD2 ARG A 239 10.472 -4.502 -10.051 1.00 98.76 H
+ATOM 3756 HD3 ARG A 239 10.346 -4.165 -11.779 1.00 98.76 H
+ATOM 3757 NE ARG A 239 11.538 -5.817 -11.274 1.00 98.76 N
+ATOM 3758 HE ARG A 239 11.409 -6.819 -11.282 1.00 98.76 H
+ATOM 3759 NH1 ARG A 239 13.090 -4.107 -11.230 1.00 98.76 N
+ATOM 3760 HH11 ARG A 239 14.065 -3.866 -11.127 1.00 98.76 H
+ATOM 3761 HH12 ARG A 239 12.528 -3.421 -11.713 1.00 98.76 H
+ATOM 3762 NH2 ARG A 239 13.767 -6.162 -11.400 1.00 98.76 N
+ATOM 3763 HH21 ARG A 239 14.669 -5.710 -11.347 1.00 98.76 H
+ATOM 3764 HH22 ARG A 239 13.665 -7.152 -11.569 1.00 98.76 H
+ATOM 3765 CZ ARG A 239 12.773 -5.360 -11.296 1.00 98.76 C
+ATOM 3766 N GLN A 240 6.124 -4.979 -13.378 1.00 98.80 N
+ATOM 3767 H GLN A 240 6.691 -5.040 -14.212 1.00 98.80 H
+ATOM 3768 CA GLN A 240 5.106 -3.925 -13.275 1.00 98.80 C
+ATOM 3769 HA GLN A 240 5.227 -3.427 -12.313 1.00 98.80 H
+ATOM 3770 C GLN A 240 3.680 -4.498 -13.286 1.00 98.80 C
+ATOM 3771 CB GLN A 240 5.298 -2.872 -14.380 1.00 98.80 C
+ATOM 3772 HB2 GLN A 240 4.511 -2.124 -14.290 1.00 98.80 H
+ATOM 3773 HB3 GLN A 240 5.196 -3.352 -15.354 1.00 98.80 H
+ATOM 3774 O GLN A 240 2.805 -3.997 -12.570 1.00 98.80 O
+ATOM 3775 CG GLN A 240 6.660 -2.152 -14.322 1.00 98.80 C
+ATOM 3776 HG2 GLN A 240 7.449 -2.866 -14.558 1.00 98.80 H
+ATOM 3777 HG3 GLN A 240 6.692 -1.384 -15.095 1.00 98.80 H
+ATOM 3778 CD GLN A 240 6.983 -1.489 -12.978 1.00 98.80 C
+ATOM 3779 NE2 GLN A 240 8.229 -1.547 -12.551 1.00 98.80 N
+ATOM 3780 HE21 GLN A 240 8.956 -1.922 -13.145 1.00 98.80 H
+ATOM 3781 HE22 GLN A 240 8.476 -1.096 -11.682 1.00 98.80 H
+ATOM 3782 OE1 GLN A 240 6.136 -0.936 -12.275 1.00 98.80 O
+ATOM 3783 N LEU A 241 3.450 -5.601 -14.005 1.00 98.80 N
+ATOM 3784 H LEU A 241 4.174 -5.930 -14.628 1.00 98.80 H
+ATOM 3785 CA LEU A 241 2.190 -6.343 -13.948 1.00 98.80 C
+ATOM 3786 HA LEU A 241 1.379 -5.645 -14.155 1.00 98.80 H
+ATOM 3787 C LEU A 241 1.941 -6.937 -12.553 1.00 98.80 C
+ATOM 3788 CB LEU A 241 2.202 -7.420 -15.047 1.00 98.80 C
+ATOM 3789 HB2 LEU A 241 3.055 -8.079 -14.888 1.00 98.80 H
+ATOM 3790 HB3 LEU A 241 2.337 -6.934 -16.013 1.00 98.80 H
+ATOM 3791 O LEU A 241 0.856 -6.763 -11.993 1.00 98.80 O
+ATOM 3792 CG LEU A 241 0.928 -8.281 -15.092 1.00 98.80 C
+ATOM 3793 HG LEU A 241 0.790 -8.780 -14.133 1.00 98.80 H
+ATOM 3794 CD1 LEU A 241 -0.321 -7.452 -15.401 1.00 98.80 C
+ATOM 3795 HD11 LEU A 241 -0.180 -6.902 -16.332 1.00 98.80 H
+ATOM 3796 HD12 LEU A 241 -1.184 -8.110 -15.501 1.00 98.80 H
+ATOM 3797 HD13 LEU A 241 -0.518 -6.749 -14.592 1.00 98.80 H
+ATOM 3798 CD2 LEU A 241 1.075 -9.360 -16.162 1.00 98.80 C
+ATOM 3799 HD21 LEU A 241 1.205 -8.898 -17.141 1.00 98.80 H
+ATOM 3800 HD22 LEU A 241 1.946 -9.978 -15.945 1.00 98.80 H
+ATOM 3801 HD23 LEU A 241 0.188 -9.993 -16.177 1.00 98.80 H
+ATOM 3802 N LEU A 242 2.945 -7.589 -11.958 1.00 98.77 N
+ATOM 3803 H LEU A 242 3.805 -7.707 -12.474 1.00 98.77 H
+ATOM 3804 CA LEU A 242 2.859 -8.140 -10.603 1.00 98.77 C
+ATOM 3805 HA LEU A 242 2.022 -8.836 -10.559 1.00 98.77 H
+ATOM 3806 C LEU A 242 2.575 -7.047 -9.569 1.00 98.77 C
+ATOM 3807 CB LEU A 242 4.160 -8.879 -10.246 1.00 98.77 C
+ATOM 3808 HB2 LEU A 242 5.003 -8.231 -10.486 1.00 98.77 H
+ATOM 3809 HB3 LEU A 242 4.176 -9.054 -9.170 1.00 98.77 H
+ATOM 3810 O LEU A 242 1.676 -7.219 -8.745 1.00 98.77 O
+ATOM 3811 CG LEU A 242 4.356 -10.231 -10.950 1.00 98.77 C
+ATOM 3812 HG LEU A 242 4.202 -10.128 -12.024 1.00 98.77 H
+ATOM 3813 CD1 LEU A 242 5.782 -10.716 -10.695 1.00 98.77 C
+ATOM 3814 HD11 LEU A 242 6.487 -10.011 -11.135 1.00 98.77 H
+ATOM 3815 HD12 LEU A 242 5.933 -11.687 -11.165 1.00 98.77 H
+ATOM 3816 HD13 LEU A 242 5.965 -10.789 -9.623 1.00 98.77 H
+ATOM 3817 CD2 LEU A 242 3.387 -11.293 -10.423 1.00 98.77 C
+ATOM 3818 HD21 LEU A 242 2.359 -11.006 -10.643 1.00 98.77 H
+ATOM 3819 HD22 LEU A 242 3.590 -12.243 -10.916 1.00 98.77 H
+ATOM 3820 HD23 LEU A 242 3.514 -11.412 -9.347 1.00 98.77 H
+ATOM 3821 N PHE A 243 3.279 -5.910 -9.631 1.00 98.79 N
+ATOM 3822 H PHE A 243 4.027 -5.837 -10.306 1.00 98.79 H
+ATOM 3823 CA PHE A 243 3.007 -4.776 -8.744 1.00 98.79 C
+ATOM 3824 HA PHE A 243 3.055 -5.127 -7.714 1.00 98.79 H
+ATOM 3825 C PHE A 243 1.591 -4.232 -8.917 1.00 98.79 C
+ATOM 3826 CB PHE A 243 4.033 -3.650 -8.952 1.00 98.79 C
+ATOM 3827 HB2 PHE A 243 3.657 -2.754 -8.458 1.00 98.79 H
+ATOM 3828 HB3 PHE A 243 4.097 -3.428 -10.017 1.00 98.79 H
+ATOM 3829 O PHE A 243 0.927 -3.963 -7.919 1.00 98.79 O
+ATOM 3830 CG PHE A 243 5.427 -3.899 -8.402 1.00 98.79 C
+ATOM 3831 CD1 PHE A 243 5.621 -4.559 -7.169 1.00 98.79 C
+ATOM 3832 HD1 PHE A 243 4.781 -4.937 -6.605 1.00 98.79 H
+ATOM 3833 CD2 PHE A 243 6.544 -3.402 -9.100 1.00 98.79 C
+ATOM 3834 HD2 PHE A 243 6.414 -2.885 -10.040 1.00 98.79 H
+ATOM 3835 CE1 PHE A 243 6.918 -4.748 -6.661 1.00 98.79 C
+ATOM 3836 HE1 PHE A 243 7.073 -5.288 -5.739 1.00 98.79 H
+ATOM 3837 CE2 PHE A 243 7.837 -3.570 -8.577 1.00 98.79 C
+ATOM 3838 HE2 PHE A 243 8.688 -3.181 -9.118 1.00 98.79 H
+ATOM 3839 CZ PHE A 243 8.027 -4.255 -7.366 1.00 98.79 C
+ATOM 3840 HZ PHE A 243 9.026 -4.404 -6.982 1.00 98.79 H
+ATOM 3841 N THR A 244 1.091 -4.133 -10.147 1.00 98.75 N
+ATOM 3842 H THR A 244 1.696 -4.333 -10.931 1.00 98.75 H
+ATOM 3843 CA THR A 244 -0.276 -3.674 -10.420 1.00 98.75 C
+ATOM 3844 HA THR A 244 -0.409 -2.689 -9.970 1.00 98.75 H
+ATOM 3845 C THR A 244 -1.328 -4.602 -9.798 1.00 98.75 C
+ATOM 3846 CB THR A 244 -0.483 -3.532 -11.933 1.00 98.75 C
+ATOM 3847 HB THR A 244 -0.288 -4.480 -12.436 1.00 98.75 H
+ATOM 3848 O THR A 244 -2.223 -4.138 -9.083 1.00 98.75 O
+ATOM 3849 CG2 THR A 244 -1.895 -3.075 -12.270 1.00 98.75 C
+ATOM 3850 HG21 THR A 244 -2.602 -3.883 -12.080 1.00 98.75 H
+ATOM 3851 HG22 THR A 244 -1.948 -2.812 -13.327 1.00 98.75 H
+ATOM 3852 HG23 THR A 244 -2.163 -2.204 -11.672 1.00 98.75 H
+ATOM 3853 OG1 THR A 244 0.408 -2.566 -12.442 1.00 98.75 O
+ATOM 3854 HG1 THR A 244 1.254 -2.987 -12.608 1.00 98.75 H
+ATOM 3855 N ILE A 245 -1.199 -5.921 -9.995 1.00 98.75 N
+ATOM 3856 H ILE A 245 -0.441 -6.242 -10.580 1.00 98.75 H
+ATOM 3857 CA ILE A 245 -2.098 -6.923 -9.391 1.00 98.75 C
+ATOM 3858 HA ILE A 245 -3.124 -6.689 -9.675 1.00 98.75 H
+ATOM 3859 C ILE A 245 -2.020 -6.856 -7.861 1.00 98.75 C
+ATOM 3860 CB ILE A 245 -1.757 -8.344 -9.908 1.00 98.75 C
+ATOM 3861 HB ILE A 245 -0.697 -8.526 -9.735 1.00 98.75 H
+ATOM 3862 O ILE A 245 -3.051 -6.866 -7.177 1.00 98.75 O
+ATOM 3863 CG1 ILE A 245 -2.039 -8.453 -11.425 1.00 98.75 C
+ATOM 3864 HG12 ILE A 245 -1.613 -7.595 -11.944 1.00 98.75 H
+ATOM 3865 HG13 ILE A 245 -3.115 -8.436 -11.599 1.00 98.75 H
+ATOM 3866 CG2 ILE A 245 -2.564 -9.424 -9.154 1.00 98.75 C
+ATOM 3867 HG21 ILE A 245 -2.294 -10.417 -9.513 1.00 98.75 H
+ATOM 3868 HG22 ILE A 245 -2.348 -9.402 -8.086 1.00 98.75 H
+ATOM 3869 HG23 ILE A 245 -3.632 -9.267 -9.306 1.00 98.75 H
+ATOM 3870 CD1 ILE A 245 -1.447 -9.711 -12.075 1.00 98.75 C
+ATOM 3871 HD11 ILE A 245 -1.587 -9.654 -13.154 1.00 98.75 H
+ATOM 3872 HD12 ILE A 245 -1.945 -10.609 -11.709 1.00 98.75 H
+ATOM 3873 HD13 ILE A 245 -0.379 -9.770 -11.863 1.00 98.75 H
+ATOM 3874 N ALA A 246 -0.804 -6.765 -7.318 1.00 98.69 N
+ATOM 3875 H ALA A 246 -0.001 -6.771 -7.930 1.00 98.69 H
+ATOM 3876 CA ALA A 246 -0.562 -6.694 -5.886 1.00 98.69 C
+ATOM 3877 HA ALA A 246 -1.044 -7.549 -5.410 1.00 98.69 H
+ATOM 3878 C ALA A 246 -1.147 -5.419 -5.266 1.00 98.69 C
+ATOM 3879 CB ALA A 246 0.945 -6.797 -5.641 1.00 98.69 C
+ATOM 3880 HB1 ALA A 246 1.132 -6.968 -4.581 1.00 98.69 H
+ATOM 3881 HB2 ALA A 246 1.445 -5.882 -5.958 1.00 98.69 H
+ATOM 3882 HB3 ALA A 246 1.358 -7.632 -6.207 1.00 98.69 H
+ATOM 3883 O ALA A 246 -1.780 -5.492 -4.214 1.00 98.69 O
+ATOM 3884 N ASP A 247 -0.996 -4.261 -5.911 1.00 98.75 N
+ATOM 3885 H ASP A 247 -0.448 -4.261 -6.760 1.00 98.75 H
+ATOM 3886 CA ASP A 247 -1.485 -2.971 -5.421 1.00 98.75 C
+ATOM 3887 HA ASP A 247 -1.157 -2.846 -4.389 1.00 98.75 H
+ATOM 3888 C ASP A 247 -3.014 -2.931 -5.372 1.00 98.75 C
+ATOM 3889 CB ASP A 247 -0.899 -1.815 -6.263 1.00 98.75 C
+ATOM 3890 HB2 ASP A 247 -1.477 -0.916 -6.052 1.00 98.75 H
+ATOM 3891 HB3 ASP A 247 -1.009 -2.040 -7.324 1.00 98.75 H
+ATOM 3892 O ASP A 247 -3.583 -2.620 -4.323 1.00 98.75 O
+ATOM 3893 CG ASP A 247 0.572 -1.493 -5.941 1.00 98.75 C
+ATOM 3894 OD1 ASP A 247 1.007 -1.845 -4.812 1.00 98.75 O
+ATOM 3895 OD2 ASP A 247 1.230 -0.770 -6.722 1.00 98.75 O
+ATOM 3896 N ILE A 248 -3.693 -3.343 -6.445 1.00 98.76 N
+ATOM 3897 H ILE A 248 -3.176 -3.611 -7.271 1.00 98.76 H
+ATOM 3898 CA ILE A 248 -5.161 -3.408 -6.466 1.00 98.76 C
+ATOM 3899 HA ILE A 248 -5.553 -2.431 -6.183 1.00 98.76 H
+ATOM 3900 C ILE A 248 -5.671 -4.412 -5.424 1.00 98.76 C
+ATOM 3901 CB ILE A 248 -5.662 -3.728 -7.893 1.00 98.76 C
+ATOM 3902 HB ILE A 248 -5.145 -4.618 -8.254 1.00 98.76 H
+ATOM 3903 O ILE A 248 -6.590 -4.107 -4.662 1.00 98.76 O
+ATOM 3904 CG1 ILE A 248 -5.323 -2.539 -8.820 1.00 98.76 C
+ATOM 3905 HG12 ILE A 248 -5.875 -1.657 -8.495 1.00 98.76 H
+ATOM 3906 HG13 ILE A 248 -4.261 -2.306 -8.746 1.00 98.76 H
+ATOM 3907 CG2 ILE A 248 -7.178 -4.009 -7.901 1.00 98.76 C
+ATOM 3908 HG21 ILE A 248 -7.415 -4.876 -7.286 1.00 98.76 H
+ATOM 3909 HG22 ILE A 248 -7.514 -4.243 -8.911 1.00 98.76 H
+ATOM 3910 HG23 ILE A 248 -7.726 -3.140 -7.536 1.00 98.76 H
+ATOM 3911 CD1 ILE A 248 -5.618 -2.789 -10.300 1.00 98.76 C
+ATOM 3912 HD11 ILE A 248 -5.075 -3.668 -10.648 1.00 98.76 H
+ATOM 3913 HD12 ILE A 248 -6.686 -2.917 -10.473 1.00 98.76 H
+ATOM 3914 HD13 ILE A 248 -5.287 -1.915 -10.860 1.00 98.76 H
+ATOM 3915 N SER A 249 -5.050 -5.588 -5.322 1.00 98.78 N
+ATOM 3916 H SER A 249 -4.299 -5.794 -5.965 1.00 98.78 H
+ATOM 3917 CA SER A 249 -5.477 -6.621 -4.372 1.00 98.78 C
+ATOM 3918 HA SER A 249 -6.545 -6.794 -4.503 1.00 98.78 H
+ATOM 3919 C SER A 249 -5.253 -6.203 -2.913 1.00 98.78 C
+ATOM 3920 CB SER A 249 -4.753 -7.939 -4.656 1.00 98.78 C
+ATOM 3921 HB2 SER A 249 -3.679 -7.810 -4.521 1.00 98.78 H
+ATOM 3922 HB3 SER A 249 -5.115 -8.700 -3.964 1.00 98.78 H
+ATOM 3923 O SER A 249 -6.155 -6.315 -2.080 1.00 98.78 O
+ATOM 3924 OG SER A 249 -5.002 -8.373 -5.975 1.00 98.78 O
+ATOM 3925 HG SER A 249 -4.392 -7.911 -6.555 1.00 98.78 H
+ATOM 3926 N SER A 250 -4.061 -5.692 -2.596 1.00 98.75 N
+ATOM 3927 H SER A 250 -3.385 -5.574 -3.337 1.00 98.75 H
+ATOM 3928 CA SER A 250 -3.640 -5.364 -1.228 1.00 98.75 C
+ATOM 3929 HA SER A 250 -4.004 -6.146 -0.562 1.00 98.75 H
+ATOM 3930 C SER A 250 -4.187 -4.041 -0.702 1.00 98.75 C
+ATOM 3931 CB SER A 250 -2.112 -5.332 -1.114 1.00 98.75 C
+ATOM 3932 HB2 SER A 250 -1.844 -5.200 -0.066 1.00 98.75 H
+ATOM 3933 HB3 SER A 250 -1.689 -6.271 -1.470 1.00 98.75 H
+ATOM 3934 O SER A 250 -4.193 -3.848 0.513 1.00 98.75 O
+ATOM 3935 OG SER A 250 -1.564 -4.257 -1.848 1.00 98.75 O
+ATOM 3936 HG SER A 250 -1.436 -4.579 -2.743 1.00 98.75 H
+ATOM 3937 N LYS A 251 -4.636 -3.134 -1.579 1.00 98.73 N
+ATOM 3938 H LYS A 251 -4.484 -3.320 -2.560 1.00 98.73 H
+ATOM 3939 CA LYS A 251 -5.120 -1.800 -1.193 1.00 98.73 C
+ATOM 3940 HA LYS A 251 -5.027 -1.683 -0.113 1.00 98.73 H
+ATOM 3941 C LYS A 251 -6.601 -1.625 -1.497 1.00 98.73 C
+ATOM 3942 CB LYS A 251 -4.263 -0.701 -1.850 1.00 98.73 C
+ATOM 3943 HB2 LYS A 251 -4.576 0.264 -1.452 1.00 98.73 H
+ATOM 3944 HB3 LYS A 251 -4.429 -0.694 -2.927 1.00 98.73 H
+ATOM 3945 O LYS A 251 -7.364 -1.294 -0.593 1.00 98.73 O
+ATOM 3946 CG LYS A 251 -2.766 -0.857 -1.560 1.00 98.73 C
+ATOM 3947 HG2 LYS A 251 -2.601 -0.769 -0.486 1.00 98.73 H
+ATOM 3948 HG3 LYS A 251 -2.434 -1.842 -1.890 1.00 98.73 H
+ATOM 3949 CD LYS A 251 -1.932 0.196 -2.294 1.00 98.73 C
+ATOM 3950 HD2 LYS A 251 -2.289 1.187 -2.014 1.00 98.73 H
+ATOM 3951 HD3 LYS A 251 -2.053 0.076 -3.371 1.00 98.73 H
+ATOM 3952 CE LYS A 251 -0.447 0.070 -1.924 1.00 98.73 C
+ATOM 3953 HE2 LYS A 251 0.101 0.882 -2.402 1.00 98.73 H
+ATOM 3954 HE3 LYS A 251 -0.351 0.182 -0.844 1.00 98.73 H
+ATOM 3955 NZ LYS A 251 0.126 -1.233 -2.350 1.00 98.73 N
+ATOM 3956 HZ1 LYS A 251 1.044 -1.403 -1.965 1.00 98.73 H
+ATOM 3957 HZ2 LYS A 251 0.255 -1.277 -3.350 1.00 98.73 H
+ATOM 3958 HZ3 LYS A 251 -0.461 -2.018 -2.103 1.00 98.73 H
+ATOM 3959 N VAL A 252 -7.023 -1.880 -2.735 1.00 98.81 N
+ATOM 3960 H VAL A 252 -6.352 -2.211 -3.413 1.00 98.81 H
+ATOM 3961 CA VAL A 252 -8.401 -1.625 -3.187 1.00 98.81 C
+ATOM 3962 HA VAL A 252 -8.752 -0.707 -2.715 1.00 98.81 H
+ATOM 3963 C VAL A 252 -9.333 -2.741 -2.728 1.00 98.81 C
+ATOM 3964 CB VAL A 252 -8.476 -1.403 -4.710 1.00 98.81 C
+ATOM 3965 HB VAL A 252 -8.145 -2.302 -5.230 1.00 98.81 H
+ATOM 3966 O VAL A 252 -10.231 -2.483 -1.930 1.00 98.81 O
+ATOM 3967 CG1 VAL A 252 -9.912 -1.111 -5.161 1.00 98.81 C
+ATOM 3968 HG11 VAL A 252 -10.322 -0.280 -4.586 1.00 98.81 H
+ATOM 3969 HG12 VAL A 252 -10.542 -1.990 -5.022 1.00 98.81 H
+ATOM 3970 HG13 VAL A 252 -9.919 -0.850 -6.219 1.00 98.81 H
+ATOM 3971 CG2 VAL A 252 -7.570 -0.245 -5.144 1.00 98.81 C
+ATOM 3972 HG21 VAL A 252 -6.568 -0.335 -4.724 1.00 98.81 H
+ATOM 3973 HG22 VAL A 252 -8.002 0.710 -4.844 1.00 98.81 H
+ATOM 3974 HG23 VAL A 252 -7.453 -0.264 -6.228 1.00 98.81 H
+ATOM 3975 N ILE A 253 -9.098 -3.988 -3.154 1.00 98.82 N
+ATOM 3976 H ILE A 253 -8.313 -4.139 -3.771 1.00 98.82 H
+ATOM 3977 CA ILE A 253 -9.940 -5.139 -2.771 1.00 98.82 C
+ATOM 3978 HA ILE A 253 -10.970 -4.924 -3.055 1.00 98.82 H
+ATOM 3979 C ILE A 253 -9.919 -5.315 -1.250 1.00 98.82 C
+ATOM 3980 CB ILE A 253 -9.500 -6.432 -3.499 1.00 98.82 C
+ATOM 3981 HB ILE A 253 -8.462 -6.642 -3.238 1.00 98.82 H
+ATOM 3982 O ILE A 253 -10.968 -5.429 -0.615 1.00 98.82 O
+ATOM 3983 CG1 ILE A 253 -9.592 -6.248 -5.033 1.00 98.82 C
+ATOM 3984 HG12 ILE A 253 -10.612 -5.978 -5.304 1.00 98.82 H
+ATOM 3985 HG13 ILE A 253 -8.940 -5.427 -5.333 1.00 98.82 H
+ATOM 3986 CG2 ILE A 253 -10.354 -7.632 -3.045 1.00 98.82 C
+ATOM 3987 HG21 ILE A 253 -10.319 -7.758 -1.963 1.00 98.82 H
+ATOM 3988 HG22 ILE A 253 -9.974 -8.554 -3.485 1.00 98.82 H
+ATOM 3989 HG23 ILE A 253 -11.391 -7.489 -3.350 1.00 98.82 H
+ATOM 3990 CD1 ILE A 253 -9.178 -7.476 -5.856 1.00 98.82 C
+ATOM 3991 HD11 ILE A 253 -9.921 -8.267 -5.759 1.00 98.82 H
+ATOM 3992 HD12 ILE A 253 -8.207 -7.847 -5.527 1.00 98.82 H
+ATOM 3993 HD13 ILE A 253 -9.111 -7.196 -6.907 1.00 98.82 H
+ATOM 3994 N TYR A 254 -8.732 -5.252 -0.648 1.00 98.87 N
+ATOM 3995 H TYR A 254 -7.903 -5.233 -1.225 1.00 98.87 H
+ATOM 3996 CA TYR A 254 -8.571 -5.259 0.801 1.00 98.87 C
+ATOM 3997 HA TYR A 254 -8.938 -6.205 1.198 1.00 98.87 H
+ATOM 3998 C TYR A 254 -9.360 -4.132 1.493 1.00 98.87 C
+ATOM 3999 CB TYR A 254 -7.080 -5.145 1.104 1.00 98.87 C
+ATOM 4000 HB2 TYR A 254 -6.567 -6.038 0.748 1.00 98.87 H
+ATOM 4001 HB3 TYR A 254 -6.689 -4.289 0.553 1.00 98.87 H
+ATOM 4002 O TYR A 254 -10.115 -4.400 2.428 1.00 98.87 O
+ATOM 4003 CG TYR A 254 -6.788 -4.953 2.571 1.00 98.87 C
+ATOM 4004 CD1 TYR A 254 -6.526 -3.661 3.063 1.00 98.87 C
+ATOM 4005 HD1 TYR A 254 -6.497 -2.822 2.384 1.00 98.87 H
+ATOM 4006 CD2 TYR A 254 -6.810 -6.058 3.441 1.00 98.87 C
+ATOM 4007 HD2 TYR A 254 -6.999 -7.047 3.052 1.00 98.87 H
+ATOM 4008 CE1 TYR A 254 -6.257 -3.474 4.427 1.00 98.87 C
+ATOM 4009 HE1 TYR A 254 -5.996 -2.493 4.797 1.00 98.87 H
+ATOM 4010 CE2 TYR A 254 -6.589 -5.864 4.815 1.00 98.87 C
+ATOM 4011 HE2 TYR A 254 -6.593 -6.697 5.502 1.00 98.87 H
+ATOM 4012 OH TYR A 254 -6.107 -4.399 6.621 1.00 98.87 O
+ATOM 4013 HH TYR A 254 -5.584 -3.617 6.816 1.00 98.87 H
+ATOM 4014 CZ TYR A 254 -6.316 -4.573 5.301 1.00 98.87 C
+ATOM 4015 N GLY A 255 -9.240 -2.885 1.025 1.00 98.76 N
+ATOM 4016 H GLY A 255 -8.620 -2.704 0.248 1.00 98.76 H
+ATOM 4017 CA GLY A 255 -9.974 -1.744 1.574 1.00 98.76 C
+ATOM 4018 HA2 GLY A 255 -9.700 -1.599 2.619 1.00 98.76 H
+ATOM 4019 HA3 GLY A 255 -9.703 -0.848 1.015 1.00 98.76 H
+ATOM 4020 C GLY A 255 -11.490 -1.928 1.487 1.00 98.76 C
+ATOM 4021 O GLY A 255 -12.191 -1.696 2.470 1.00 98.76 O
+ATOM 4022 N LEU A 256 -11.998 -2.436 0.357 1.00 98.80 N
+ATOM 4023 H LEU A 256 -11.366 -2.612 -0.410 1.00 98.80 H
+ATOM 4024 CA LEU A 256 -13.418 -2.759 0.176 1.00 98.80 C
+ATOM 4025 HA LEU A 256 -14.014 -1.862 0.340 1.00 98.80 H
+ATOM 4026 C LEU A 256 -13.893 -3.791 1.207 1.00 98.80 C
+ATOM 4027 CB LEU A 256 -13.664 -3.272 -1.257 1.00 98.80 C
+ATOM 4028 HB2 LEU A 256 -12.980 -4.097 -1.456 1.00 98.80 H
+ATOM 4029 HB3 LEU A 256 -14.677 -3.672 -1.311 1.00 98.80 H
+ATOM 4030 O LEU A 256 -14.932 -3.592 1.838 1.00 98.80 O
+ATOM 4031 CG LEU A 256 -13.507 -2.225 -2.376 1.00 98.80 C
+ATOM 4032 HG LEU A 256 -12.531 -1.745 -2.312 1.00 98.80 H
+ATOM 4033 CD1 LEU A 256 -13.624 -2.909 -3.738 1.00 98.80 C
+ATOM 4034 HD11 LEU A 256 -13.489 -2.172 -4.530 1.00 98.80 H
+ATOM 4035 HD12 LEU A 256 -14.604 -3.374 -3.845 1.00 98.80 H
+ATOM 4036 HD13 LEU A 256 -12.848 -3.668 -3.838 1.00 98.80 H
+ATOM 4037 CD2 LEU A 256 -14.567 -1.132 -2.291 1.00 98.80 C
+ATOM 4038 HD21 LEU A 256 -15.567 -1.567 -2.283 1.00 98.80 H
+ATOM 4039 HD22 LEU A 256 -14.408 -0.541 -1.389 1.00 98.80 H
+ATOM 4040 HD23 LEU A 256 -14.477 -0.464 -3.147 1.00 98.80 H
+ATOM 4041 N MET A 257 -13.115 -4.853 1.442 1.00 98.83 N
+ATOM 4042 H MET A 257 -12.275 -4.962 0.890 1.00 98.83 H
+ATOM 4043 CA MET A 257 -13.438 -5.858 2.461 1.00 98.83 C
+ATOM 4044 HA MET A 257 -14.449 -6.223 2.280 1.00 98.83 H
+ATOM 4045 C MET A 257 -13.412 -5.278 3.882 1.00 98.83 C
+ATOM 4046 CB MET A 257 -12.475 -7.048 2.379 1.00 98.83 C
+ATOM 4047 HB2 MET A 257 -11.446 -6.702 2.475 1.00 98.83 H
+ATOM 4048 HB3 MET A 257 -12.693 -7.709 3.218 1.00 98.83 H
+ATOM 4049 O MET A 257 -14.295 -5.587 4.685 1.00 98.83 O
+ATOM 4050 CG MET A 257 -12.614 -7.856 1.088 1.00 98.83 C
+ATOM 4051 HG2 MET A 257 -12.331 -7.231 0.241 1.00 98.83 H
+ATOM 4052 HG3 MET A 257 -13.655 -8.149 0.952 1.00 98.83 H
+ATOM 4053 SD MET A 257 -11.579 -9.344 1.068 1.00 98.83 S
+ATOM 4054 CE MET A 257 -12.599 -10.455 2.063 1.00 98.83 C
+ATOM 4055 HE1 MET A 257 -12.789 -10.016 3.043 1.00 98.83 H
+ATOM 4056 HE2 MET A 257 -12.067 -11.399 2.184 1.00 98.83 H
+ATOM 4057 HE3 MET A 257 -13.546 -10.634 1.553 1.00 98.83 H
+ATOM 4058 N ILE A 258 -12.438 -4.422 4.204 1.00 98.85 N
+ATOM 4059 H ILE A 258 -11.736 -4.221 3.507 1.00 98.85 H
+ATOM 4060 CA ILE A 258 -12.347 -3.752 5.510 1.00 98.85 C
+ATOM 4061 HA ILE A 258 -12.414 -4.510 6.291 1.00 98.85 H
+ATOM 4062 C ILE A 258 -13.536 -2.808 5.729 1.00 98.85 C
+ATOM 4063 CB ILE A 258 -10.988 -3.028 5.646 1.00 98.85 C
+ATOM 4064 HB ILE A 258 -10.839 -2.422 4.752 1.00 98.85 H
+ATOM 4065 O ILE A 258 -14.149 -2.843 6.797 1.00 98.85 O
+ATOM 4066 CG1 ILE A 258 -9.808 -4.027 5.730 1.00 98.85 C
+ATOM 4067 HG12 ILE A 258 -8.874 -3.472 5.644 1.00 98.85 H
+ATOM 4068 HG13 ILE A 258 -9.847 -4.714 4.885 1.00 98.85 H
+ATOM 4069 CG2 ILE A 258 -10.961 -2.073 6.853 1.00 98.85 C
+ATOM 4070 HG21 ILE A 258 -9.950 -1.698 7.012 1.00 98.85 H
+ATOM 4071 HG22 ILE A 258 -11.286 -2.593 7.754 1.00 98.85 H
+ATOM 4072 HG23 ILE A 258 -11.613 -1.218 6.672 1.00 98.85 H
+ATOM 4073 CD1 ILE A 258 -9.721 -4.874 7.005 1.00 98.85 C
+ATOM 4074 HD11 ILE A 258 -10.615 -5.488 7.118 1.00 98.85 H
+ATOM 4075 HD12 ILE A 258 -8.855 -5.533 6.937 1.00 98.85 H
+ATOM 4076 HD13 ILE A 258 -9.593 -4.233 7.877 1.00 98.85 H
+ATOM 4077 N THR A 259 -13.911 -2.005 4.730 1.00 98.80 N
+ATOM 4078 H THR A 259 -13.346 -1.975 3.894 1.00 98.80 H
+ATOM 4079 CA THR A 259 -15.082 -1.118 4.801 1.00 98.80 C
+ATOM 4080 HA THR A 259 -15.007 -0.524 5.712 1.00 98.80 H
+ATOM 4081 C THR A 259 -16.386 -1.908 4.901 1.00 98.80 C
+ATOM 4082 CB THR A 259 -15.096 -0.140 3.617 1.00 98.80 C
+ATOM 4083 HB THR A 259 -14.934 -0.682 2.686 1.00 98.80 H
+ATOM 4084 O THR A 259 -17.233 -1.551 5.719 1.00 98.80 O
+ATOM 4085 CG2 THR A 259 -16.374 0.689 3.505 1.00 98.80 C
+ATOM 4086 HG21 THR A 259 -17.202 0.048 3.203 1.00 98.80 H
+ATOM 4087 HG22 THR A 259 -16.609 1.160 4.460 1.00 98.80 H
+ATOM 4088 HG23 THR A 259 -16.247 1.457 2.742 1.00 98.80 H
+ATOM 4089 OG1 THR A 259 -14.066 0.797 3.807 1.00 98.80 O
+ATOM 4090 HG1 THR A 259 -14.407 1.486 4.382 1.00 98.80 H
+ATOM 4091 N TYR A 260 -16.535 -3.018 4.172 1.00 98.71 N
+ATOM 4092 H TYR A 260 -15.833 -3.252 3.484 1.00 98.71 H
+ATOM 4093 CA TYR A 260 -17.677 -3.923 4.333 1.00 98.71 C
+ATOM 4094 HA TYR A 260 -18.595 -3.380 4.110 1.00 98.71 H
+ATOM 4095 C TYR A 260 -17.794 -4.436 5.776 1.00 98.71 C
+ATOM 4096 CB TYR A 260 -17.558 -5.091 3.344 1.00 98.71 C
+ATOM 4097 HB2 TYR A 260 -17.762 -4.726 2.337 1.00 98.71 H
+ATOM 4098 HB3 TYR A 260 -16.537 -5.472 3.353 1.00 98.71 H
+ATOM 4099 O TYR A 260 -18.839 -4.282 6.409 1.00 98.71 O
+ATOM 4100 CG TYR A 260 -18.507 -6.229 3.661 1.00 98.71 C
+ATOM 4101 CD1 TYR A 260 -18.014 -7.437 4.188 1.00 98.71 C
+ATOM 4102 HD1 TYR A 260 -16.947 -7.560 4.303 1.00 98.71 H
+ATOM 4103 CD2 TYR A 260 -19.892 -6.044 3.508 1.00 98.71 C
+ATOM 4104 HD2 TYR A 260 -20.282 -5.109 3.134 1.00 98.71 H
+ATOM 4105 CE1 TYR A 260 -18.903 -8.479 4.525 1.00 98.71 C
+ATOM 4106 HE1 TYR A 260 -18.529 -9.430 4.875 1.00 98.71 H
+ATOM 4107 CE2 TYR A 260 -20.781 -7.063 3.889 1.00 98.71 C
+ATOM 4108 HE2 TYR A 260 -21.847 -6.899 3.839 1.00 98.71 H
+ATOM 4109 OH TYR A 260 -21.165 -9.284 4.689 1.00 98.71 O
+ATOM 4110 HH TYR A 260 -20.742 -10.099 4.969 1.00 98.71 H
+ATOM 4111 CZ TYR A 260 -20.293 -8.292 4.373 1.00 98.71 C
+ATOM 4112 N ILE A 261 -16.700 -4.967 6.336 1.00 98.75 N
+ATOM 4113 H ILE A 261 -15.870 -5.053 5.767 1.00 98.75 H
+ATOM 4114 CA ILE A 261 -16.654 -5.425 7.731 1.00 98.75 C
+ATOM 4115 HA ILE A 261 -17.413 -6.196 7.862 1.00 98.75 H
+ATOM 4116 C ILE A 261 -17.009 -4.281 8.694 1.00 98.75 C
+ATOM 4117 CB ILE A 261 -15.265 -6.036 8.034 1.00 98.75 C
+ATOM 4118 HB ILE A 261 -14.501 -5.355 7.658 1.00 98.75 H
+ATOM 4119 O ILE A 261 -17.748 -4.490 9.657 1.00 98.75 O
+ATOM 4120 CG1 ILE A 261 -15.112 -7.392 7.308 1.00 98.75 C
+ATOM 4121 HG12 ILE A 261 -15.797 -8.120 7.743 1.00 98.75 H
+ATOM 4122 HG13 ILE A 261 -15.386 -7.275 6.259 1.00 98.75 H
+ATOM 4123 CG2 ILE A 261 -15.033 -6.202 9.546 1.00 98.75 C
+ATOM 4124 HG21 ILE A 261 -15.807 -6.830 9.987 1.00 98.75 H
+ATOM 4125 HG22 ILE A 261 -14.052 -6.638 9.734 1.00 98.75 H
+ATOM 4126 HG23 ILE A 261 -15.046 -5.224 10.026 1.00 98.75 H
+ATOM 4127 CD1 ILE A 261 -13.688 -7.958 7.351 1.00 98.75 C
+ATOM 4128 HD11 ILE A 261 -13.611 -8.799 6.662 1.00 98.75 H
+ATOM 4129 HD12 ILE A 261 -13.462 -8.319 8.354 1.00 98.75 H
+ATOM 4130 HD13 ILE A 261 -12.970 -7.192 7.057 1.00 98.75 H
+ATOM 4131 N ALA A 262 -16.510 -3.069 8.445 1.00 98.78 N
+ATOM 4132 H ALA A 262 -15.891 -2.958 7.655 1.00 98.78 H
+ATOM 4133 CA ALA A 262 -16.774 -1.905 9.282 1.00 98.78 C
+ATOM 4134 HA ALA A 262 -16.505 -2.155 10.308 1.00 98.78 H
+ATOM 4135 C ALA A 262 -18.262 -1.505 9.283 1.00 98.78 C
+ATOM 4136 CB ALA A 262 -15.868 -0.757 8.822 1.00 98.78 C
+ATOM 4137 HB1 ALA A 262 -15.971 0.088 9.502 1.00 98.78 H
+ATOM 4138 HB2 ALA A 262 -14.827 -1.081 8.822 1.00 98.78 H
+ATOM 4139 HB3 ALA A 262 -16.143 -0.435 7.818 1.00 98.78 H
+ATOM 4140 O ALA A 262 -18.817 -1.260 10.357 1.00 98.78 O
+ATOM 4141 N ILE A 263 -18.929 -1.470 8.123 1.00 98.64 N
+ATOM 4142 H ILE A 263 -18.423 -1.681 7.275 1.00 98.64 H
+ATOM 4143 CA ILE A 263 -20.371 -1.172 8.020 1.00 98.64 C
+ATOM 4144 HA ILE A 263 -20.584 -0.244 8.551 1.00 98.64 H
+ATOM 4145 C ILE A 263 -21.194 -2.282 8.675 1.00 98.64 C
+ATOM 4146 CB ILE A 263 -20.811 -0.991 6.551 1.00 98.64 C
+ATOM 4147 HB ILE A 263 -20.559 -1.902 6.009 1.00 98.64 H
+ATOM 4148 O ILE A 263 -22.074 -1.990 9.482 1.00 98.64 O
+ATOM 4149 CG1 ILE A 263 -20.087 0.199 5.898 1.00 98.64 C
+ATOM 4150 HG12 ILE A 263 -19.015 0.125 6.080 1.00 98.64 H
+ATOM 4151 HG13 ILE A 263 -20.436 1.139 6.326 1.00 98.64 H
+ATOM 4152 CG2 ILE A 263 -22.330 -0.756 6.437 1.00 98.64 C
+ATOM 4153 HG21 ILE A 263 -22.613 0.155 6.964 1.00 98.64 H
+ATOM 4154 HG22 ILE A 263 -22.627 -0.665 5.392 1.00 98.64 H
+ATOM 4155 HG23 ILE A 263 -22.889 -1.594 6.853 1.00 98.64 H
+ATOM 4156 CD1 ILE A 263 -20.292 0.219 4.385 1.00 98.64 C
+ATOM 4157 HD11 ILE A 263 -21.176 0.802 4.126 1.00 98.64 H
+ATOM 4158 HD12 ILE A 263 -20.393 -0.794 3.993 1.00 98.64 H
+ATOM 4159 HD13 ILE A 263 -19.399 0.651 3.933 1.00 98.64 H
+ATOM 4160 N GLN A 264 -20.874 -3.547 8.398 1.00 98.42 N
+ATOM 4161 H GLN A 264 -20.159 -3.729 7.708 1.00 98.42 H
+ATOM 4162 CA GLN A 264 -21.605 -4.692 8.940 1.00 98.42 C
+ATOM 4163 HA GLN A 264 -22.652 -4.602 8.649 1.00 98.42 H
+ATOM 4164 C GLN A 264 -21.546 -4.727 10.474 1.00 98.42 C
+ATOM 4165 CB GLN A 264 -21.028 -5.971 8.316 1.00 98.42 C
+ATOM 4166 HB2 GLN A 264 -20.013 -6.118 8.686 1.00 98.42 H
+ATOM 4167 HB3 GLN A 264 -20.967 -5.851 7.234 1.00 98.42 H
+ATOM 4168 O GLN A 264 -22.573 -4.859 11.143 1.00 98.42 O
+ATOM 4169 CG GLN A 264 -21.875 -7.215 8.624 1.00 98.42 C
+ATOM 4170 HG2 GLN A 264 -21.366 -8.094 8.228 1.00 98.42 H
+ATOM 4171 HG3 GLN A 264 -21.975 -7.336 9.702 1.00 98.42 H
+ATOM 4172 CD GLN A 264 -23.255 -7.152 7.978 1.00 98.42 C
+ATOM 4173 NE2 GLN A 264 -24.279 -7.685 8.602 1.00 98.42 N
+ATOM 4174 HE21 GLN A 264 -25.148 -7.662 8.088 1.00 98.42 H
+ATOM 4175 HE22 GLN A 264 -24.128 -8.297 9.391 1.00 98.42 H
+ATOM 4176 OE1 GLN A 264 -23.438 -6.608 6.906 1.00 98.42 O
+ATOM 4177 N GLN A 265 -20.359 -4.519 11.057 1.00 98.59 N
+ATOM 4178 H GLN A 265 -19.539 -4.434 10.474 1.00 98.59 H
+ATOM 4179 CA GLN A 265 -20.218 -4.409 12.510 1.00 98.59 C
+ATOM 4180 HA GLN A 265 -20.726 -5.259 12.966 1.00 98.59 H
+ATOM 4181 C GLN A 265 -20.880 -3.145 13.075 1.00 98.59 C
+ATOM 4182 CB GLN A 265 -18.741 -4.445 12.918 1.00 98.59 C
+ATOM 4183 HB2 GLN A 265 -18.183 -3.680 12.378 1.00 98.59 H
+ATOM 4184 HB3 GLN A 265 -18.685 -4.223 13.984 1.00 98.59 H
+ATOM 4185 O GLN A 265 -21.345 -3.165 14.213 1.00 98.59 O
+ATOM 4186 CG GLN A 265 -18.096 -5.816 12.696 1.00 98.59 C
+ATOM 4187 HG2 GLN A 265 -18.747 -6.596 13.090 1.00 98.59 H
+ATOM 4188 HG3 GLN A 265 -17.959 -6.003 11.631 1.00 98.59 H
+ATOM 4189 CD GLN A 265 -16.756 -5.915 13.405 1.00 98.59 C
+ATOM 4190 NE2 GLN A 265 -15.687 -5.489 12.775 1.00 98.59 N
+ATOM 4191 HE21 GLN A 265 -14.798 -5.610 13.239 1.00 98.59 H
+ATOM 4192 HE22 GLN A 265 -15.764 -5.172 11.820 1.00 98.59 H
+ATOM 4193 OE1 GLN A 265 -16.670 -6.340 14.549 1.00 98.59 O
+ATOM 4194 N SER A 266 -20.937 -2.050 12.309 1.00 98.66 N
+ATOM 4195 H SER A 266 -20.542 -2.097 11.381 1.00 98.66 H
+ATOM 4196 CA SER A 266 -21.649 -0.827 12.705 1.00 98.66 C
+ATOM 4197 HA SER A 266 -21.303 -0.517 13.691 1.00 98.66 H
+ATOM 4198 C SER A 266 -23.157 -1.061 12.799 1.00 98.66 C
+ATOM 4199 CB SER A 266 -21.380 0.318 11.722 1.00 98.66 C
+ATOM 4200 HB2 SER A 266 -21.704 0.048 10.717 1.00 98.66 H
+ATOM 4201 HB3 SER A 266 -21.946 1.196 12.033 1.00 98.66 H
+ATOM 4202 O SER A 266 -23.769 -0.678 13.794 1.00 98.66 O
+ATOM 4203 OG SER A 266 -20.006 0.641 11.702 1.00 98.66 O
+ATOM 4204 HG SER A 266 -19.561 -0.068 11.232 1.00 98.66 H
+ATOM 4205 N ALA A 267 -23.748 -1.727 11.805 1.00 98.30 N
+ATOM 4206 H ALA A 267 -23.193 -2.007 11.009 1.00 98.30 H
+ATOM 4207 CA ALA A 267 -25.173 -2.049 11.778 1.00 98.30 C
+ATOM 4208 HA ALA A 267 -25.743 -1.132 11.925 1.00 98.30 H
+ATOM 4209 C ALA A 267 -25.558 -3.023 12.900 1.00 98.30 C
+ATOM 4210 CB ALA A 267 -25.512 -2.622 10.399 1.00 98.30 C
+ATOM 4211 HB1 ALA A 267 -24.931 -3.525 10.210 1.00 98.30 H
+ATOM 4212 HB2 ALA A 267 -26.573 -2.870 10.352 1.00 98.30 H
+ATOM 4213 HB3 ALA A 267 -25.291 -1.890 9.623 1.00 98.30 H
+ATOM 4214 O ALA A 267 -26.532 -2.781 13.618 1.00 98.30 O
+ATOM 4215 N ALA A 268 -24.750 -4.070 13.105 1.00 97.98 N
+ATOM 4216 H ALA A 268 -24.005 -4.237 12.444 1.00 97.98 H
+ATOM 4217 CA ALA A 268 -24.930 -5.033 14.192 1.00 97.98 C
+ATOM 4218 HA ALA A 268 -25.937 -5.444 14.131 1.00 97.98 H
+ATOM 4219 C ALA A 268 -24.778 -4.398 15.589 1.00 97.98 C
+ATOM 4220 CB ALA A 268 -23.927 -6.171 13.981 1.00 97.98 C
+ATOM 4221 HB1 ALA A 268 -22.911 -5.778 14.020 1.00 97.98 H
+ATOM 4222 HB2 ALA A 268 -24.063 -6.922 14.759 1.00 97.98 H
+ATOM 4223 HB3 ALA A 268 -24.096 -6.634 13.009 1.00 97.98 H
+ATOM 4224 O ALA A 268 -25.391 -4.862 16.545 1.00 97.98 O
+ATOM 4225 N ALA A 269 -24.002 -3.315 15.707 1.00 98.01 N
+ATOM 4226 H ALA A 269 -23.476 -3.016 14.898 1.00 98.01 H
+ATOM 4227 CA ALA A 269 -23.871 -2.519 16.928 1.00 98.01 C
+ATOM 4228 HA ALA A 269 -24.003 -3.181 17.784 1.00 98.01 H
+ATOM 4229 C ALA A 269 -24.936 -1.409 17.073 1.00 98.01 C
+ATOM 4230 CB ALA A 269 -22.444 -1.959 16.990 1.00 98.01 C
+ATOM 4231 HB1 ALA A 269 -22.283 -1.270 16.161 1.00 98.01 H
+ATOM 4232 HB2 ALA A 269 -21.723 -2.774 16.929 1.00 98.01 H
+ATOM 4233 HB3 ALA A 269 -22.300 -1.428 17.931 1.00 98.01 H
+ATOM 4234 O ALA A 269 -24.838 -0.596 17.990 1.00 98.01 O
+ATOM 4235 N GLY A 270 -25.935 -1.343 16.184 1.00 97.72 N
+ATOM 4236 H GLY A 270 -25.969 -2.029 15.443 1.00 97.72 H
+ATOM 4237 CA GLY A 270 -27.052 -0.398 16.290 1.00 97.72 C
+ATOM 4238 HA2 GLY A 270 -27.926 -0.844 15.816 1.00 97.72 H
+ATOM 4239 HA3 GLY A 270 -27.293 -0.241 17.342 1.00 97.72 H
+ATOM 4240 C GLY A 270 -26.828 0.978 15.654 1.00 97.72 C
+ATOM 4241 O GLY A 270 -27.584 1.906 15.934 1.00 97.72 O
+ATOM 4242 N TYR A 271 -25.811 1.159 14.805 1.00 98.27 N
+ATOM 4243 H TYR A 271 -25.206 0.379 14.589 1.00 98.27 H
+ATOM 4244 CA TYR A 271 -25.603 2.433 14.109 1.00 98.27 C
+ATOM 4245 HA TYR A 271 -25.781 3.233 14.827 1.00 98.27 H
+ATOM 4246 C TYR A 271 -26.612 2.600 12.962 1.00 98.27 C
+ATOM 4247 CB TYR A 271 -24.148 2.550 13.635 1.00 98.27 C
+ATOM 4248 HB2 TYR A 271 -23.973 1.804 12.861 1.00 98.27 H
+ATOM 4249 HB3 TYR A 271 -23.495 2.319 14.477 1.00 98.27 H
+ATOM 4250 O TYR A 271 -26.452 2.010 11.894 1.00 98.27 O
+ATOM 4251 CG TYR A 271 -23.763 3.922 13.105 1.00 98.27 C
+ATOM 4252 CD1 TYR A 271 -23.240 4.069 11.804 1.00 98.27 C
+ATOM 4253 HD1 TYR A 271 -23.107 3.207 11.166 1.00 98.27 H
+ATOM 4254 CD2 TYR A 271 -23.917 5.061 13.921 1.00 98.27 C
+ATOM 4255 HD2 TYR A 271 -24.314 4.959 14.921 1.00 98.27 H
+ATOM 4256 CE1 TYR A 271 -22.873 5.339 11.324 1.00 98.27 C
+ATOM 4257 HE1 TYR A 271 -22.477 5.463 10.327 1.00 98.27 H
+ATOM 4258 CE2 TYR A 271 -23.581 6.338 13.433 1.00 98.27 C
+ATOM 4259 HE2 TYR A 271 -23.731 7.209 14.054 1.00 98.27 H
+ATOM 4260 OH TYR A 271 -22.707 7.702 11.665 1.00 98.27 O
+ATOM 4261 HH TYR A 271 -23.147 8.415 12.134 1.00 98.27 H
+ATOM 4262 CZ TYR A 271 -23.053 6.476 12.133 1.00 98.27 C
+ATOM 4263 N VAL A 272 -27.641 3.425 13.180 1.00 97.94 N
+ATOM 4264 H VAL A 272 -27.760 3.766 14.123 1.00 97.94 H
+ATOM 4265 CA VAL A 272 -28.771 3.624 12.249 1.00 97.94 C
+ATOM 4266 HA VAL A 272 -29.312 2.679 12.189 1.00 97.94 H
+ATOM 4267 C VAL A 272 -28.341 3.953 10.807 1.00 97.94 C
+ATOM 4268 CB VAL A 272 -29.765 4.671 12.800 1.00 97.94 C
+ATOM 4269 HB VAL A 272 -29.246 5.609 12.996 1.00 97.94 H
+ATOM 4270 O VAL A 272 -28.866 3.312 9.896 1.00 97.94 O
+ATOM 4271 CG1 VAL A 272 -30.913 4.962 11.826 1.00 97.94 C
+ATOM 4272 HG11 VAL A 272 -31.631 5.640 12.288 1.00 97.94 H
+ATOM 4273 HG12 VAL A 272 -31.420 4.035 11.560 1.00 97.94 H
+ATOM 4274 HG13 VAL A 272 -30.536 5.440 10.921 1.00 97.94 H
+ATOM 4275 CG2 VAL A 272 -30.372 4.195 14.125 1.00 97.94 C
+ATOM 4276 HG21 VAL A 272 -30.892 3.248 13.976 1.00 97.94 H
+ATOM 4277 HG22 VAL A 272 -31.084 4.933 14.495 1.00 97.94 H
+ATOM 4278 HG23 VAL A 272 -29.599 4.058 14.882 1.00 97.94 H
+ATOM 4279 N PRO A 273 -27.357 4.843 10.543 1.00 98.25 N
+ATOM 4280 CA PRO A 273 -26.907 5.092 9.171 1.00 98.25 C
+ATOM 4281 HA PRO A 273 -27.751 5.474 8.596 1.00 98.25 H
+ATOM 4282 C PRO A 273 -26.363 3.842 8.460 1.00 98.25 C
+ATOM 4283 CB PRO A 273 -25.843 6.191 9.276 1.00 98.25 C
+ATOM 4284 HB2 PRO A 273 -25.854 6.846 8.406 1.00 98.25 H
+ATOM 4285 HB3 PRO A 273 -24.855 5.751 9.407 1.00 98.25 H
+ATOM 4286 O PRO A 273 -26.581 3.681 7.262 1.00 98.25 O
+ATOM 4287 CG PRO A 273 -26.245 6.935 10.547 1.00 98.25 C
+ATOM 4288 HG2 PRO A 273 -25.410 7.482 10.986 1.00 98.25 H
+ATOM 4289 HG3 PRO A 273 -27.072 7.610 10.330 1.00 98.25 H
+ATOM 4290 CD PRO A 273 -26.730 5.801 11.446 1.00 98.25 C
+ATOM 4291 HD2 PRO A 273 -25.879 5.329 11.937 1.00 98.25 H
+ATOM 4292 HD3 PRO A 273 -27.422 6.197 12.189 1.00 98.25 H
+ATOM 4293 N ALA A 274 -25.701 2.927 9.182 1.00 98.20 N
+ATOM 4294 H ALA A 274 -25.639 3.048 10.182 1.00 98.20 H
+ATOM 4295 CA ALA A 274 -25.248 1.653 8.615 1.00 98.20 C
+ATOM 4296 HA ALA A 274 -24.689 1.848 7.699 1.00 98.20 H
+ATOM 4297 C ALA A 274 -26.427 0.738 8.263 1.00 98.20 C
+ATOM 4298 CB ALA A 274 -24.327 0.925 9.602 1.00 98.20 C
+ATOM 4299 HB1 ALA A 274 -24.883 0.624 10.490 1.00 98.20 H
+ATOM 4300 HB2 ALA A 274 -23.493 1.557 9.905 1.00 98.20 H
+ATOM 4301 HB3 ALA A 274 -23.925 0.033 9.121 1.00 98.20 H
+ATOM 4302 O ALA A 274 -26.442 0.137 7.193 1.00 98.20 O
+ATOM 4303 N GLN A 275 -27.422 0.646 9.151 1.00 97.51 N
+ATOM 4304 H GLN A 275 -27.363 1.197 9.995 1.00 97.51 H
+ATOM 4305 CA GLN A 275 -28.618 -0.177 8.940 1.00 97.51 C
+ATOM 4306 HA GLN A 275 -28.321 -1.209 8.751 1.00 97.51 H
+ATOM 4307 C GLN A 275 -29.407 0.299 7.718 1.00 97.51 C
+ATOM 4308 CB GLN A 275 -29.506 -0.139 10.191 1.00 97.51 C
+ATOM 4309 HB2 GLN A 275 -30.439 -0.663 9.980 1.00 97.51 H
+ATOM 4310 HB3 GLN A 275 -29.744 0.896 10.433 1.00 97.51 H
+ATOM 4311 O GLN A 275 -29.746 -0.504 6.858 1.00 97.51 O
+ATOM 4312 CG GLN A 275 -28.834 -0.811 11.396 1.00 97.51 C
+ATOM 4313 HG2 GLN A 275 -28.702 -1.871 11.180 1.00 97.51 H
+ATOM 4314 HG3 GLN A 275 -27.853 -0.368 11.570 1.00 97.51 H
+ATOM 4315 CD GLN A 275 -29.633 -0.666 12.683 1.00 97.51 C
+ATOM 4316 NE2 GLN A 275 -29.323 -1.451 13.691 1.00 97.51 N
+ATOM 4317 HE21 GLN A 275 -28.563 -2.111 13.613 1.00 97.51 H
+ATOM 4318 HE22 GLN A 275 -29.873 -1.321 14.528 1.00 97.51 H
+ATOM 4319 OE1 GLN A 275 -30.504 0.172 12.839 1.00 97.51 O
+ATOM 4320 N GLN A 276 -29.609 1.613 7.583 1.00 97.25 N
+ATOM 4321 H GLN A 276 -29.312 2.223 8.331 1.00 97.25 H
+ATOM 4322 CA GLN A 276 -30.246 2.208 6.404 1.00 97.25 C
+ATOM 4323 HA GLN A 276 -31.246 1.792 6.283 1.00 97.25 H
+ATOM 4324 C GLN A 276 -29.461 1.910 5.119 1.00 97.25 C
+ATOM 4325 CB GLN A 276 -30.348 3.726 6.603 1.00 97.25 C
+ATOM 4326 HB2 GLN A 276 -30.648 4.188 5.662 1.00 97.25 H
+ATOM 4327 HB3 GLN A 276 -29.367 4.113 6.876 1.00 97.25 H
+ATOM 4328 O GLN A 276 -30.051 1.561 4.096 1.00 97.25 O
+ATOM 4329 CG GLN A 276 -31.374 4.117 7.677 1.00 97.25 C
+ATOM 4330 HG2 GLN A 276 -32.367 3.817 7.343 1.00 97.25 H
+ATOM 4331 HG3 GLN A 276 -31.161 3.598 8.612 1.00 97.25 H
+ATOM 4332 CD GLN A 276 -31.379 5.617 7.960 1.00 97.25 C
+ATOM 4333 NE2 GLN A 276 -32.396 6.123 8.621 1.00 97.25 N
+ATOM 4334 HE21 GLN A 276 -33.173 5.541 8.899 1.00 97.25 H
+ATOM 4335 HE22 GLN A 276 -32.381 7.123 8.761 1.00 97.25 H
+ATOM 4336 OE1 GLN A 276 -30.475 6.360 7.617 1.00 97.25 O
+ATOM 4337 N ALA A 277 -28.129 2.019 5.170 1.00 97.31 N
+ATOM 4338 H ALA A 277 -27.698 2.336 6.026 1.00 97.31 H
+ATOM 4339 CA ALA A 277 -27.269 1.766 4.020 1.00 97.31 C
+ATOM 4340 HA ALA A 277 -27.647 2.357 3.186 1.00 97.31 H
+ATOM 4341 C ALA A 277 -27.257 0.298 3.572 1.00 97.31 C
+ATOM 4342 CB ALA A 277 -25.856 2.251 4.342 1.00 97.31 C
+ATOM 4343 HB1 ALA A 277 -25.899 3.307 4.605 1.00 97.31 H
+ATOM 4344 HB2 ALA A 277 -25.446 1.686 5.179 1.00 97.31 H
+ATOM 4345 HB3 ALA A 277 -25.211 2.122 3.473 1.00 97.31 H
+ATOM 4346 O ALA A 277 -27.193 0.061 2.367 1.00 97.31 O
+ATOM 4347 N LEU A 278 -27.325 -0.660 4.504 1.00 97.00 N
+ATOM 4348 H LEU A 278 -27.314 -0.382 5.474 1.00 97.00 H
+ATOM 4349 CA LEU A 278 -27.431 -2.093 4.199 1.00 97.00 C
+ATOM 4350 HA LEU A 278 -26.791 -2.328 3.349 1.00 97.00 H
+ATOM 4351 C LEU A 278 -28.856 -2.501 3.794 1.00 97.00 C
+ATOM 4352 CB LEU A 278 -26.961 -2.925 5.406 1.00 97.00 C
+ATOM 4353 HB2 LEU A 278 -27.541 -2.628 6.280 1.00 97.00 H
+ATOM 4354 HB3 LEU A 278 -27.189 -3.972 5.204 1.00 97.00 H
+ATOM 4355 O LEU A 278 -29.024 -3.306 2.880 1.00 97.00 O
+ATOM 4356 CG LEU A 278 -25.463 -2.820 5.742 1.00 97.00 C
+ATOM 4357 HG LEU A 278 -25.219 -1.794 6.017 1.00 97.00 H
+ATOM 4358 CD1 LEU A 278 -25.167 -3.725 6.936 1.00 97.00 C
+ATOM 4359 HD11 LEU A 278 -25.823 -3.462 7.765 1.00 97.00 H
+ATOM 4360 HD12 LEU A 278 -24.127 -3.612 7.240 1.00 97.00 H
+ATOM 4361 HD13 LEU A 278 -25.346 -4.765 6.662 1.00 97.00 H
+ATOM 4362 CD2 LEU A 278 -24.549 -3.238 4.589 1.00 97.00 C
+ATOM 4363 HD21 LEU A 278 -24.824 -4.232 4.235 1.00 97.00 H
+ATOM 4364 HD22 LEU A 278 -23.513 -3.264 4.926 1.00 97.00 H
+ATOM 4365 HD23 LEU A 278 -24.628 -2.523 3.770 1.00 97.00 H
+ATOM 4366 N GLY A 279 -29.881 -1.918 4.422 1.00 95.63 N
+ATOM 4367 H GLY A 279 -29.685 -1.317 5.210 1.00 95.63 H
+ATOM 4368 CA GLY A 279 -31.288 -2.186 4.115 1.00 95.63 C
+ATOM 4369 HA2 GLY A 279 -31.500 -3.244 4.264 1.00 95.63 H
+ATOM 4370 HA3 GLY A 279 -31.917 -1.608 4.792 1.00 95.63 H
+ATOM 4371 C GLY A 279 -31.653 -1.817 2.677 1.00 95.63 C
+ATOM 4372 O GLY A 279 -32.261 -2.617 1.973 1.00 95.63 O
+ATOM 4373 N ARG A 280 -31.185 -0.661 2.182 1.00 95.61 N
+ATOM 4374 H ARG A 280 -30.704 -0.039 2.816 1.00 95.61 H
+ATOM 4375 CA ARG A 280 -31.434 -0.219 0.792 1.00 95.61 C
+ATOM 4376 HA ARG A 280 -32.503 -0.320 0.601 1.00 95.61 H
+ATOM 4377 C ARG A 280 -30.764 -1.080 -0.292 1.00 95.61 C
+ATOM 4378 CB ARG A 280 -31.068 1.266 0.626 1.00 95.61 C
+ATOM 4379 HB2 ARG A 280 -31.421 1.611 -0.345 1.00 95.61 H
+ATOM 4380 HB3 ARG A 280 -31.565 1.851 1.400 1.00 95.61 H
+ATOM 4381 O ARG A 280 -31.092 -0.912 -1.460 1.00 95.61 O
+ATOM 4382 CG ARG A 280 -29.555 1.480 0.712 1.00 95.61 C
+ATOM 4383 HG2 ARG A 280 -29.226 1.154 1.699 1.00 95.61 H
+ATOM 4384 HG3 ARG A 280 -29.059 0.884 -0.054 1.00 95.61 H
+ATOM 4385 CD ARG A 280 -29.134 2.932 0.519 1.00 95.61 C
+ATOM 4386 HD2 ARG A 280 -29.589 3.536 1.304 1.00 95.61 H
+ATOM 4387 HD3 ARG A 280 -29.489 3.273 -0.454 1.00 95.61 H
+ATOM 4388 NE ARG A 280 -27.664 3.038 0.583 1.00 95.61 N
+ATOM 4389 HE ARG A 280 -27.169 2.170 0.727 1.00 95.61 H
+ATOM 4390 NH1 ARG A 280 -27.521 5.310 0.318 1.00 95.61 N
+ATOM 4391 HH11 ARG A 280 -26.968 6.149 0.212 1.00 95.61 H
+ATOM 4392 HH12 ARG A 280 -28.527 5.344 0.237 1.00 95.61 H
+ATOM 4393 NH2 ARG A 280 -25.659 4.102 0.585 1.00 95.61 N
+ATOM 4394 HH21 ARG A 280 -25.202 3.211 0.714 1.00 95.61 H
+ATOM 4395 HH22 ARG A 280 -25.122 4.957 0.606 1.00 95.61 H
+ATOM 4396 CZ ARG A 280 -26.957 4.147 0.493 1.00 95.61 C
+ATOM 4397 N ILE A 281 -29.815 -1.949 0.071 1.00 95.10 N
+ATOM 4398 H ILE A 281 -29.610 -2.036 1.056 1.00 95.10 H
+ATOM 4399 CA ILE A 281 -29.127 -2.874 -0.851 1.00 95.10 C
+ATOM 4400 HA ILE A 281 -29.504 -2.697 -1.859 1.00 95.10 H
+ATOM 4401 C ILE A 281 -29.466 -4.350 -0.576 1.00 95.10 C
+ATOM 4402 CB ILE A 281 -27.599 -2.625 -0.904 1.00 95.10 C
+ATOM 4403 HB ILE A 281 -27.171 -3.335 -1.612 1.00 95.10 H
+ATOM 4404 O ILE A 281 -28.821 -5.234 -1.130 1.00 95.10 O
+ATOM 4405 CG1 ILE A 281 -26.939 -2.865 0.469 1.00 95.10 C
+ATOM 4406 HG12 ILE A 281 -27.198 -3.863 0.822 1.00 95.10 H
+ATOM 4407 HG13 ILE A 281 -27.340 -2.143 1.181 1.00 95.10 H
+ATOM 4408 CG2 ILE A 281 -27.283 -1.217 -1.441 1.00 95.10 C
+ATOM 4409 HG21 ILE A 281 -26.238 -1.169 -1.748 1.00 95.10 H
+ATOM 4410 HG22 ILE A 281 -27.462 -0.473 -0.665 1.00 95.10 H
+ATOM 4411 HG23 ILE A 281 -27.906 -1.006 -2.310 1.00 95.10 H
+ATOM 4412 CD1 ILE A 281 -25.412 -2.748 0.470 1.00 95.10 C
+ATOM 4413 HD11 ILE A 281 -25.107 -1.723 0.260 1.00 95.10 H
+ATOM 4414 HD12 ILE A 281 -24.990 -3.420 -0.278 1.00 95.10 H
+ATOM 4415 HD13 ILE A 281 -25.032 -3.032 1.452 1.00 95.10 H
+ATOM 4416 N GLY A 282 -30.458 -4.632 0.280 1.00 88.27 N
+ATOM 4417 H GLY A 282 -30.974 -3.871 0.697 1.00 88.27 H
+ATOM 4418 CA GLY A 282 -30.922 -5.998 0.550 1.00 88.27 C
+ATOM 4419 HA2 GLY A 282 -31.889 -5.942 1.049 1.00 88.27 H
+ATOM 4420 HA3 GLY A 282 -31.059 -6.524 -0.395 1.00 88.27 H
+ATOM 4421 C GLY A 282 -29.992 -6.842 1.430 1.00 88.27 C
+ATOM 4422 O GLY A 282 -30.054 -8.065 1.374 1.00 88.27 O
+ATOM 4423 N MET A 283 -29.130 -6.217 2.240 1.00 78.05 N
+ATOM 4424 H MET A 283 -29.124 -5.207 2.235 1.00 78.05 H
+ATOM 4425 CA MET A 283 -28.188 -6.912 3.137 1.00 78.05 C
+ATOM 4426 HA MET A 283 -28.163 -7.967 2.866 1.00 78.05 H
+ATOM 4427 C MET A 283 -28.605 -6.891 4.618 1.00 78.05 C
+ATOM 4428 CB MET A 283 -26.765 -6.368 2.940 1.00 78.05 C
+ATOM 4429 HB2 MET A 283 -26.105 -6.830 3.674 1.00 78.05 H
+ATOM 4430 HB3 MET A 283 -26.758 -5.290 3.101 1.00 78.05 H
+ATOM 4431 O MET A 283 -27.836 -7.314 5.483 1.00 78.05 O
+ATOM 4432 CG MET A 283 -26.214 -6.677 1.545 1.00 78.05 C
+ATOM 4433 HG2 MET A 283 -26.380 -7.730 1.318 1.00 78.05 H
+ATOM 4434 HG3 MET A 283 -26.766 -6.091 0.810 1.00 78.05 H
+ATOM 4435 SD MET A 283 -24.445 -6.317 1.361 1.00 78.05 S
+ATOM 4436 CE MET A 283 -23.766 -7.760 2.219 1.00 78.05 C
+ATOM 4437 HE1 MET A 283 -22.694 -7.822 2.030 1.00 78.05 H
+ATOM 4438 HE2 MET A 283 -23.954 -7.683 3.290 1.00 78.05 H
+ATOM 4439 HE3 MET A 283 -24.237 -8.666 1.837 1.00 78.05 H
+ATOM 4440 N ASP A 284 -29.809 -6.408 4.940 1.00 68.30 N
+ATOM 4441 H ASP A 284 -30.433 -6.123 4.199 1.00 68.30 H
+ATOM 4442 CA ASP A 284 -30.335 -6.495 6.302 1.00 68.30 C
+ATOM 4443 HA ASP A 284 -29.515 -6.288 6.990 1.00 68.30 H
+ATOM 4444 C ASP A 284 -30.848 -7.914 6.597 1.00 68.30 C
+ATOM 4445 CB ASP A 284 -31.398 -5.415 6.568 1.00 68.30 C
+ATOM 4446 HB2 ASP A 284 -31.012 -4.459 6.215 1.00 68.30 H
+ATOM 4447 HB3 ASP A 284 -32.306 -5.646 6.011 1.00 68.30 H
+ATOM 4448 O ASP A 284 -31.834 -8.378 6.025 1.00 68.30 O
+ATOM 4449 CG ASP A 284 -31.727 -5.274 8.064 1.00 68.30 C
+ATOM 4450 OD1 ASP A 284 -31.293 -6.143 8.863 1.00 68.30 O
+ATOM 4451 OD2 ASP A 284 -32.394 -4.283 8.420 1.00 68.30 O
+ATOM 4452 N SER A 285 -30.196 -8.595 7.543 1.00 58.16 N
+ATOM 4453 H SER A 285 -29.378 -8.159 7.943 1.00 58.16 H
+ATOM 4454 CA SER A 285 -30.619 -9.900 8.066 1.00 58.16 C
+ATOM 4455 HA SER A 285 -30.599 -10.621 7.249 1.00 58.16 H
+ATOM 4456 C SER A 285 -32.047 -9.912 8.635 1.00 58.16 C
+ATOM 4457 CB SER A 285 -29.627 -10.365 9.139 1.00 58.16 C
+ATOM 4458 HB2 SER A 285 -30.008 -11.264 9.624 1.00 58.16 H
+ATOM 4459 HB3 SER A 285 -28.676 -10.607 8.663 1.00 58.16 H
+ATOM 4460 O SER A 285 -32.627 -10.988 8.764 1.00 58.16 O
+ATOM 4461 OG SER A 285 -29.405 -9.354 10.112 1.00 58.16 O
+ATOM 4462 HG SER A 285 -30.046 -8.652 9.975 1.00 58.16 H
+ATOM 4463 N LYS A 286 -32.637 -8.749 8.961 1.00 53.98 N
+ATOM 4464 H LYS A 286 -32.122 -7.889 8.831 1.00 53.98 H
+ATOM 4465 CA LYS A 286 -34.031 -8.652 9.426 1.00 53.98 C
+ATOM 4466 HA LYS A 286 -34.251 -9.508 10.064 1.00 53.98 H
+ATOM 4467 C LYS A 286 -35.065 -8.737 8.298 1.00 53.98 C
+ATOM 4468 CB LYS A 286 -34.226 -7.379 10.259 1.00 53.98 C
+ATOM 4469 HB2 LYS A 286 -35.294 -7.245 10.428 1.00 53.98 H
+ATOM 4470 HB3 LYS A 286 -33.860 -6.511 9.709 1.00 53.98 H
+ATOM 4471 O LYS A 286 -36.120 -9.324 8.515 1.00 53.98 O
+ATOM 4472 CG LYS A 286 -33.524 -7.483 11.620 1.00 53.98 C
+ATOM 4473 HG2 LYS A 286 -32.444 -7.525 11.480 1.00 53.98 H
+ATOM 4474 HG3 LYS A 286 -33.856 -8.390 12.126 1.00 53.98 H
+ATOM 4475 CD LYS A 286 -33.885 -6.268 12.476 1.00 53.98 C
+ATOM 4476 HD2 LYS A 286 -33.494 -5.371 11.997 1.00 53.98 H
+ATOM 4477 HD3 LYS A 286 -34.971 -6.192 12.534 1.00 53.98 H
+ATOM 4478 CE LYS A 286 -33.307 -6.411 13.885 1.00 53.98 C
+ATOM 4479 HE2 LYS A 286 -33.640 -7.364 14.297 1.00 53.98 H
+ATOM 4480 HE3 LYS A 286 -32.220 -6.428 13.814 1.00 53.98 H
+ATOM 4481 NZ LYS A 286 -33.767 -5.292 14.740 1.00 53.98 N
+ATOM 4482 HZ1 LYS A 286 -33.402 -5.377 15.678 1.00 53.98 H
+ATOM 4483 HZ2 LYS A 286 -34.776 -5.293 14.778 1.00 53.98 H
+ATOM 4484 HZ3 LYS A 286 -33.478 -4.412 14.336 1.00 53.98 H
+ATOM 4485 N ALA A 287 -34.751 -8.278 7.084 1.00 46.81 N
+ATOM 4486 H ALA A 287 -33.840 -7.868 6.934 1.00 46.81 H
+ATOM 4487 CA ALA A 287 -35.664 -8.390 5.938 1.00 46.81 C
+ATOM 4488 HA ALA A 287 -36.648 -8.030 6.238 1.00 46.81 H
+ATOM 4489 C ALA A 287 -35.840 -9.848 5.461 1.00 46.81 C
+ATOM 4490 CB ALA A 287 -35.147 -7.480 4.818 1.00 46.81 C
+ATOM 4491 HB1 ALA A 287 -34.163 -7.812 4.487 1.00 46.81 H
+ATOM 4492 HB2 ALA A 287 -35.082 -6.452 5.177 1.00 46.81 H
+ATOM 4493 HB3 ALA A 287 -35.838 -7.514 3.976 1.00 46.81 H
+ATOM 4494 O ALA A 287 -36.889 -10.215 4.935 1.00 46.81 O
+ATOM 4495 N ALA A 288 -34.845 -10.708 5.710 1.00 43.13 N
+ATOM 4496 H ALA A 288 -33.991 -10.345 6.109 1.00 43.13 H
+ATOM 4497 CA ALA A 288 -34.927 -12.143 5.433 1.00 43.13 C
+ATOM 4498 HA ALA A 288 -35.341 -12.282 4.434 1.00 43.13 H
+ATOM 4499 C ALA A 288 -35.849 -12.908 6.409 1.00 43.13 C
+ATOM 4500 CB ALA A 288 -33.501 -12.708 5.442 1.00 43.13 C
+ATOM 4501 HB1 ALA A 288 -32.888 -12.181 4.711 1.00 43.13 H
+ATOM 4502 HB2 ALA A 288 -33.062 -12.597 6.434 1.00 43.13 H
+ATOM 4503 HB3 ALA A 288 -33.530 -13.766 5.182 1.00 43.13 H
+ATOM 4504 O ALA A 288 -36.315 -13.996 6.079 1.00 43.13 O
+ATOM 4505 N LEU A 289 -36.130 -12.346 7.592 1.00 44.15 N
+ATOM 4506 H LEU A 289 -35.753 -11.430 7.788 1.00 44.15 H
+ATOM 4507 CA LEU A 289 -37.014 -12.947 8.598 1.00 44.15 C
+ATOM 4508 HA LEU A 289 -37.020 -14.029 8.467 1.00 44.15 H
+ATOM 4509 C LEU A 289 -38.478 -12.507 8.429 1.00 44.15 C
+ATOM 4510 CB LEU A 289 -36.458 -12.634 10.001 1.00 44.15 C
+ATOM 4511 HB2 LEU A 289 -37.243 -12.788 10.741 1.00 44.15 H
+ATOM 4512 HB3 LEU A 289 -36.178 -11.582 10.037 1.00 44.15 H
+ATOM 4513 O LEU A 289 -39.377 -13.295 8.703 1.00 44.15 O
+ATOM 4514 CG LEU A 289 -35.246 -13.513 10.374 1.00 44.15 C
+ATOM 4515 HG LEU A 289 -34.600 -13.641 9.505 1.00 44.15 H
+ATOM 4516 CD1 LEU A 289 -34.419 -12.851 11.478 1.00 44.15 C
+ATOM 4517 HD11 LEU A 289 -34.040 -11.896 11.116 1.00 44.15 H
+ATOM 4518 HD12 LEU A 289 -33.574 -13.489 11.734 1.00 44.15 H
+ATOM 4519 HD13 LEU A 289 -35.040 -12.690 12.359 1.00 44.15 H
+ATOM 4520 CD2 LEU A 289 -35.687 -14.890 10.877 1.00 44.15 C
+ATOM 4521 HD21 LEU A 289 -36.314 -14.786 11.762 1.00 44.15 H
+ATOM 4522 HD22 LEU A 289 -34.813 -15.495 11.118 1.00 44.15 H
+ATOM 4523 HD23 LEU A 289 -36.258 -15.402 10.101 1.00 44.15 H
+ATOM 4524 N GLU A 290 -38.741 -11.302 7.915 1.00 46.47 N
+ATOM 4525 H GLU A 290 -37.978 -10.656 7.770 1.00 46.47 H
+ATOM 4526 CA GLU A 290 -40.113 -10.820 7.670 1.00 46.47 C
+ATOM 4527 HA GLU A 290 -40.755 -11.159 8.484 1.00 46.47 H
+ATOM 4528 C GLU A 290 -40.739 -11.403 6.388 1.00 46.47 C
+ATOM 4529 CB GLU A 290 -40.136 -9.282 7.689 1.00 46.47 C
+ATOM 4530 HB2 GLU A 290 -39.339 -8.903 7.050 1.00 46.47 H
+ATOM 4531 HB3 GLU A 290 -41.094 -8.936 7.301 1.00 46.47 H
+ATOM 4532 O GLU A 290 -41.950 -11.617 6.335 1.00 46.47 O
+ATOM 4533 CG GLU A 290 -39.969 -8.752 9.127 1.00 46.47 C
+ATOM 4534 HG2 GLU A 290 -40.788 -9.139 9.733 1.00 46.47 H
+ATOM 4535 HG3 GLU A 290 -39.040 -9.143 9.541 1.00 46.47 H
+ATOM 4536 CD GLU A 290 -39.941 -7.218 9.244 1.00 46.47 C
+ATOM 4537 OE1 GLU A 290 -39.961 -6.737 10.401 1.00 46.47 O
+ATOM 4538 OE2 GLU A 290 -39.841 -6.534 8.200 1.00 46.47 O
+ATOM 4539 N HIS A 291 -39.933 -11.781 5.388 1.00 49.01 N
+ATOM 4540 H HIS A 291 -38.952 -11.549 5.448 1.00 49.01 H
+ATOM 4541 CA HIS A 291 -40.437 -12.419 4.162 1.00 49.01 C
+ATOM 4542 HA HIS A 291 -41.368 -11.918 3.894 1.00 49.01 H
+ATOM 4543 C HIS A 291 -40.820 -13.905 4.315 1.00 49.01 C
+ATOM 4544 CB HIS A 291 -39.448 -12.194 3.006 1.00 49.01 C
+ATOM 4545 HB2 HIS A 291 -38.460 -11.940 3.391 1.00 49.01 H
+ATOM 4546 HB3 HIS A 291 -39.345 -13.112 2.428 1.00 49.01 H
+ATOM 4547 O HIS A 291 -41.509 -14.443 3.450 1.00 49.01 O
+ATOM 4548 CG HIS A 291 -39.922 -11.115 2.069 1.00 49.01 C
+ATOM 4549 CD2 HIS A 291 -39.463 -9.828 1.988 1.00 49.01 C
+ATOM 4550 HD2 HIS A 291 -38.674 -9.398 2.587 1.00 49.01 H
+ATOM 4551 ND1 HIS A 291 -40.948 -11.240 1.160 1.00 49.01 N
+ATOM 4552 HD1 HIS A 291 -41.511 -12.066 1.013 1.00 49.01 H
+ATOM 4553 CE1 HIS A 291 -41.099 -10.059 0.539 1.00 49.01 C
+ATOM 4554 HE1 HIS A 291 -41.836 -9.847 -0.222 1.00 49.01 H
+ATOM 4555 NE2 HIS A 291 -40.209 -9.168 1.003 1.00 49.01 N
+ATOM 4556 N HIS A 292 -40.433 -14.566 5.413 1.00 48.14 N
+ATOM 4557 H HIS A 292 -39.881 -14.072 6.099 1.00 48.14 H
+ATOM 4558 CA HIS A 292 -40.768 -15.974 5.671 1.00 48.14 C
+ATOM 4559 HA HIS A 292 -40.995 -16.444 4.715 1.00 48.14 H
+ATOM 4560 C HIS A 292 -42.045 -16.184 6.506 1.00 48.14 C
+ATOM 4561 CB HIS A 292 -39.542 -16.709 6.245 1.00 48.14 C
+ATOM 4562 HB2 HIS A 292 -39.861 -17.395 7.029 1.00 48.14 H
+ATOM 4563 HB3 HIS A 292 -38.850 -15.999 6.698 1.00 48.14 H
+ATOM 4564 O HIS A 292 -42.485 -17.322 6.652 1.00 48.14 O
+ATOM 4565 CG HIS A 292 -38.825 -17.520 5.194 1.00 48.14 C
+ATOM 4566 CD2 HIS A 292 -37.590 -17.277 4.654 1.00 48.14 C
+ATOM 4567 HD2 HIS A 292 -36.937 -16.457 4.913 1.00 48.14 H
+ATOM 4568 ND1 HIS A 292 -39.325 -18.644 4.575 1.00 48.14 N
+ATOM 4569 HD1 HIS A 292 -40.228 -19.061 4.752 1.00 48.14 H
+ATOM 4570 CE1 HIS A 292 -38.415 -19.068 3.683 1.00 48.14 C
+ATOM 4571 HE1 HIS A 292 -38.531 -19.928 3.040 1.00 48.14 H
+ATOM 4572 NE2 HIS A 292 -37.335 -18.272 3.700 1.00 48.14 N
+ATOM 4573 N HIS A 293 -42.683 -15.116 7.002 1.00 49.54 N
+ATOM 4574 H HIS A 293 -42.277 -14.203 6.854 1.00 49.54 H
+ATOM 4575 CA HIS A 293 -43.890 -15.202 7.840 1.00 49.54 C
+ATOM 4576 HA HIS A 293 -44.036 -16.245 8.119 1.00 49.54 H
+ATOM 4577 C HIS A 293 -45.210 -14.834 7.130 1.00 49.54 C
+ATOM 4578 CB HIS A 293 -43.651 -14.437 9.155 1.00 49.54 C
+ATOM 4579 HB2 HIS A 293 -44.608 -14.188 9.613 1.00 49.54 H
+ATOM 4580 HB3 HIS A 293 -43.130 -13.501 8.952 1.00 49.54 H
+ATOM 4581 O HIS A 293 -46.255 -14.824 7.776 1.00 49.54 O
+ATOM 4582 CG HIS A 293 -42.875 -15.256 10.159 1.00 49.54 C
+ATOM 4583 CD2 HIS A 293 -41.615 -15.018 10.640 1.00 49.54 C
+ATOM 4584 HD2 HIS A 293 -40.981 -14.187 10.367 1.00 49.54 H
+ATOM 4585 ND1 HIS A 293 -43.326 -16.407 10.767 1.00 49.54 N
+ATOM 4586 HD1 HIS A 293 -44.218 -16.851 10.601 1.00 49.54 H
+ATOM 4587 CE1 HIS A 293 -42.361 -16.853 11.587 1.00 49.54 C
+ATOM 4588 HE1 HIS A 293 -42.424 -17.747 12.189 1.00 49.54 H
+ATOM 4589 NE2 HIS A 293 -41.299 -16.035 11.551 1.00 49.54 N
+ATOM 4590 N HIS A 294 -45.203 -14.602 5.810 1.00 47.83 N
+ATOM 4591 H HIS A 294 -44.312 -14.614 5.333 1.00 47.83 H
+ATOM 4592 CA HIS A 294 -46.399 -14.218 5.035 1.00 47.83 C
+ATOM 4593 HA HIS A 294 -47.245 -14.181 5.721 1.00 47.83 H
+ATOM 4594 C HIS A 294 -46.870 -15.239 3.977 1.00 47.83 C
+ATOM 4595 CB HIS A 294 -46.224 -12.786 4.498 1.00 47.83 C
+ATOM 4596 HB2 HIS A 294 -46.885 -12.621 3.646 1.00 47.83 H
+ATOM 4597 HB3 HIS A 294 -45.201 -12.637 4.154 1.00 47.83 H
+ATOM 4598 O HIS A 294 -47.702 -14.912 3.134 1.00 47.83 O
+ATOM 4599 CG HIS A 294 -46.578 -11.750 5.534 1.00 47.83 C
+ATOM 4600 CD2 HIS A 294 -45.740 -10.848 6.135 1.00 47.83 C
+ATOM 4601 HD2 HIS A 294 -44.681 -10.743 5.953 1.00 47.83 H
+ATOM 4602 ND1 HIS A 294 -47.833 -11.555 6.068 1.00 47.83 N
+ATOM 4603 HD1 HIS A 294 -48.659 -12.094 5.849 1.00 47.83 H
+ATOM 4604 CE1 HIS A 294 -47.754 -10.563 6.967 1.00 47.83 C
+ATOM 4605 HE1 HIS A 294 -48.578 -10.194 7.561 1.00 47.83 H
+ATOM 4606 NE2 HIS A 294 -46.501 -10.094 7.037 1.00 47.83 N
+ATOM 4607 N HIS A 295 -46.408 -16.491 4.047 1.00 41.74 N
+ATOM 4608 H HIS A 295 -45.753 -16.720 4.781 1.00 41.74 H
+ATOM 4609 CA HIS A 295 -46.913 -17.593 3.217 1.00 41.74 C
+ATOM 4610 HA HIS A 295 -47.823 -17.277 2.707 1.00 41.74 H
+ATOM 4611 C HIS A 295 -47.323 -18.795 4.083 1.00 41.74 C
+ATOM 4612 CB HIS A 295 -45.882 -17.954 2.132 1.00 41.74 C
+ATOM 4613 HB2 HIS A 295 -46.173 -18.901 1.676 1.00 41.74 H
+ATOM 4614 HB3 HIS A 295 -44.904 -18.095 2.592 1.00 41.74 H
+ATOM 4615 O HIS A 295 -46.617 -19.799 4.131 1.00 41.74 O
+ATOM 4616 CG HIS A 295 -45.780 -16.938 1.021 1.00 41.74 C
+ATOM 4617 CD2 HIS A 295 -44.693 -16.171 0.699 1.00 41.74 C
+ATOM 4618 HD2 HIS A 295 -43.742 -16.172 1.212 1.00 41.74 H
+ATOM 4619 ND1 HIS A 295 -46.771 -16.632 0.117 1.00 41.74 N
+ATOM 4620 HD1 HIS A 295 -47.719 -16.982 0.138 1.00 41.74 H
+ATOM 4621 CE1 HIS A 295 -46.295 -15.702 -0.726 1.00 41.74 C
+ATOM 4622 HE1 HIS A 295 -46.856 -15.245 -1.527 1.00 41.74 H
+ATOM 4623 NE2 HIS A 295 -45.026 -15.394 -0.418 1.00 41.74 N
+ATOM 4624 N HIS A 296 -48.459 -18.673 4.773 1.00 37.36 N
+ATOM 4625 H HIS A 296 -48.976 -17.808 4.720 1.00 37.36 H
+ATOM 4626 CA HIS A 296 -49.227 -19.774 5.363 1.00 37.36 C
+ATOM 4627 HA HIS A 296 -49.089 -20.672 4.761 1.00 37.36 H
+ATOM 4628 C HIS A 296 -50.719 -19.457 5.288 1.00 37.36 C
+ATOM 4629 CB HIS A 296 -48.788 -20.061 6.808 1.00 37.36 C
+ATOM 4630 HB2 HIS A 296 -49.633 -20.484 7.351 1.00 37.36 H
+ATOM 4631 HB3 HIS A 296 -48.508 -19.131 7.302 1.00 37.36 H
+ATOM 4632 O HIS A 296 -51.064 -18.264 5.446 1.00 37.36 O
+ATOM 4633 CG HIS A 296 -47.662 -21.056 6.886 1.00 37.36 C
+ATOM 4634 CD2 HIS A 296 -46.403 -20.856 7.380 1.00 37.36 C
+ATOM 4635 HD2 HIS A 296 -46.027 -19.931 7.790 1.00 37.36 H
+ATOM 4636 ND1 HIS A 296 -47.720 -22.353 6.438 1.00 37.36 N
+ATOM 4637 HD1 HIS A 296 -48.508 -22.754 5.951 1.00 37.36 H
+ATOM 4638 CE1 HIS A 296 -46.522 -22.921 6.652 1.00 37.36 C
+ATOM 4639 HE1 HIS A 296 -46.258 -23.931 6.375 1.00 37.36 H
+ATOM 4640 NE2 HIS A 296 -45.687 -22.055 7.247 1.00 37.36 N
+ATOM 4641 OXT HIS A 296 -51.461 -20.429 5.040 1.00 37.36 O
+TER 4642 HIS A 296
+END
diff --git a/modules/mol/alg/tests/testfiles/6jyf_trg.cif b/modules/mol/alg/tests/testfiles/6jyf_trg.cif
new file mode 100644
index 0000000000000000000000000000000000000000..cb2ec7fa482d436c3944238cfeeb41213c690d87
--- /dev/null
+++ b/modules/mol/alg/tests/testfiles/6jyf_trg.cif
@@ -0,0 +1,4338 @@
+data_6JYF
+#
+_entry.id 6JYF
+#
+_audit_conform.dict_name mmcif_pdbx.dic
+_audit_conform.dict_version 5.323
+_audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic
+#
+loop_
+_database_2.database_id
+_database_2.database_code
+PDB 6JYF
+WWPDB D_1300011511
+#
+_pdbx_database_status.status_code REL
+_pdbx_database_status.status_code_sf REL
+_pdbx_database_status.status_code_mr ?
+_pdbx_database_status.entry_id 6JYF
+_pdbx_database_status.recvd_initial_deposition_date 2019-04-26
+_pdbx_database_status.SG_entry N
+_pdbx_database_status.deposit_site PDBJ
+_pdbx_database_status.process_site PDBJ
+_pdbx_database_status.status_code_cs ?
+_pdbx_database_status.methods_development_category ?
+_pdbx_database_status.pdb_format_compatible Y
+#
+loop_
+_audit_author.name
+_audit_author.pdbx_ordinal
+_audit_author.identifier_ORCID
+'Yun, J.H.' 1 ?
+'Ohki, M.' 2 ?
+'Park, S.Y.' 3 ?
+'Lee, W.' 4 ?
+#
+_citation.abstract ?
+_citation.abstract_id_CAS ?
+_citation.book_id_ISBN ?
+_citation.book_publisher ?
+_citation.book_publisher_city ?
+_citation.book_title ?
+_citation.coordinate_linkage ?
+_citation.country US
+_citation.database_id_Medline ?
+_citation.details ?
+_citation.id primary
+_citation.journal_abbrev 'Sci Adv'
+_citation.journal_id_ASTM ?
+_citation.journal_id_CSD ?
+_citation.journal_id_ISSN 2375-2548
+_citation.journal_full ?
+_citation.journal_issue ?
+_citation.journal_volume 6
+_citation.language ?
+_citation.page_first eaay2042
+_citation.page_last eaay2042
+_citation.title
+'Pumping mechanism of NM-R3, a light-driven bacterial chloride importer in the rhodopsin family.'
+_citation.year 2020
+_citation.database_id_CSD ?
+_citation.pdbx_database_id_DOI 10.1126/sciadv.aay2042
+_citation.pdbx_database_id_PubMed 32083178
+_citation.unpublished_flag ?
+#
+loop_
+_citation_author.citation_id
+_citation_author.name
+_citation_author.ordinal
+_citation_author.identifier_ORCID
+primary 'Yun, J.H.' 1 0000-0001-7570-369X
+primary 'Ohki, M.' 2 0000-0002-7653-7782
+primary 'Park, J.H.' 3 0000-0001-5690-9705
+primary 'Ishimoto, N.' 4 0000-0001-8976-8582
+primary 'Sato-Tomita, A.' 5 0000-0002-1173-1058
+primary 'Lee, W.' 6 ?
+primary 'Jin, Z.' 7 0000-0002-6478-2967
+primary 'Tame, J.R.H.' 8 0000-0002-9341-7280
+primary 'Shibayama, N.' 9 0000-0002-2208-1126
+primary 'Park, S.Y.' 10 0000-0001-6164-8896
+primary 'Lee, W.' 11 0000-0003-2347-1262
+#
+_cell.angle_alpha 90.00
+_cell.angle_alpha_esd ?
+_cell.angle_beta 109.98
+_cell.angle_beta_esd ?
+_cell.angle_gamma 90.00
+_cell.angle_gamma_esd ?
+_cell.entry_id 6JYF
+_cell.details ?
+_cell.formula_units_Z ?
+_cell.length_a 102.918
+_cell.length_a_esd ?
+_cell.length_b 49.289
+_cell.length_b_esd ?
+_cell.length_c 69.466
+_cell.length_c_esd ?
+_cell.volume ?
+_cell.volume_esd ?
+_cell.Z_PDB 4
+_cell.reciprocal_angle_alpha ?
+_cell.reciprocal_angle_beta ?
+_cell.reciprocal_angle_gamma ?
+_cell.reciprocal_angle_alpha_esd ?
+_cell.reciprocal_angle_beta_esd ?
+_cell.reciprocal_angle_gamma_esd ?
+_cell.reciprocal_length_a ?
+_cell.reciprocal_length_b ?
+_cell.reciprocal_length_c ?
+_cell.reciprocal_length_a_esd ?
+_cell.reciprocal_length_b_esd ?
+_cell.reciprocal_length_c_esd ?
+_cell.pdbx_unique_axis ?
+#
+_symmetry.entry_id 6JYF
+_symmetry.cell_setting ?
+_symmetry.Int_Tables_number 5
+_symmetry.space_group_name_Hall ?
+_symmetry.space_group_name_H-M 'C 1 2 1'
+_symmetry.pdbx_full_space_group_name_H-M ?
+#
+loop_
+_entity.id
+_entity.type
+_entity.src_method
+_entity.pdbx_description
+_entity.formula_weight
+_entity.pdbx_number_of_molecules
+_entity.pdbx_ec
+_entity.pdbx_mutation
+_entity.pdbx_fragment
+_entity.details
+1 polymer man 'Chloride pumping rhodopsin' 32913.434 1 ? ? ? ?
+2 non-polymer syn RETINAL 284.436 1 ? ? ? ?
+3 non-polymer syn 'CHLORIDE ION' 35.453 2 ? ? ? ?
+4 non-polymer nat 'OLEIC ACID' 282.461 11 ? ? ? ?
+5 water nat water 18.015 85 ? ? ? ?
+#
+_entity_poly.entity_id 1
+_entity_poly.type 'polypeptide(L)'
+_entity_poly.nstd_linkage no
+_entity_poly.nstd_monomer no
+_entity_poly.pdbx_seq_one_letter_code
+;MASMTGGQQMGRDPNSMKNIESLFDYSAGQFEFIDHLLTMGVGVHFAALIFFLVVSQFVAPKYRIATALSCIVMVSAGLI
+LNSQAVMWTDAYAYVDGSYQLQDLTFSNGYRYVNWMATIPCLLLQLLIVLNLKGKELFSTATWLILAAWGMIITGYVGQL
+YEVDDIAQLMIWGAVSTAFFVVMNWIVGTKIFKNRATMLGGTDSTITKVFWLMMFAWTLYPIAYLVPAFMNNADGVVLRQ
+LLFTIADISSKVIYGLMITYIAIQQSAAAGYVPAQQALGRIGMDSKAALEHHHHHH
+;
+_entity_poly.pdbx_seq_one_letter_code_can
+;MASMTGGQQMGRDPNSMKNIESLFDYSAGQFEFIDHLLTMGVGVHFAALIFFLVVSQFVAPKYRIATALSCIVMVSAGLI
+LNSQAVMWTDAYAYVDGSYQLQDLTFSNGYRYVNWMATIPCLLLQLLIVLNLKGKELFSTATWLILAAWGMIITGYVGQL
+YEVDDIAQLMIWGAVSTAFFVVMNWIVGTKIFKNRATMLGGTDSTITKVFWLMMFAWTLYPIAYLVPAFMNNADGVVLRQ
+LLFTIADISSKVIYGLMITYIAIQQSAAAGYVPAQQALGRIGMDSKAALEHHHHHH
+;
+_entity_poly.pdbx_strand_id A
+_entity_poly.pdbx_target_identifier ?
+#
+loop_
+_entity_poly_seq.entity_id
+_entity_poly_seq.num
+_entity_poly_seq.mon_id
+_entity_poly_seq.hetero
+1 1 MET n
+1 2 ALA n
+1 3 SER n
+1 4 MET n
+1 5 THR n
+1 6 GLY n
+1 7 GLY n
+1 8 GLN n
+1 9 GLN n
+1 10 MET n
+1 11 GLY n
+1 12 ARG n
+1 13 ASP n
+1 14 PRO n
+1 15 ASN n
+1 16 SER n
+1 17 MET n
+1 18 LYS n
+1 19 ASN n
+1 20 ILE n
+1 21 GLU n
+1 22 SER n
+1 23 LEU n
+1 24 PHE n
+1 25 ASP n
+1 26 TYR n
+1 27 SER n
+1 28 ALA n
+1 29 GLY n
+1 30 GLN n
+1 31 PHE n
+1 32 GLU n
+1 33 PHE n
+1 34 ILE n
+1 35 ASP n
+1 36 HIS n
+1 37 LEU n
+1 38 LEU n
+1 39 THR n
+1 40 MET n
+1 41 GLY n
+1 42 VAL n
+1 43 GLY n
+1 44 VAL n
+1 45 HIS n
+1 46 PHE n
+1 47 ALA n
+1 48 ALA n
+1 49 LEU n
+1 50 ILE n
+1 51 PHE n
+1 52 PHE n
+1 53 LEU n
+1 54 VAL n
+1 55 VAL n
+1 56 SER n
+1 57 GLN n
+1 58 PHE n
+1 59 VAL n
+1 60 ALA n
+1 61 PRO n
+1 62 LYS n
+1 63 TYR n
+1 64 ARG n
+1 65 ILE n
+1 66 ALA n
+1 67 THR n
+1 68 ALA n
+1 69 LEU n
+1 70 SER n
+1 71 CYS n
+1 72 ILE n
+1 73 VAL n
+1 74 MET n
+1 75 VAL n
+1 76 SER n
+1 77 ALA n
+1 78 GLY n
+1 79 LEU n
+1 80 ILE n
+1 81 LEU n
+1 82 ASN n
+1 83 SER n
+1 84 GLN n
+1 85 ALA n
+1 86 VAL n
+1 87 MET n
+1 88 TRP n
+1 89 THR n
+1 90 ASP n
+1 91 ALA n
+1 92 TYR n
+1 93 ALA n
+1 94 TYR n
+1 95 VAL n
+1 96 ASP n
+1 97 GLY n
+1 98 SER n
+1 99 TYR n
+1 100 GLN n
+1 101 LEU n
+1 102 GLN n
+1 103 ASP n
+1 104 LEU n
+1 105 THR n
+1 106 PHE n
+1 107 SER n
+1 108 ASN n
+1 109 GLY n
+1 110 TYR n
+1 111 ARG n
+1 112 TYR n
+1 113 VAL n
+1 114 ASN n
+1 115 TRP n
+1 116 MET n
+1 117 ALA n
+1 118 THR n
+1 119 ILE n
+1 120 PRO n
+1 121 CYS n
+1 122 LEU n
+1 123 LEU n
+1 124 LEU n
+1 125 GLN n
+1 126 LEU n
+1 127 LEU n
+1 128 ILE n
+1 129 VAL n
+1 130 LEU n
+1 131 ASN n
+1 132 LEU n
+1 133 LYS n
+1 134 GLY n
+1 135 LYS n
+1 136 GLU n
+1 137 LEU n
+1 138 PHE n
+1 139 SER n
+1 140 THR n
+1 141 ALA n
+1 142 THR n
+1 143 TRP n
+1 144 LEU n
+1 145 ILE n
+1 146 LEU n
+1 147 ALA n
+1 148 ALA n
+1 149 TRP n
+1 150 GLY n
+1 151 MET n
+1 152 ILE n
+1 153 ILE n
+1 154 THR n
+1 155 GLY n
+1 156 TYR n
+1 157 VAL n
+1 158 GLY n
+1 159 GLN n
+1 160 LEU n
+1 161 TYR n
+1 162 GLU n
+1 163 VAL n
+1 164 ASP n
+1 165 ASP n
+1 166 ILE n
+1 167 ALA n
+1 168 GLN n
+1 169 LEU n
+1 170 MET n
+1 171 ILE n
+1 172 TRP n
+1 173 GLY n
+1 174 ALA n
+1 175 VAL n
+1 176 SER n
+1 177 THR n
+1 178 ALA n
+1 179 PHE n
+1 180 PHE n
+1 181 VAL n
+1 182 VAL n
+1 183 MET n
+1 184 ASN n
+1 185 TRP n
+1 186 ILE n
+1 187 VAL n
+1 188 GLY n
+1 189 THR n
+1 190 LYS n
+1 191 ILE n
+1 192 PHE n
+1 193 LYS n
+1 194 ASN n
+1 195 ARG n
+1 196 ALA n
+1 197 THR n
+1 198 MET n
+1 199 LEU n
+1 200 GLY n
+1 201 GLY n
+1 202 THR n
+1 203 ASP n
+1 204 SER n
+1 205 THR n
+1 206 ILE n
+1 207 THR n
+1 208 LYS n
+1 209 VAL n
+1 210 PHE n
+1 211 TRP n
+1 212 LEU n
+1 213 MET n
+1 214 MET n
+1 215 PHE n
+1 216 ALA n
+1 217 TRP n
+1 218 THR n
+1 219 LEU n
+1 220 TYR n
+1 221 PRO n
+1 222 ILE n
+1 223 ALA n
+1 224 TYR n
+1 225 LEU n
+1 226 VAL n
+1 227 PRO n
+1 228 ALA n
+1 229 PHE n
+1 230 MET n
+1 231 ASN n
+1 232 ASN n
+1 233 ALA n
+1 234 ASP n
+1 235 GLY n
+1 236 VAL n
+1 237 VAL n
+1 238 LEU n
+1 239 ARG n
+1 240 GLN n
+1 241 LEU n
+1 242 LEU n
+1 243 PHE n
+1 244 THR n
+1 245 ILE n
+1 246 ALA n
+1 247 ASP n
+1 248 ILE n
+1 249 SER n
+1 250 SER n
+1 251 LYS n
+1 252 VAL n
+1 253 ILE n
+1 254 TYR n
+1 255 GLY n
+1 256 LEU n
+1 257 MET n
+1 258 ILE n
+1 259 THR n
+1 260 TYR n
+1 261 ILE n
+1 262 ALA n
+1 263 ILE n
+1 264 GLN n
+1 265 GLN n
+1 266 SER n
+1 267 ALA n
+1 268 ALA n
+1 269 ALA n
+1 270 GLY n
+1 271 TYR n
+1 272 VAL n
+1 273 PRO n
+1 274 ALA n
+1 275 GLN n
+1 276 GLN n
+1 277 ALA n
+1 278 LEU n
+1 279 GLY n
+1 280 ARG n
+1 281 ILE n
+1 282 GLY n
+1 283 MET n
+1 284 ASP n
+1 285 SER n
+1 286 LYS n
+1 287 ALA n
+1 288 ALA n
+1 289 LEU n
+1 290 GLU n
+1 291 HIS n
+1 292 HIS n
+1 293 HIS n
+1 294 HIS n
+1 295 HIS n
+1 296 HIS n
+#
+_entity_src_gen.entity_id 1
+_entity_src_gen.pdbx_src_id 1
+_entity_src_gen.pdbx_alt_source_flag sample
+_entity_src_gen.pdbx_seq_type 'Biological sequence'
+_entity_src_gen.pdbx_beg_seq_num 1
+_entity_src_gen.pdbx_end_seq_num 296
+_entity_src_gen.gene_src_common_name ?
+_entity_src_gen.gene_src_genus ?
+_entity_src_gen.pdbx_gene_src_gene 'ClR, NMS_1267'
+_entity_src_gen.gene_src_species ?
+_entity_src_gen.gene_src_strain S1-08
+_entity_src_gen.gene_src_tissue ?
+_entity_src_gen.gene_src_tissue_fraction ?
+_entity_src_gen.gene_src_details ?
+_entity_src_gen.pdbx_gene_src_fragment ?
+_entity_src_gen.pdbx_gene_src_scientific_name 'Nonlabens marinus S1-08'
+_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1454201
+_entity_src_gen.pdbx_gene_src_variant ?
+_entity_src_gen.pdbx_gene_src_cell_line ?
+_entity_src_gen.pdbx_gene_src_atcc ?
+_entity_src_gen.pdbx_gene_src_organ ?
+_entity_src_gen.pdbx_gene_src_organelle ?
+_entity_src_gen.pdbx_gene_src_cell ?
+_entity_src_gen.pdbx_gene_src_cellular_location ?
+_entity_src_gen.host_org_common_name ?
+_entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)'
+_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008
+_entity_src_gen.host_org_genus ?
+_entity_src_gen.pdbx_host_org_gene ?
+_entity_src_gen.pdbx_host_org_organ ?
+_entity_src_gen.host_org_species ?
+_entity_src_gen.pdbx_host_org_tissue ?
+_entity_src_gen.pdbx_host_org_tissue_fraction ?
+_entity_src_gen.pdbx_host_org_strain 'BL21(DE3)'
+_entity_src_gen.pdbx_host_org_variant ?
+_entity_src_gen.pdbx_host_org_cell_line ?
+_entity_src_gen.pdbx_host_org_atcc ?
+_entity_src_gen.pdbx_host_org_culture_collection ?
+_entity_src_gen.pdbx_host_org_cell ?
+_entity_src_gen.pdbx_host_org_organelle ?
+_entity_src_gen.pdbx_host_org_cellular_location ?
+_entity_src_gen.pdbx_host_org_vector_type ?
+_entity_src_gen.pdbx_host_org_vector ?
+_entity_src_gen.host_org_details ?
+_entity_src_gen.expression_system_id ?
+_entity_src_gen.plasmid_name ?
+_entity_src_gen.plasmid_details ?
+_entity_src_gen.pdbx_description ?
+#
+_struct_ref.id 1
+_struct_ref.db_name UNP
+_struct_ref.db_code W8VZW3_9FLAO
+_struct_ref.pdbx_db_accession W8VZW3
+_struct_ref.pdbx_db_isoform ?
+_struct_ref.entity_id 1
+_struct_ref.pdbx_seq_one_letter_code
+;MKNIESLFDYSAGQFEFIDHLLTMGVGVHFAALIFFLVVSQFVAPKYRIATALSCIVMVSAGLILNSQAVMWTDAYAYVD
+GSYQLQDLTFSNGYRYVNWMATIPCLLLQLLIVLNLKGKELFSTATWLILAAWGMIITGYVGQLYEVDDIAQLMIWGAVS
+TAFFVVMNWIVGTKIFKNRATMLGGTDSTITKVFWLMMFAWTLYPIAYLVPAFMNNADGVVLRQLLFTIADISSKVIYGL
+MITYIAIQQSAAAGYVPAQQALGRIGMDSKAA
+;
+_struct_ref.pdbx_align_begin 1
+#
+_struct_ref_seq.align_id 1
+_struct_ref_seq.ref_id 1
+_struct_ref_seq.pdbx_PDB_id_code 6JYF
+_struct_ref_seq.pdbx_strand_id A
+_struct_ref_seq.seq_align_beg 17
+_struct_ref_seq.pdbx_seq_align_beg_ins_code ?
+_struct_ref_seq.seq_align_end 288
+_struct_ref_seq.pdbx_seq_align_end_ins_code ?
+_struct_ref_seq.pdbx_db_accession W8VZW3
+_struct_ref_seq.db_align_beg 1
+_struct_ref_seq.pdbx_db_align_beg_ins_code ?
+_struct_ref_seq.db_align_end 272
+_struct_ref_seq.pdbx_db_align_end_ins_code ?
+_struct_ref_seq.pdbx_auth_seq_align_beg 1
+_struct_ref_seq.pdbx_auth_seq_align_end 272
+#
+loop_
+_struct_ref_seq_dif.align_id
+_struct_ref_seq_dif.pdbx_pdb_id_code
+_struct_ref_seq_dif.mon_id
+_struct_ref_seq_dif.pdbx_pdb_strand_id
+_struct_ref_seq_dif.seq_num
+_struct_ref_seq_dif.pdbx_pdb_ins_code
+_struct_ref_seq_dif.pdbx_seq_db_name
+_struct_ref_seq_dif.pdbx_seq_db_accession_code
+_struct_ref_seq_dif.db_mon_id
+_struct_ref_seq_dif.pdbx_seq_db_seq_num
+_struct_ref_seq_dif.details
+_struct_ref_seq_dif.pdbx_auth_seq_num
+_struct_ref_seq_dif.pdbx_ordinal
+1 6JYF MET A 1 ? UNP W8VZW3 ? ? 'expression tag' -15 1
+1 6JYF ALA A 2 ? UNP W8VZW3 ? ? 'expression tag' -14 2
+1 6JYF SER A 3 ? UNP W8VZW3 ? ? 'expression tag' -13 3
+1 6JYF MET A 4 ? UNP W8VZW3 ? ? 'expression tag' -12 4
+1 6JYF THR A 5 ? UNP W8VZW3 ? ? 'expression tag' -11 5
+1 6JYF GLY A 6 ? UNP W8VZW3 ? ? 'expression tag' -10 6
+1 6JYF GLY A 7 ? UNP W8VZW3 ? ? 'expression tag' -9 7
+1 6JYF GLN A 8 ? UNP W8VZW3 ? ? 'expression tag' -8 8
+1 6JYF GLN A 9 ? UNP W8VZW3 ? ? 'expression tag' -7 9
+1 6JYF MET A 10 ? UNP W8VZW3 ? ? 'expression tag' -6 10
+1 6JYF GLY A 11 ? UNP W8VZW3 ? ? 'expression tag' -5 11
+1 6JYF ARG A 12 ? UNP W8VZW3 ? ? 'expression tag' -4 12
+1 6JYF ASP A 13 ? UNP W8VZW3 ? ? 'expression tag' -3 13
+1 6JYF PRO A 14 ? UNP W8VZW3 ? ? 'expression tag' -2 14
+1 6JYF ASN A 15 ? UNP W8VZW3 ? ? 'expression tag' -1 15
+1 6JYF SER A 16 ? UNP W8VZW3 ? ? 'expression tag' 0 16
+1 6JYF LEU A 289 ? UNP W8VZW3 ? ? 'expression tag' 273 17
+1 6JYF GLU A 290 ? UNP W8VZW3 ? ? 'expression tag' 274 18
+1 6JYF HIS A 291 ? UNP W8VZW3 ? ? 'expression tag' 275 19
+1 6JYF HIS A 292 ? UNP W8VZW3 ? ? 'expression tag' 276 20
+1 6JYF HIS A 293 ? UNP W8VZW3 ? ? 'expression tag' 277 21
+1 6JYF HIS A 294 ? UNP W8VZW3 ? ? 'expression tag' 278 22
+1 6JYF HIS A 295 ? UNP W8VZW3 ? ? 'expression tag' 279 23
+1 6JYF HIS A 296 ? UNP W8VZW3 ? ? 'expression tag' 280 24
+#
+loop_
+_chem_comp.id
+_chem_comp.type
+_chem_comp.mon_nstd_flag
+_chem_comp.name
+_chem_comp.pdbx_synonyms
+_chem_comp.formula
+_chem_comp.formula_weight
+ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093
+ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209
+ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118
+ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103
+CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453
+CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158
+GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144
+GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129
+GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067
+HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162
+HOH non-polymer . WATER ? 'H2 O' 18.015
+ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173
+LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173
+LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195
+MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211
+OLA non-polymer . 'OLEIC ACID' ? 'C18 H34 O2' 282.461
+PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189
+PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130
+RET non-polymer . RETINAL ? 'C20 H28 O' 284.436
+SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093
+THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119
+TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225
+TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189
+VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146
+#
+_exptl.absorpt_coefficient_mu ?
+_exptl.absorpt_correction_T_max ?
+_exptl.absorpt_correction_T_min ?
+_exptl.absorpt_correction_type ?
+_exptl.absorpt_process_details ?
+_exptl.entry_id 6JYF
+_exptl.crystals_number 1
+_exptl.details ?
+_exptl.method 'X-RAY DIFFRACTION'
+_exptl.method_details ?
+#
+_exptl_crystal.colour ?
+_exptl_crystal.density_diffrn ?
+_exptl_crystal.density_Matthews 2.52
+_exptl_crystal.density_method ?
+_exptl_crystal.density_percent_sol 51.10
+_exptl_crystal.description ?
+_exptl_crystal.F_000 ?
+_exptl_crystal.id 1
+_exptl_crystal.preparation ?
+_exptl_crystal.size_max ?
+_exptl_crystal.size_mid ?
+_exptl_crystal.size_min ?
+_exptl_crystal.size_rad ?
+_exptl_crystal.colour_lustre ?
+_exptl_crystal.colour_modifier ?
+_exptl_crystal.colour_primary ?
+_exptl_crystal.density_meas ?
+_exptl_crystal.density_meas_esd ?
+_exptl_crystal.density_meas_gt ?
+_exptl_crystal.density_meas_lt ?
+_exptl_crystal.density_meas_temp ?
+_exptl_crystal.density_meas_temp_esd ?
+_exptl_crystal.density_meas_temp_gt ?
+_exptl_crystal.density_meas_temp_lt ?
+_exptl_crystal.pdbx_crystal_image_url ?
+_exptl_crystal.pdbx_crystal_image_format ?
+_exptl_crystal.pdbx_mosaicity ?
+_exptl_crystal.pdbx_mosaicity_esd ?
+#
+_exptl_crystal_grow.apparatus ?
+_exptl_crystal_grow.atmosphere ?
+_exptl_crystal_grow.crystal_id 1
+_exptl_crystal_grow.details ?
+_exptl_crystal_grow.method 'LIPIDIC CUBIC PHASE'
+_exptl_crystal_grow.method_ref ?
+_exptl_crystal_grow.pH ?
+_exptl_crystal_grow.pressure ?
+_exptl_crystal_grow.pressure_esd ?
+_exptl_crystal_grow.seeding ?
+_exptl_crystal_grow.seeding_ref ?
+_exptl_crystal_grow.temp 293
+_exptl_crystal_grow.temp_details ?
+_exptl_crystal_grow.temp_esd ?
+_exptl_crystal_grow.time ?
+_exptl_crystal_grow.pdbx_details
+'30% polyethylene glycol dimethyl ether 500, 0.15 M sodium chloride, 0.15M calcium chloride, and 0.1 M MES (pH 6.0) buffer'
+_exptl_crystal_grow.pdbx_pH_range ?
+#
+_diffrn.ambient_environment ?
+_diffrn.ambient_temp 140
+_diffrn.ambient_temp_details ?
+_diffrn.ambient_temp_esd ?
+_diffrn.crystal_id 1
+_diffrn.crystal_support ?
+_diffrn.crystal_treatment ?
+_diffrn.details ?
+_diffrn.id 1
+_diffrn.ambient_pressure ?
+_diffrn.ambient_pressure_esd ?
+_diffrn.ambient_pressure_gt ?
+_diffrn.ambient_pressure_lt ?
+_diffrn.ambient_temp_gt ?
+_diffrn.ambient_temp_lt ?
+_diffrn.pdbx_serial_crystal_experiment N
+#
+_diffrn_detector.details ?
+_diffrn_detector.detector CCD
+_diffrn_detector.diffrn_id 1
+_diffrn_detector.type 'ADSC QUANTUM 270'
+_diffrn_detector.area_resol_mean ?
+_diffrn_detector.dtime ?
+_diffrn_detector.pdbx_frames_total ?
+_diffrn_detector.pdbx_collection_time_total ?
+_diffrn_detector.pdbx_collection_date 2018-11-24
+_diffrn_detector.pdbx_frequency ?
+#
+_diffrn_radiation.collimation ?
+_diffrn_radiation.diffrn_id 1
+_diffrn_radiation.filter_edge ?
+_diffrn_radiation.inhomogeneity ?
+_diffrn_radiation.monochromator ?
+_diffrn_radiation.polarisn_norm ?
+_diffrn_radiation.polarisn_ratio ?
+_diffrn_radiation.probe ?
+_diffrn_radiation.type ?
+_diffrn_radiation.xray_symbol ?
+_diffrn_radiation.wavelength_id 1
+_diffrn_radiation.pdbx_monochromatic_or_laue_m_l M
+_diffrn_radiation.pdbx_wavelength_list ?
+_diffrn_radiation.pdbx_wavelength ?
+_diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH'
+_diffrn_radiation.pdbx_analyzer ?
+_diffrn_radiation.pdbx_scattering_type x-ray
+#
+_diffrn_radiation_wavelength.id 1
+_diffrn_radiation_wavelength.wavelength 1.0
+_diffrn_radiation_wavelength.wt 1.0
+#
+_diffrn_source.current ?
+_diffrn_source.details ?
+_diffrn_source.diffrn_id 1
+_diffrn_source.power ?
+_diffrn_source.size ?
+_diffrn_source.source SYNCHROTRON
+_diffrn_source.target ?
+_diffrn_source.type 'PHOTON FACTORY BEAMLINE AR-NW14A'
+_diffrn_source.voltage ?
+_diffrn_source.take-off_angle ?
+_diffrn_source.pdbx_wavelength_list 1.0
+_diffrn_source.pdbx_wavelength ?
+_diffrn_source.pdbx_synchrotron_beamline AR-NW14A
+_diffrn_source.pdbx_synchrotron_site 'Photon Factory'
+#
+_reflns.B_iso_Wilson_estimate ?
+_reflns.entry_id 6JYF
+_reflns.data_reduction_details ?
+_reflns.data_reduction_method ?
+_reflns.d_resolution_high 2
+_reflns.d_resolution_low 34.1
+_reflns.details ?
+_reflns.limit_h_max ?
+_reflns.limit_h_min ?
+_reflns.limit_k_max ?
+_reflns.limit_k_min ?
+_reflns.limit_l_max ?
+_reflns.limit_l_min ?
+_reflns.number_all ?
+_reflns.number_obs 21264
+_reflns.observed_criterion ?
+_reflns.observed_criterion_F_max ?
+_reflns.observed_criterion_F_min ?
+_reflns.observed_criterion_I_max ?
+_reflns.observed_criterion_I_min ?
+_reflns.observed_criterion_sigma_F ?
+_reflns.observed_criterion_sigma_I ?
+_reflns.percent_possible_obs 95.9
+_reflns.R_free_details ?
+_reflns.Rmerge_F_all ?
+_reflns.Rmerge_F_obs ?
+_reflns.Friedel_coverage ?
+_reflns.number_gt ?
+_reflns.threshold_expression ?
+_reflns.pdbx_redundancy 2.9
+_reflns.pdbx_Rmerge_I_obs ?
+_reflns.pdbx_Rmerge_I_all ?
+_reflns.pdbx_Rsym_value ?
+_reflns.pdbx_netI_over_av_sigmaI ?
+_reflns.pdbx_netI_over_sigmaI 13.8
+_reflns.pdbx_res_netI_over_av_sigmaI_2 ?
+_reflns.pdbx_res_netI_over_sigmaI_2 ?
+_reflns.pdbx_chi_squared ?
+_reflns.pdbx_scaling_rejects ?
+_reflns.pdbx_d_res_high_opt ?
+_reflns.pdbx_d_res_low_opt ?
+_reflns.pdbx_d_res_opt_method ?
+_reflns.phase_calculation_details ?
+_reflns.pdbx_Rrim_I_all ?
+_reflns.pdbx_Rpim_I_all ?
+_reflns.pdbx_d_opt ?
+_reflns.pdbx_number_measured_all ?
+_reflns.pdbx_diffrn_id 1
+_reflns.pdbx_ordinal 1
+_reflns.pdbx_CC_half ?
+_reflns.pdbx_R_split ?
+#
+_reflns_shell.d_res_high 2.0
+_reflns_shell.d_res_low 2.03
+_reflns_shell.meanI_over_sigI_all ?
+_reflns_shell.meanI_over_sigI_obs ?
+_reflns_shell.number_measured_all ?
+_reflns_shell.number_measured_obs ?
+_reflns_shell.number_possible ?
+_reflns_shell.number_unique_all ?
+_reflns_shell.number_unique_obs ?
+_reflns_shell.percent_possible_all ?
+_reflns_shell.percent_possible_obs ?
+_reflns_shell.Rmerge_F_all ?
+_reflns_shell.Rmerge_F_obs ?
+_reflns_shell.Rmerge_I_all ?
+_reflns_shell.Rmerge_I_obs ?
+_reflns_shell.meanI_over_sigI_gt ?
+_reflns_shell.meanI_over_uI_all ?
+_reflns_shell.meanI_over_uI_gt ?
+_reflns_shell.number_measured_gt ?
+_reflns_shell.number_unique_gt ?
+_reflns_shell.percent_possible_gt ?
+_reflns_shell.Rmerge_F_gt ?
+_reflns_shell.Rmerge_I_gt ?
+_reflns_shell.pdbx_redundancy ?
+_reflns_shell.pdbx_Rsym_value ?
+_reflns_shell.pdbx_chi_squared ?
+_reflns_shell.pdbx_netI_over_sigmaI_all ?
+_reflns_shell.pdbx_netI_over_sigmaI_obs ?
+_reflns_shell.pdbx_Rrim_I_all ?
+_reflns_shell.pdbx_Rpim_I_all ?
+_reflns_shell.pdbx_rejects ?
+_reflns_shell.pdbx_ordinal 1
+_reflns_shell.pdbx_diffrn_id 1
+_reflns_shell.pdbx_CC_half ?
+_reflns_shell.pdbx_R_split ?
+#
+_refine.aniso_B[1][1] ?
+_refine.aniso_B[1][2] ?
+_refine.aniso_B[1][3] ?
+_refine.aniso_B[2][2] ?
+_refine.aniso_B[2][3] ?
+_refine.aniso_B[3][3] ?
+_refine.B_iso_max ?
+_refine.B_iso_mean ?
+_refine.B_iso_min ?
+_refine.correlation_coeff_Fo_to_Fc ?
+_refine.correlation_coeff_Fo_to_Fc_free ?
+_refine.details ?
+_refine.diff_density_max ?
+_refine.diff_density_max_esd ?
+_refine.diff_density_min ?
+_refine.diff_density_min_esd ?
+_refine.diff_density_rms ?
+_refine.diff_density_rms_esd ?
+_refine.entry_id 6JYF
+_refine.pdbx_refine_id 'X-RAY DIFFRACTION'
+_refine.ls_abs_structure_details ?
+_refine.ls_abs_structure_Flack ?
+_refine.ls_abs_structure_Flack_esd ?
+_refine.ls_abs_structure_Rogers ?
+_refine.ls_abs_structure_Rogers_esd ?
+_refine.ls_d_res_high 2.004
+_refine.ls_d_res_low 34.072
+_refine.ls_extinction_coef ?
+_refine.ls_extinction_coef_esd ?
+_refine.ls_extinction_expression ?
+_refine.ls_extinction_method ?
+_refine.ls_goodness_of_fit_all ?
+_refine.ls_goodness_of_fit_all_esd ?
+_refine.ls_goodness_of_fit_obs ?
+_refine.ls_goodness_of_fit_obs_esd ?
+_refine.ls_hydrogen_treatment ?
+_refine.ls_matrix_type ?
+_refine.ls_number_constraints ?
+_refine.ls_number_parameters ?
+_refine.ls_number_reflns_all ?
+_refine.ls_number_reflns_obs 21257
+_refine.ls_number_reflns_R_free 1093
+_refine.ls_number_reflns_R_work ?
+_refine.ls_number_restraints ?
+_refine.ls_percent_reflns_obs 95.73
+_refine.ls_percent_reflns_R_free 5.14
+_refine.ls_R_factor_all ?
+_refine.ls_R_factor_obs 0.1641
+_refine.ls_R_factor_R_free 0.2131
+_refine.ls_R_factor_R_free_error ?
+_refine.ls_R_factor_R_free_error_details ?
+_refine.ls_R_factor_R_work 0.1615
+_refine.ls_R_Fsqd_factor_obs ?
+_refine.ls_R_I_factor_obs ?
+_refine.ls_redundancy_reflns_all ?
+_refine.ls_redundancy_reflns_obs ?
+_refine.ls_restrained_S_all ?
+_refine.ls_restrained_S_obs ?
+_refine.ls_shift_over_esd_max ?
+_refine.ls_shift_over_esd_mean ?
+_refine.ls_structure_factor_coef ?
+_refine.ls_weighting_details ?
+_refine.ls_weighting_scheme ?
+_refine.ls_wR_factor_all ?
+_refine.ls_wR_factor_obs ?
+_refine.ls_wR_factor_R_free ?
+_refine.ls_wR_factor_R_work ?
+_refine.occupancy_max ?
+_refine.occupancy_min ?
+_refine.solvent_model_details ?
+_refine.solvent_model_param_bsol ?
+_refine.solvent_model_param_ksol ?
+_refine.ls_R_factor_gt ?
+_refine.ls_goodness_of_fit_gt ?
+_refine.ls_goodness_of_fit_ref ?
+_refine.ls_shift_over_su_max ?
+_refine.ls_shift_over_su_max_lt ?
+_refine.ls_shift_over_su_mean ?
+_refine.ls_shift_over_su_mean_lt ?
+_refine.pdbx_ls_sigma_I ?
+_refine.pdbx_ls_sigma_F 1.50
+_refine.pdbx_ls_sigma_Fsqd ?
+_refine.pdbx_data_cutoff_high_absF ?
+_refine.pdbx_data_cutoff_high_rms_absF ?
+_refine.pdbx_data_cutoff_low_absF ?
+_refine.pdbx_isotropic_thermal_model ?
+_refine.pdbx_ls_cross_valid_method 'FREE R-VALUE'
+_refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT'
+_refine.pdbx_starting_model 5ZTK
+_refine.pdbx_stereochemistry_target_values ?
+_refine.pdbx_R_Free_selection_details ?
+_refine.pdbx_stereochem_target_val_spec_case ?
+_refine.pdbx_overall_ESU_R ?
+_refine.pdbx_overall_ESU_R_Free ?
+_refine.pdbx_solvent_vdw_probe_radii 1.11
+_refine.pdbx_solvent_ion_probe_radii ?
+_refine.pdbx_solvent_shrinkage_radii 0.90
+_refine.pdbx_real_space_R ?
+_refine.pdbx_density_correlation ?
+_refine.pdbx_pd_number_of_powder_patterns ?
+_refine.pdbx_pd_number_of_points ?
+_refine.pdbx_pd_meas_number_of_points ?
+_refine.pdbx_pd_proc_ls_prof_R_factor ?
+_refine.pdbx_pd_proc_ls_prof_wR_factor ?
+_refine.pdbx_pd_Marquardt_correlation_coeff ?
+_refine.pdbx_pd_Fsqrd_R_factor ?
+_refine.pdbx_pd_ls_matrix_band_width ?
+_refine.pdbx_overall_phase_error 19.29
+_refine.pdbx_overall_SU_R_free_Cruickshank_DPI ?
+_refine.pdbx_overall_SU_R_free_Blow_DPI ?
+_refine.pdbx_overall_SU_R_Blow_DPI ?
+_refine.pdbx_TLS_residual_ADP_flag ?
+_refine.pdbx_diffrn_id 1
+_refine.overall_SU_B ?
+_refine.overall_SU_ML 0.19
+_refine.overall_SU_R_Cruickshank_DPI ?
+_refine.overall_SU_R_free ?
+_refine.overall_FOM_free_R_set ?
+_refine.overall_FOM_work_R_set ?
+_refine.pdbx_average_fsc_overall ?
+_refine.pdbx_average_fsc_work ?
+_refine.pdbx_average_fsc_free ?
+#
+_refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION'
+_refine_hist.cycle_id LAST
+_refine_hist.pdbx_number_atoms_protein 2072
+_refine_hist.pdbx_number_atoms_nucleic_acid 0
+_refine_hist.pdbx_number_atoms_ligand 150
+_refine_hist.number_atoms_solvent 85
+_refine_hist.number_atoms_total 2307
+_refine_hist.d_res_high 2.004
+_refine_hist.d_res_low 34.072
+#
+loop_
+_refine_ls_restr.pdbx_refine_id
+_refine_ls_restr.criterion
+_refine_ls_restr.dev_ideal
+_refine_ls_restr.dev_ideal_target
+_refine_ls_restr.number
+_refine_ls_restr.rejects
+_refine_ls_restr.type
+_refine_ls_restr.weight
+_refine_ls_restr.pdbx_restraint_function
+'X-RAY DIFFRACTION' ? 0.003 ? 2262 ? f_bond_d ? ?
+'X-RAY DIFFRACTION' ? 0.770 ? 3036 ? f_angle_d ? ?
+'X-RAY DIFFRACTION' ? 12.311 ? 818 ? f_dihedral_angle_d ? ?
+'X-RAY DIFFRACTION' ? 0.026 ? 342 ? f_chiral_restr ? ?
+'X-RAY DIFFRACTION' ? 0.004 ? 362 ? f_plane_restr ? ?
+#
+loop_
+_refine_ls_shell.pdbx_refine_id
+_refine_ls_shell.d_res_high
+_refine_ls_shell.d_res_low
+_refine_ls_shell.number_reflns_all
+_refine_ls_shell.number_reflns_obs
+_refine_ls_shell.number_reflns_R_free
+_refine_ls_shell.number_reflns_R_work
+_refine_ls_shell.percent_reflns_obs
+_refine_ls_shell.percent_reflns_R_free
+_refine_ls_shell.R_factor_all
+_refine_ls_shell.R_factor_obs
+_refine_ls_shell.R_factor_R_free
+_refine_ls_shell.R_factor_R_free_error
+_refine_ls_shell.R_factor_R_work
+_refine_ls_shell.redundancy_reflns_all
+_refine_ls_shell.redundancy_reflns_obs
+_refine_ls_shell.wR_factor_all
+_refine_ls_shell.wR_factor_obs
+_refine_ls_shell.wR_factor_R_free
+_refine_ls_shell.wR_factor_R_work
+_refine_ls_shell.pdbx_total_number_of_bins_used
+_refine_ls_shell.pdbx_phase_error
+_refine_ls_shell.pdbx_fsc_work
+_refine_ls_shell.pdbx_fsc_free
+'X-RAY DIFFRACTION' 2.0041 2.0953 . . 140 2341 90.00 . . . 0.2695 . 0.2151 . . . . . . . . . .
+'X-RAY DIFFRACTION' 2.0953 2.2057 . . 128 2431 94.00 . . . 0.2398 . 0.1780 . . . . . . . . . .
+'X-RAY DIFFRACTION' 2.2057 2.3439 . . 137 2480 94.00 . . . 0.2180 . 0.1622 . . . . . . . . . .
+'X-RAY DIFFRACTION' 2.3439 2.5248 . . 138 2490 96.00 . . . 0.2177 . 0.1536 . . . . . . . . . .
+'X-RAY DIFFRACTION' 2.5248 2.7788 . . 113 2609 97.00 . . . 0.2104 . 0.1486 . . . . . . . . . .
+'X-RAY DIFFRACTION' 2.7788 3.1806 . . 150 2548 98.00 . . . 0.2135 . 0.1581 . . . . . . . . . .
+'X-RAY DIFFRACTION' 3.1806 4.0062 . . 147 2600 99.00 . . . 0.2026 . 0.1509 . . . . . . . . . .
+'X-RAY DIFFRACTION' 4.0062 34.0768 . . 140 2665 98.00 . . . 0.1976 . 0.1630 . . . . . . . . . .
+#
+_struct.entry_id 6JYF
+_struct.title
+'Structure of light-state marine bacterial chloride importer, NM-R3, with Pulse laser (ND-1%) at 140K.'
+_struct.pdbx_descriptor 'Chloride pumping rhodopsin'
+_struct.pdbx_model_details ?
+_struct.pdbx_formula_weight ?
+_struct.pdbx_formula_weight_method ?
+_struct.pdbx_model_type_details ?
+_struct.pdbx_CASP_flag N
+#
+_struct_keywords.entry_id 6JYF
+_struct_keywords.text 'Photo-excitation, Chloride pump, Retinal, MEMBRANE PROTEIN'
+_struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN'
+#
+loop_
+_struct_asym.id
+_struct_asym.pdbx_blank_PDB_chainid_flag
+_struct_asym.pdbx_modified
+_struct_asym.entity_id
+_struct_asym.details
+A N N 1 ?
+B N N 2 ?
+C N N 3 ?
+D N N 3 ?
+E N N 4 ?
+F N N 4 ?
+G N N 4 ?
+H N N 4 ?
+I N N 4 ?
+J N N 4 ?
+K N N 4 ?
+L N N 4 ?
+M N N 4 ?
+N N N 4 ?
+O N N 4 ?
+P N N 5 ?
+#
+loop_
+_struct_conf.conf_type_id
+_struct_conf.id
+_struct_conf.pdbx_PDB_helix_id
+_struct_conf.beg_label_comp_id
+_struct_conf.beg_label_asym_id
+_struct_conf.beg_label_seq_id
+_struct_conf.pdbx_beg_PDB_ins_code
+_struct_conf.end_label_comp_id
+_struct_conf.end_label_asym_id
+_struct_conf.end_label_seq_id
+_struct_conf.pdbx_end_PDB_ins_code
+_struct_conf.beg_auth_comp_id
+_struct_conf.beg_auth_asym_id
+_struct_conf.beg_auth_seq_id
+_struct_conf.end_auth_comp_id
+_struct_conf.end_auth_asym_id
+_struct_conf.end_auth_seq_id
+_struct_conf.pdbx_PDB_helix_class
+_struct_conf.details
+_struct_conf.pdbx_PDB_helix_length
+HELX_P HELX_P1 AA1 ASN A 19 ? PHE A 24 ? ASN A 3 PHE A 8 5 ? 6
+HELX_P HELX_P2 AA2 SER A 27 ? SER A 56 ? SER A 11 SER A 40 1 ? 30
+HELX_P HELX_P3 AA3 GLN A 57 ? VAL A 59 ? GLN A 41 VAL A 43 5 ? 3
+HELX_P HELX_P4 AA4 TYR A 63 ? ALA A 91 ? TYR A 47 ALA A 75 1 ? 29
+HELX_P HELX_P5 AA5 ASN A 108 ? LEU A 130 ? ASN A 92 LEU A 114 1 ? 23
+HELX_P HELX_P6 AA6 LYS A 133 ? LEU A 160 ? LYS A 117 LEU A 144 1 ? 28
+HELX_P HELX_P7 AA7 ASP A 165 ? ARG A 195 ? ASP A 149 ARG A 179 1 ? 31
+HELX_P HELX_P8 AA8 ALA A 196 ? MET A 198 ? ALA A 180 MET A 182 5 ? 3
+HELX_P HELX_P9 AA9 GLY A 201 ? LEU A 225 ? GLY A 185 LEU A 209 1 ? 25
+HELX_P HELX_P10 AB1 LEU A 225 ? MET A 230 ? LEU A 209 MET A 214 1 ? 6
+HELX_P HELX_P11 AB2 ASN A 232 ? ALA A 269 ? ASN A 216 ALA A 253 1 ? 38
+HELX_P HELX_P12 AB3 TYR A 271 ? ILE A 281 ? TYR A 255 ILE A 265 1 ? 11
+#
+_struct_conf_type.id HELX_P
+_struct_conf_type.criteria ?
+_struct_conf_type.reference ?
+#
+_struct_conn.id covale1
+_struct_conn.conn_type_id covale
+_struct_conn.pdbx_leaving_atom_flag one
+_struct_conn.pdbx_PDB_id ?
+_struct_conn.ptnr1_label_asym_id A
+_struct_conn.ptnr1_label_comp_id LYS
+_struct_conn.ptnr1_label_seq_id 251
+_struct_conn.ptnr1_label_atom_id NZ
+_struct_conn.pdbx_ptnr1_label_alt_id ?
+_struct_conn.pdbx_ptnr1_PDB_ins_code ?
+_struct_conn.pdbx_ptnr1_standard_comp_id ?
+_struct_conn.ptnr1_symmetry 1_555
+_struct_conn.ptnr2_label_asym_id B
+_struct_conn.ptnr2_label_comp_id RET
+_struct_conn.ptnr2_label_seq_id .
+_struct_conn.ptnr2_label_atom_id C15
+_struct_conn.pdbx_ptnr2_label_alt_id ?
+_struct_conn.pdbx_ptnr2_PDB_ins_code ?
+_struct_conn.ptnr1_auth_asym_id A
+_struct_conn.ptnr1_auth_comp_id LYS
+_struct_conn.ptnr1_auth_seq_id 235
+_struct_conn.ptnr2_auth_asym_id A
+_struct_conn.ptnr2_auth_comp_id RET
+_struct_conn.ptnr2_auth_seq_id 301
+_struct_conn.ptnr2_symmetry 1_555
+_struct_conn.pdbx_ptnr3_label_atom_id ?
+_struct_conn.pdbx_ptnr3_label_seq_id ?
+_struct_conn.pdbx_ptnr3_label_comp_id ?
+_struct_conn.pdbx_ptnr3_label_asym_id ?
+_struct_conn.pdbx_ptnr3_label_alt_id ?
+_struct_conn.pdbx_ptnr3_PDB_ins_code ?
+_struct_conn.details ?
+_struct_conn.pdbx_dist_value 1.349
+_struct_conn.pdbx_value_order ?
+#
+_struct_conn_type.id covale
+_struct_conn_type.criteria ?
+_struct_conn_type.reference ?
+#
+_struct_sheet.id AA1
+_struct_sheet.type ?
+_struct_sheet.number_strands 2
+_struct_sheet.details ?
+#
+_struct_sheet_order.sheet_id AA1
+_struct_sheet_order.range_id_1 1
+_struct_sheet_order.range_id_2 2
+_struct_sheet_order.offset ?
+_struct_sheet_order.sense anti-parallel
+#
+loop_
+_struct_sheet_range.sheet_id
+_struct_sheet_range.id
+_struct_sheet_range.beg_label_comp_id
+_struct_sheet_range.beg_label_asym_id
+_struct_sheet_range.beg_label_seq_id
+_struct_sheet_range.pdbx_beg_PDB_ins_code
+_struct_sheet_range.end_label_comp_id
+_struct_sheet_range.end_label_asym_id
+_struct_sheet_range.end_label_seq_id
+_struct_sheet_range.pdbx_end_PDB_ins_code
+_struct_sheet_range.beg_auth_comp_id
+_struct_sheet_range.beg_auth_asym_id
+_struct_sheet_range.beg_auth_seq_id
+_struct_sheet_range.end_auth_comp_id
+_struct_sheet_range.end_auth_asym_id
+_struct_sheet_range.end_auth_seq_id
+AA1 1 TYR A 92 ? VAL A 95 ? TYR A 76 VAL A 79
+AA1 2 SER A 98 ? LEU A 101 ? SER A 82 LEU A 85
+#
+_pdbx_struct_sheet_hbond.sheet_id AA1
+_pdbx_struct_sheet_hbond.range_id_1 1
+_pdbx_struct_sheet_hbond.range_id_2 2
+_pdbx_struct_sheet_hbond.range_1_label_atom_id N
+_pdbx_struct_sheet_hbond.range_1_label_comp_id VAL
+_pdbx_struct_sheet_hbond.range_1_label_asym_id A
+_pdbx_struct_sheet_hbond.range_1_label_seq_id 95
+_pdbx_struct_sheet_hbond.range_1_PDB_ins_code ?
+_pdbx_struct_sheet_hbond.range_1_auth_atom_id N
+_pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL
+_pdbx_struct_sheet_hbond.range_1_auth_asym_id A
+_pdbx_struct_sheet_hbond.range_1_auth_seq_id 79
+_pdbx_struct_sheet_hbond.range_2_label_atom_id O
+_pdbx_struct_sheet_hbond.range_2_label_comp_id SER
+_pdbx_struct_sheet_hbond.range_2_label_asym_id A
+_pdbx_struct_sheet_hbond.range_2_label_seq_id 98
+_pdbx_struct_sheet_hbond.range_2_PDB_ins_code ?
+_pdbx_struct_sheet_hbond.range_2_auth_atom_id O
+_pdbx_struct_sheet_hbond.range_2_auth_comp_id SER
+_pdbx_struct_sheet_hbond.range_2_auth_asym_id A
+_pdbx_struct_sheet_hbond.range_2_auth_seq_id 82
+#
+loop_
+_struct_site.id
+_struct_site.pdbx_evidence_code
+_struct_site.pdbx_auth_asym_id
+_struct_site.pdbx_auth_comp_id
+_struct_site.pdbx_auth_seq_id
+_struct_site.pdbx_auth_ins_code
+_struct_site.pdbx_num_residues
+_struct_site.details
+AC1 Software A RET 301 ? 11 'binding site for residue RET A 301'
+AC2 Software A CL 302 ? 3 'binding site for residue CL A 302'
+AC3 Software A CL 303 ? 3 'binding site for residue CL A 303'
+AC4 Software A OLA 304 ? 5 'binding site for residue OLA A 304'
+AC5 Software A OLA 305 ? 5 'binding site for residue OLA A 305'
+AC6 Software A OLA 306 ? 6 'binding site for residue OLA A 306'
+AC7 Software A OLA 307 ? 3 'binding site for residue OLA A 307'
+AC8 Software A OLA 308 ? 1 'binding site for residue OLA A 308'
+AC9 Software A OLA 309 ? 2 'binding site for residue OLA A 309'
+AD1 Software A OLA 311 ? 2 'binding site for residue OLA A 311'
+AD2 Software A OLA 312 ? 1 'binding site for residue OLA A 312'
+AD3 Software A OLA 313 ? 2 'binding site for residue OLA A 313'
+AD4 Software A OLA 314 ? 1 'binding site for residue OLA A 314'
+#
+loop_
+_struct_site_gen.id
+_struct_site_gen.site_id
+_struct_site_gen.pdbx_num_res
+_struct_site_gen.label_comp_id
+_struct_site_gen.label_asym_id
+_struct_site_gen.label_seq_id
+_struct_site_gen.pdbx_auth_ins_code
+_struct_site_gen.auth_comp_id
+_struct_site_gen.auth_asym_id
+_struct_site_gen.auth_seq_id
+_struct_site_gen.label_atom_id
+_struct_site_gen.label_alt_id
+_struct_site_gen.symmetry
+_struct_site_gen.details
+1 AC1 11 TRP A 115 ? TRP A 99 . ? 1_555 ?
+2 AC1 11 ILE A 119 ? ILE A 103 . ? 1_555 ?
+3 AC1 11 MET A 151 ? MET A 135 . ? 1_555 ?
+4 AC1 11 GLY A 155 ? GLY A 139 . ? 1_555 ?
+5 AC1 11 SER A 176 ? SER A 160 . ? 1_555 ?
+6 AC1 11 PHE A 180 ? PHE A 164 . ? 1_555 ?
+7 AC1 11 TRP A 217 ? TRP A 201 . ? 1_555 ?
+8 AC1 11 TYR A 220 ? TYR A 204 . ? 1_555 ?
+9 AC1 11 TYR A 224 ? TYR A 208 . ? 1_555 ?
+10 AC1 11 SER A 250 ? SER A 234 . ? 1_555 ?
+11 AC1 11 LYS A 251 ? LYS A 235 . ? 1_555 ?
+12 AC2 3 ASN A 114 ? ASN A 98 . ? 1_555 ?
+13 AC2 3 THR A 118 ? THR A 102 . ? 1_555 ?
+14 AC2 3 LYS A 251 ? LYS A 235 . ? 1_555 ?
+15 AC3 3 PRO A 61 ? PRO A 45 . ? 1_555 ?
+16 AC3 3 LYS A 62 ? LYS A 46 . ? 1_555 ?
+17 AC3 3 HOH P . ? HOH A 485 . ? 1_555 ?
+18 AC4 5 GLN A 168 ? GLN A 152 . ? 1_555 ?
+19 AC4 5 TRP A 172 ? TRP A 156 . ? 1_555 ?
+20 AC4 5 VAL A 175 ? VAL A 159 . ? 1_555 ?
+21 AC4 5 LYS A 208 ? LYS A 192 . ? 4_455 ?
+22 AC4 5 TRP A 211 ? TRP A 195 . ? 4_455 ?
+23 AC5 5 PHE A 33 ? PHE A 17 . ? 1_555 ?
+24 AC5 5 VAL A 181 ? VAL A 165 . ? 4_445 ?
+25 AC5 5 THR A 189 ? THR A 173 . ? 4_445 ?
+26 AC5 5 LEU A 241 ? LEU A 225 . ? 1_555 ?
+27 AC5 5 OLA H . ? OLA A 307 . ? 1_555 ?
+28 AC6 6 MET A 170 ? MET A 154 . ? 4_445 ?
+29 AC6 6 GLY A 173 ? GLY A 157 . ? 4_445 ?
+30 AC6 6 THR A 177 ? THR A 161 . ? 4_445 ?
+31 AC6 6 MET A 257 ? MET A 241 . ? 1_555 ?
+32 AC6 6 TYR A 260 ? TYR A 244 . ? 1_555 ?
+33 AC6 6 OLA L . ? OLA A 311 . ? 1_555 ?
+34 AC7 3 PHE A 192 ? PHE A 176 . ? 4_445 ?
+35 AC7 3 OLA F . ? OLA A 305 . ? 1_555 ?
+36 AC7 3 HOH P . ? HOH A 449 . ? 1_555 ?
+37 AC8 1 ASN A 82 ? ASN A 66 . ? 2_555 ?
+38 AC9 2 PHE A 179 ? PHE A 163 . ? 4_445 ?
+39 AC9 2 PHE A 215 ? PHE A 199 . ? 1_555 ?
+40 AD1 2 PHE A 51 ? PHE A 35 . ? 1_555 ?
+41 AD1 2 OLA G . ? OLA A 306 . ? 1_555 ?
+42 AD2 1 TRP A 211 ? TRP A 195 . ? 1_555 ?
+43 AD3 2 HOH P . ? HOH A 406 . ? 2_555 ?
+44 AD3 2 HOH P . ? HOH A 460 . ? 1_555 ?
+45 AD4 1 GLY A 150 ? GLY A 134 . ? 1_555 ?
+#
+_atom_sites.entry_id 6JYF
+_atom_sites.fract_transf_matrix[1][1] 0.009716
+_atom_sites.fract_transf_matrix[1][2] 0.000000
+_atom_sites.fract_transf_matrix[1][3] 0.003533
+_atom_sites.fract_transf_matrix[2][1] 0.000000
+_atom_sites.fract_transf_matrix[2][2] 0.020289
+_atom_sites.fract_transf_matrix[2][3] 0.000000
+_atom_sites.fract_transf_matrix[3][1] 0.000000
+_atom_sites.fract_transf_matrix[3][2] 0.000000
+_atom_sites.fract_transf_matrix[3][3] 0.015318
+_atom_sites.fract_transf_vector[1] 0.00000
+_atom_sites.fract_transf_vector[2] 0.00000
+_atom_sites.fract_transf_vector[3] 0.00000
+#
+loop_
+_atom_type.symbol
+C
+CL
+N
+O
+S
+#
+loop_
+_atom_site.group_PDB
+_atom_site.id
+_atom_site.type_symbol
+_atom_site.label_atom_id
+_atom_site.label_alt_id
+_atom_site.label_comp_id
+_atom_site.label_asym_id
+_atom_site.label_entity_id
+_atom_site.label_seq_id
+_atom_site.pdbx_PDB_ins_code
+_atom_site.Cartn_x
+_atom_site.Cartn_y
+_atom_site.Cartn_z
+_atom_site.occupancy
+_atom_site.B_iso_or_equiv
+_atom_site.pdbx_formal_charge
+_atom_site.auth_seq_id
+_atom_site.auth_comp_id
+_atom_site.auth_asym_id
+_atom_site.auth_atom_id
+_atom_site.pdbx_PDB_model_num
+ATOM 1 N N . LYS A 1 18 ? -17.183 -16.380 22.725 1.00 34.42 ? 2 LYS A N 1
+ATOM 2 C CA . LYS A 1 18 ? -18.028 -15.596 21.833 1.00 41.12 ? 2 LYS A CA 1
+ATOM 3 C C . LYS A 1 18 ? -18.752 -16.485 20.823 1.00 32.33 ? 2 LYS A C 1
+ATOM 4 O O . LYS A 1 18 ? -19.707 -16.049 20.183 1.00 40.88 ? 2 LYS A O 1
+ATOM 5 C CB . LYS A 1 18 ? -17.200 -14.536 21.098 1.00 50.76 ? 2 LYS A CB 1
+ATOM 6 C CG . LYS A 1 18 ? -16.474 -13.568 22.018 1.00 77.01 ? 2 LYS A CG 1
+ATOM 7 C CD . LYS A 1 18 ? -17.446 -12.839 22.935 1.00 62.54 ? 2 LYS A CD 1
+ATOM 8 C CE . LYS A 1 18 ? -16.711 -11.946 23.926 1.00 51.83 ? 2 LYS A CE 1
+ATOM 9 N NZ . LYS A 1 18 ? -17.642 -11.284 24.889 1.00 43.85 ? 2 LYS A NZ 1
+ATOM 10 N N . ASN A 1 19 ? -18.290 -17.725 20.682 1.00 26.04 ? 3 ASN A N 1
+ATOM 11 C CA . ASN A 1 19 ? -18.894 -18.677 19.749 1.00 20.87 ? 3 ASN A CA 1
+ATOM 12 C C . ASN A 1 19 ? -19.851 -19.623 20.466 1.00 24.92 ? 3 ASN A C 1
+ATOM 13 O O . ASN A 1 19 ? -19.659 -19.916 21.645 1.00 22.82 ? 3 ASN A O 1
+ATOM 14 C CB . ASN A 1 19 ? -17.811 -19.478 19.031 1.00 41.28 ? 3 ASN A CB 1
+ATOM 15 C CG . ASN A 1 19 ? -16.921 -20.242 19.992 1.00 34.89 ? 3 ASN A CG 1
+ATOM 16 O OD1 . ASN A 1 19 ? -16.552 -19.734 21.051 1.00 57.74 ? 3 ASN A OD1 1
+ATOM 17 N ND2 . ASN A 1 19 ? -16.582 -21.474 19.633 1.00 69.68 ? 3 ASN A ND2 1
+ATOM 18 N N . ILE A 1 20 ? -20.872 -20.111 19.766 1.00 22.55 ? 4 ILE A N 1
+ATOM 19 C CA . ILE A 1 20 ? -21.881 -20.944 20.418 1.00 21.92 ? 4 ILE A CA 1
+ATOM 20 C C . ILE A 1 20 ? -21.328 -22.302 20.840 1.00 16.32 ? 4 ILE A C 1
+ATOM 21 O O . ILE A 1 20 ? -21.872 -22.938 21.742 1.00 21.24 ? 4 ILE A O 1
+ATOM 22 C CB . ILE A 1 20 ? -23.120 -21.173 19.526 1.00 24.14 ? 4 ILE A CB 1
+ATOM 23 C CG1 . ILE A 1 20 ? -22.756 -21.992 18.286 1.00 28.26 ? 4 ILE A CG1 1
+ATOM 24 C CG2 . ILE A 1 20 ? -23.755 -19.845 19.155 1.00 31.89 ? 4 ILE A CG2 1
+ATOM 25 C CD1 . ILE A 1 20 ? -23.956 -22.553 17.565 1.00 30.64 ? 4 ILE A CD1 1
+ATOM 26 N N . GLU A 1 21 ? -20.250 -22.740 20.194 1.00 20.55 ? 5 GLU A N 1
+ATOM 27 C CA . GLU A 1 21 ? -19.618 -24.004 20.553 1.00 19.20 ? 5 GLU A CA 1
+ATOM 28 C C . GLU A 1 21 ? -19.236 -24.020 22.032 1.00 22.91 ? 5 GLU A C 1
+ATOM 29 O O . GLU A 1 21 ? -19.365 -25.042 22.702 1.00 20.32 ? 5 GLU A O 1
+ATOM 30 C CB . GLU A 1 21 ? -18.382 -24.264 19.688 1.00 20.64 ? 5 GLU A CB 1
+ATOM 31 C CG . GLU A 1 21 ? -18.694 -24.671 18.253 1.00 28.00 ? 5 GLU A CG 1
+ATOM 32 C CD . GLU A 1 21 ? -18.962 -23.487 17.339 1.00 28.57 ? 5 GLU A CD 1
+ATOM 33 O OE1 . GLU A 1 21 ? -18.746 -22.335 17.770 1.00 22.98 ? 5 GLU A OE1 1
+ATOM 34 O OE2 . GLU A 1 21 ? -19.392 -23.708 16.186 1.00 29.51 ? 5 GLU A OE2 1
+ATOM 35 N N . SER A 1 22 ? -18.799 -22.874 22.541 1.00 19.69 ? 6 SER A N 1
+ATOM 36 C CA . SER A 1 22 ? -18.333 -22.774 23.921 1.00 25.48 ? 6 SER A CA 1
+ATOM 37 C C . SER A 1 22 ? -19.462 -22.890 24.946 1.00 26.30 ? 6 SER A C 1
+ATOM 38 O O . SER A 1 22 ? -19.206 -23.106 26.128 1.00 26.42 ? 6 SER A O 1
+ATOM 39 C CB . SER A 1 22 ? -17.589 -21.454 24.136 1.00 28.41 ? 6 SER A CB 1
+ATOM 40 O OG . SER A 1 22 ? -18.459 -20.347 23.964 1.00 30.02 ? 6 SER A OG 1
+ATOM 41 N N . LEU A 1 23 ? -20.707 -22.752 24.497 1.00 20.63 ? 7 LEU A N 1
+ATOM 42 C CA . LEU A 1 23 ? -21.844 -22.728 25.415 1.00 22.01 ? 7 LEU A CA 1
+ATOM 43 C C . LEU A 1 23 ? -22.243 -24.097 25.968 1.00 21.12 ? 7 LEU A C 1
+ATOM 44 O O . LEU A 1 23 ? -22.864 -24.180 27.023 1.00 22.04 ? 7 LEU A O 1
+ATOM 45 C CB . LEU A 1 23 ? -23.065 -22.104 24.728 1.00 23.66 ? 7 LEU A CB 1
+ATOM 46 C CG . LEU A 1 23 ? -22.932 -20.673 24.200 1.00 46.26 ? 7 LEU A CG 1
+ATOM 47 C CD1 . LEU A 1 23 ? -24.247 -20.205 23.588 1.00 28.66 ? 7 LEU A CD1 1
+ATOM 48 C CD2 . LEU A 1 23 ? -22.481 -19.727 25.302 1.00 30.10 ? 7 LEU A CD2 1
+ATOM 49 N N . PHE A 1 24 ? -21.899 -25.169 25.263 1.00 22.63 ? 8 PHE A N 1
+ATOM 50 C CA . PHE A 1 24 ? -22.474 -26.472 25.580 1.00 19.86 ? 8 PHE A CA 1
+ATOM 51 C C . PHE A 1 24 ? -21.466 -27.547 25.959 1.00 30.13 ? 8 PHE A C 1
+ATOM 52 O O . PHE A 1 24 ? -20.292 -27.484 25.595 1.00 21.36 ? 8 PHE A O 1
+ATOM 53 C CB . PHE A 1 24 ? -23.306 -26.965 24.392 1.00 16.83 ? 8 PHE A CB 1
+ATOM 54 C CG . PHE A 1 24 ? -24.168 -25.901 23.788 1.00 39.14 ? 8 PHE A CG 1
+ATOM 55 C CD1 . PHE A 1 24 ? -25.302 -25.456 24.448 1.00 21.13 ? 8 PHE A CD1 1
+ATOM 56 C CD2 . PHE A 1 24 ? -23.840 -25.335 22.567 1.00 24.12 ? 8 PHE A CD2 1
+ATOM 57 C CE1 . PHE A 1 24 ? -26.097 -24.465 23.898 1.00 26.74 ? 8 PHE A CE1 1
+ATOM 58 C CE2 . PHE A 1 24 ? -24.630 -24.346 22.012 1.00 20.93 ? 8 PHE A CE2 1
+ATOM 59 C CZ . PHE A 1 24 ? -25.756 -23.906 22.680 1.00 27.19 ? 8 PHE A CZ 1
+ATOM 60 N N . ASP A 1 25 ? -21.946 -28.526 26.718 1.00 22.47 ? 9 ASP A N 1
+ATOM 61 C CA . ASP A 1 25 ? -21.256 -29.793 26.879 1.00 23.21 ? 9 ASP A CA 1
+ATOM 62 C C . ASP A 1 25 ? -21.714 -30.678 25.737 1.00 22.32 ? 9 ASP A C 1
+ATOM 63 O O . ASP A 1 25 ? -22.793 -30.462 25.187 1.00 25.13 ? 9 ASP A O 1
+ATOM 64 C CB . ASP A 1 25 ? -21.576 -30.439 28.227 1.00 30.65 ? 9 ASP A CB 1
+ATOM 65 C CG . ASP A 1 25 ? -21.214 -29.552 29.400 1.00 19.87 ? 9 ASP A CG 1
+ATOM 66 O OD1 . ASP A 1 25 ? -20.291 -28.722 29.260 1.00 23.93 ? 9 ASP A OD1 1
+ATOM 67 O OD2 . ASP A 1 25 ? -21.849 -29.690 30.464 1.00 39.58 ? 9 ASP A OD2 1
+ATOM 68 N N . TYR A 1 26 ? -20.904 -31.666 25.372 1.00 14.17 ? 10 TYR A N 1
+ATOM 69 C CA . TYR A 1 26 ? -21.254 -32.545 24.263 1.00 13.78 ? 10 TYR A CA 1
+ATOM 70 C C . TYR A 1 26 ? -21.283 -33.995 24.710 1.00 18.69 ? 10 TYR A C 1
+ATOM 71 O O . TYR A 1 26 ? -20.464 -34.416 25.522 1.00 15.88 ? 10 TYR A O 1
+ATOM 72 C CB . TYR A 1 26 ? -20.272 -32.350 23.093 1.00 13.77 ? 10 TYR A CB 1
+ATOM 73 C CG . TYR A 1 26 ? -20.316 -30.935 22.575 1.00 16.13 ? 10 TYR A CG 1
+ATOM 74 C CD1 . TYR A 1 26 ? -21.265 -30.553 21.633 1.00 14.62 ? 10 TYR A CD1 1
+ATOM 75 C CD2 . TYR A 1 26 ? -19.453 -29.967 23.072 1.00 16.27 ? 10 TYR A CD2 1
+ATOM 76 C CE1 . TYR A 1 26 ? -21.336 -29.250 21.183 1.00 14.92 ? 10 TYR A CE1 1
+ATOM 77 C CE2 . TYR A 1 26 ? -19.514 -28.661 22.626 1.00 21.44 ? 10 TYR A CE2 1
+ATOM 78 C CZ . TYR A 1 26 ? -20.457 -28.310 21.681 1.00 23.73 ? 10 TYR A CZ 1
+ATOM 79 O OH . TYR A 1 26 ? -20.525 -27.013 21.239 1.00 18.70 ? 10 TYR A OH 1
+ATOM 80 N N . SER A 1 27 ? -22.246 -34.752 24.196 1.00 14.71 ? 11 SER A N 1
+ATOM 81 C CA . SER A 1 27 ? -22.278 -36.182 24.453 1.00 18.99 ? 11 SER A CA 1
+ATOM 82 C C . SER A 1 27 ? -21.095 -36.824 23.745 1.00 26.22 ? 11 SER A C 1
+ATOM 83 O O . SER A 1 27 ? -20.511 -36.226 22.843 1.00 17.77 ? 11 SER A O 1
+ATOM 84 C CB . SER A 1 27 ? -23.588 -36.798 23.968 1.00 25.75 ? 11 SER A CB 1
+ATOM 85 O OG . SER A 1 27 ? -23.676 -36.728 22.555 1.00 21.39 ? 11 SER A OG 1
+ATOM 86 N N . ALA A 1 28 ? -20.740 -38.036 24.154 1.00 21.90 ? 12 ALA A N 1
+ATOM 87 C CA . ALA A 1 28 ? -19.678 -38.772 23.483 1.00 33.21 ? 12 ALA A CA 1
+ATOM 88 C C . ALA A 1 28 ? -19.970 -38.890 21.984 1.00 36.65 ? 12 ALA A C 1
+ATOM 89 O O . ALA A 1 28 ? -19.079 -38.716 21.161 1.00 25.09 ? 12 ALA A O 1
+ATOM 90 C CB . ALA A 1 28 ? -19.508 -40.145 24.107 1.00 20.86 ? 12 ALA A CB 1
+ATOM 91 N N . GLY A 1 29 ? -21.229 -39.155 21.643 1.00 20.71 ? 13 GLY A N 1
+ATOM 92 C CA . GLY A 1 29 ? -21.645 -39.277 20.255 1.00 16.52 ? 13 GLY A CA 1
+ATOM 93 C C . GLY A 1 29 ? -21.457 -38.010 19.435 1.00 15.56 ? 13 GLY A C 1
+ATOM 94 O O . GLY A 1 29 ? -20.927 -38.057 18.325 1.00 22.99 ? 13 GLY A O 1
+ATOM 95 N N . GLN A 1 30 ? -21.895 -36.880 19.979 1.00 16.69 ? 14 GLN A N 1
+ATOM 96 C CA . GLN A 1 30 ? -21.751 -35.594 19.303 1.00 17.80 ? 14 GLN A CA 1
+ATOM 97 C C . GLN A 1 30 ? -20.278 -35.245 19.109 1.00 18.67 ? 14 GLN A C 1
+ATOM 98 O O . GLN A 1 30 ? -19.853 -34.855 18.016 1.00 14.80 ? 14 GLN A O 1
+ATOM 99 C CB . GLN A 1 30 ? -22.447 -34.484 20.100 1.00 13.81 ? 14 GLN A CB 1
+ATOM 100 C CG . GLN A 1 30 ? -23.974 -34.519 20.054 1.00 20.21 ? 14 GLN A CG 1
+ATOM 101 C CD . GLN A 1 30 ? -24.611 -33.586 21.071 1.00 27.57 ? 14 GLN A CD 1
+ATOM 102 O OE1 . GLN A 1 30 ? -24.069 -33.367 22.154 1.00 18.58 ? 14 GLN A OE1 1
+ATOM 103 N NE2 . GLN A 1 30 ? -25.766 -33.028 20.723 1.00 18.97 ? 14 GLN A NE2 1
+ATOM 104 N N . PHE A 1 31 ? -19.504 -35.389 20.180 1.00 15.81 ? 15 PHE A N 1
+ATOM 105 C CA . PHE A 1 31 ? -18.092 -35.037 20.158 1.00 28.24 ? 15 PHE A CA 1
+ATOM 106 C C . PHE A 1 31 ? -17.314 -35.865 19.147 1.00 22.39 ? 15 PHE A C 1
+ATOM 107 O O . PHE A 1 31 ? -16.498 -35.329 18.396 1.00 17.72 ? 15 PHE A O 1
+ATOM 108 C CB . PHE A 1 31 ? -17.471 -35.208 21.542 1.00 17.11 ? 15 PHE A CB 1
+ATOM 109 C CG . PHE A 1 31 ? -16.017 -34.866 21.588 1.00 15.75 ? 15 PHE A CG 1
+ATOM 110 C CD1 . PHE A 1 31 ? -15.610 -33.548 21.703 1.00 21.11 ? 15 PHE A CD1 1
+ATOM 111 C CD2 . PHE A 1 31 ? -15.054 -35.858 21.504 1.00 17.61 ? 15 PHE A CD2 1
+ATOM 112 C CE1 . PHE A 1 31 ? -14.270 -33.226 21.731 1.00 23.41 ? 15 PHE A CE1 1
+ATOM 113 C CE2 . PHE A 1 31 ? -13.715 -35.541 21.533 1.00 29.19 ? 15 PHE A CE2 1
+ATOM 114 C CZ . PHE A 1 31 ? -13.324 -34.220 21.650 1.00 18.60 ? 15 PHE A CZ 1
+ATOM 115 N N . GLU A 1 32 ? -17.569 -37.169 19.132 1.00 18.64 ? 16 GLU A N 1
+ATOM 116 C CA . GLU A 1 32 ? -16.843 -38.075 18.249 1.00 24.48 ? 16 GLU A CA 1
+ATOM 117 C C . GLU A 1 32 ? -17.251 -37.895 16.791 1.00 20.70 ? 16 GLU A C 1
+ATOM 118 O O . GLU A 1 32 ? -16.428 -38.048 15.889 1.00 23.64 ? 16 GLU A O 1
+ATOM 119 C CB . GLU A 1 32 ? -17.054 -39.527 18.679 1.00 20.83 ? 16 GLU A CB 1
+ATOM 120 C CG . GLU A 1 32 ? -16.348 -39.885 19.981 1.00 56.27 ? 16 GLU A CG 1
+ATOM 121 C CD . GLU A 1 32 ? -16.623 -41.309 20.427 1.00 86.66 ? 16 GLU A CD 1
+ATOM 122 O OE1 . GLU A 1 32 ? -17.221 -42.077 19.643 1.00 77.64 ? 16 GLU A OE1 1
+ATOM 123 O OE2 . GLU A 1 32 ? -16.242 -41.657 21.565 1.00 74.85 ? 16 GLU A OE2 1
+ATOM 124 N N . PHE A 1 33 ? -18.517 -37.560 16.558 1.00 22.16 ? 17 PHE A N 1
+ATOM 125 C CA . PHE A 1 33 ? -18.986 -37.356 15.193 1.00 13.84 ? 17 PHE A CA 1
+ATOM 126 C C . PHE A 1 33 ? -18.312 -36.140 14.566 1.00 14.25 ? 17 PHE A C 1
+ATOM 127 O O . PHE A 1 33 ? -17.898 -36.182 13.410 1.00 16.79 ? 17 PHE A O 1
+ATOM 128 C CB . PHE A 1 33 ? -20.505 -37.196 15.147 1.00 15.24 ? 17 PHE A CB 1
+ATOM 129 C CG . PHE A 1 33 ? -21.051 -37.039 13.752 1.00 26.23 ? 17 PHE A CG 1
+ATOM 130 C CD1 . PHE A 1 33 ? -20.772 -37.985 12.776 1.00 20.84 ? 17 PHE A CD1 1
+ATOM 131 C CD2 . PHE A 1 33 ? -21.841 -35.954 13.418 1.00 22.68 ? 17 PHE A CD2 1
+ATOM 132 C CE1 . PHE A 1 33 ? -21.269 -37.848 11.488 1.00 24.86 ? 17 PHE A CE1 1
+ATOM 133 C CE2 . PHE A 1 33 ? -22.345 -35.810 12.134 1.00 31.02 ? 17 PHE A CE2 1
+ATOM 134 C CZ . PHE A 1 33 ? -22.060 -36.760 11.167 1.00 21.25 ? 17 PHE A CZ 1
+ATOM 135 N N . ILE A 1 34 ? -18.195 -35.062 15.335 1.00 21.13 ? 18 ILE A N 1
+ATOM 136 C CA . ILE A 1 34 ? -17.534 -33.854 14.850 1.00 24.95 ? 18 ILE A CA 1
+ATOM 137 C C . ILE A 1 34 ? -16.046 -34.104 14.607 1.00 14.72 ? 18 ILE A C 1
+ATOM 138 O O . ILE A 1 34 ? -15.480 -33.624 13.623 1.00 17.92 ? 18 ILE A O 1
+ATOM 139 C CB . ILE A 1 34 ? -17.731 -32.687 15.832 1.00 17.24 ? 18 ILE A CB 1
+ATOM 140 C CG1 . ILE A 1 34 ? -19.175 -32.172 15.731 1.00 12.47 ? 18 ILE A CG1 1
+ATOM 141 C CG2 . ILE A 1 34 ? -16.737 -31.564 15.552 1.00 11.25 ? 18 ILE A CG2 1
+ATOM 142 C CD1 . ILE A 1 34 ? -19.493 -31.044 16.689 1.00 16.24 ? 18 ILE A CD1 1
+ATOM 143 N N . ASP A 1 35 ? -15.423 -34.879 15.488 1.00 12.91 ? 19 ASP A N 1
+ATOM 144 C CA . ASP A 1 35 ? -14.030 -35.272 15.301 1.00 18.43 ? 19 ASP A CA 1
+ATOM 145 C C . ASP A 1 35 ? -13.847 -36.069 14.007 1.00 24.10 ? 19 ASP A C 1
+ATOM 146 O O . ASP A 1 35 ? -12.900 -35.842 13.254 1.00 14.39 ? 19 ASP A O 1
+ATOM 147 C CB . ASP A 1 35 ? -13.542 -36.094 16.494 1.00 22.02 ? 19 ASP A CB 1
+ATOM 148 C CG . ASP A 1 35 ? -12.053 -36.385 16.431 1.00 23.86 ? 19 ASP A CG 1
+ATOM 149 O OD1 . ASP A 1 35 ? -11.275 -35.457 16.123 1.00 27.71 ? 19 ASP A OD1 1
+ATOM 150 O OD2 . ASP A 1 35 ? -11.665 -37.544 16.675 1.00 39.50 ? 19 ASP A OD2 1
+ATOM 151 N N . HIS A 1 36 ? -14.762 -37.000 13.756 1.00 12.18 ? 20 HIS A N 1
+ATOM 152 C CA . HIS A 1 36 ? -14.718 -37.826 12.547 1.00 23.42 ? 20 HIS A CA 1
+ATOM 153 C C . HIS A 1 36 ? -14.979 -37.014 11.284 1.00 21.28 ? 20 HIS A C 1
+ATOM 154 O O . HIS A 1 36 ? -14.345 -37.242 10.257 1.00 19.97 ? 20 HIS A O 1
+ATOM 155 C CB . HIS A 1 36 ? -15.733 -38.968 12.639 1.00 20.85 ? 20 HIS A CB 1
+ATOM 156 C CG . HIS A 1 36 ? -15.395 -39.992 13.679 1.00 58.86 ? 20 HIS A CG 1
+ATOM 157 N ND1 . HIS A 1 36 ? -16.335 -40.846 14.216 1.00 49.09 ? 20 HIS A ND1 1
+ATOM 158 C CD2 . HIS A 1 36 ? -14.221 -40.298 14.278 1.00 45.57 ? 20 HIS A CD2 1
+ATOM 159 C CE1 . HIS A 1 36 ? -15.753 -41.633 15.104 1.00 41.81 ? 20 HIS A CE1 1
+ATOM 160 N NE2 . HIS A 1 36 ? -14.472 -41.322 15.161 1.00 45.98 ? 20 HIS A NE2 1
+ATOM 161 N N . LEU A 1 37 ? -15.921 -36.077 11.360 1.00 14.73 ? 21 LEU A N 1
+ATOM 162 C CA . LEU A 1 37 ? -16.209 -35.199 10.230 1.00 19.39 ? 21 LEU A CA 1
+ATOM 163 C C . LEU A 1 37 ? -14.964 -34.435 9.799 1.00 17.49 ? 21 LEU A C 1
+ATOM 164 O O . LEU A 1 37 ? -14.637 -34.382 8.614 1.00 15.82 ? 21 LEU A O 1
+ATOM 165 C CB . LEU A 1 37 ? -17.322 -34.207 10.573 1.00 15.27 ? 21 LEU A CB 1
+ATOM 166 C CG . LEU A 1 37 ? -18.764 -34.702 10.475 1.00 30.65 ? 21 LEU A CG 1
+ATOM 167 C CD1 . LEU A 1 37 ? -19.728 -33.578 10.842 1.00 24.64 ? 21 LEU A CD1 1
+ATOM 168 C CD2 . LEU A 1 37 ? -19.050 -35.229 9.075 1.00 26.54 ? 21 LEU A CD2 1
+ATOM 169 N N . LEU A 1 38 ? -14.277 -33.846 10.773 1.00 17.48 ? 22 LEU A N 1
+ATOM 170 C CA . LEU A 1 38 ? -13.087 -33.044 10.499 1.00 15.53 ? 22 LEU A CA 1
+ATOM 171 C C . LEU A 1 38 ? -11.930 -33.907 10.000 1.00 19.17 ? 22 LEU A C 1
+ATOM 172 O O . LEU A 1 38 ? -11.239 -33.543 9.048 1.00 21.15 ? 22 LEU A O 1
+ATOM 173 C CB . LEU A 1 38 ? -12.672 -32.270 11.752 1.00 11.76 ? 22 LEU A CB 1
+ATOM 174 C CG . LEU A 1 38 ? -13.693 -31.245 12.257 1.00 20.05 ? 22 LEU A CG 1
+ATOM 175 C CD1 . LEU A 1 38 ? -13.302 -30.707 13.623 1.00 13.59 ? 22 LEU A CD1 1
+ATOM 176 C CD2 . LEU A 1 38 ? -13.854 -30.107 11.254 1.00 20.73 ? 22 LEU A CD2 1
+ATOM 177 N N . THR A 1 39 ? -11.725 -35.050 10.648 1.00 19.58 ? 23 THR A N 1
+ATOM 178 C CA . THR A 1 39 ? -10.681 -35.989 10.250 1.00 23.62 ? 23 THR A CA 1
+ATOM 179 C C . THR A 1 39 ? -10.909 -36.506 8.830 1.00 23.69 ? 23 THR A C 1
+ATOM 180 O O . THR A 1 39 ? -9.977 -36.562 8.030 1.00 23.68 ? 23 THR A O 1
+ATOM 181 C CB . THR A 1 39 ? -10.603 -37.185 11.222 1.00 27.32 ? 23 THR A CB 1
+ATOM 182 O OG1 . THR A 1 39 ? -10.354 -36.705 12.548 1.00 28.59 ? 23 THR A OG1 1
+ATOM 183 C CG2 . THR A 1 39 ? -9.483 -38.134 10.819 1.00 26.61 ? 23 THR A CG2 1
+ATOM 184 N N . MET A 1 40 ? -12.150 -36.879 8.523 1.00 19.54 ? 24 MET A N 1
+ATOM 185 C CA . MET A 1 40 ? -12.506 -37.331 7.181 1.00 22.24 ? 24 MET A CA 1
+ATOM 186 C C . MET A 1 40 ? -12.262 -36.235 6.151 1.00 18.49 ? 24 MET A C 1
+ATOM 187 O O . MET A 1 40 ? -11.790 -36.505 5.049 1.00 17.72 ? 24 MET A O 1
+ATOM 188 C CB . MET A 1 40 ? -13.970 -37.771 7.119 1.00 29.65 ? 24 MET A CB 1
+ATOM 189 C CG . MET A 1 40 ? -14.419 -38.207 5.730 1.00 33.23 ? 24 MET A CG 1
+ATOM 190 S SD . MET A 1 40 ? -16.212 -38.312 5.552 1.00 56.71 ? 24 MET A SD 1
+ATOM 191 C CE . MET A 1 40 ? -16.686 -36.592 5.703 1.00 33.47 ? 24 MET A CE 1
+ATOM 192 N N . GLY A 1 41 ? -12.604 -35.002 6.515 1.00 15.44 ? 25 GLY A N 1
+ATOM 193 C CA . GLY A 1 41 ? -12.359 -33.857 5.660 1.00 17.43 ? 25 GLY A CA 1
+ATOM 194 C C . GLY A 1 41 ? -10.887 -33.723 5.307 1.00 23.98 ? 25 GLY A C 1
+ATOM 195 O O . GLY A 1 41 ? -10.540 -33.407 4.174 1.00 20.11 ? 25 GLY A O 1
+ATOM 196 N N . VAL A 1 42 ? -10.020 -33.972 6.281 1.00 19.63 ? 26 VAL A N 1
+ATOM 197 C CA . VAL A 1 42 ? -8.579 -33.891 6.055 1.00 18.21 ? 26 VAL A CA 1
+ATOM 198 C C . VAL A 1 42 ? -8.133 -34.930 5.034 1.00 18.06 ? 26 VAL A C 1
+ATOM 199 O O . VAL A 1 42 ? -7.411 -34.617 4.090 1.00 20.88 ? 26 VAL A O 1
+ATOM 200 C CB . VAL A 1 42 ? -7.790 -34.088 7.363 1.00 23.04 ? 26 VAL A CB 1
+ATOM 201 C CG1 . VAL A 1 42 ? -6.297 -34.168 7.083 1.00 20.32 ? 26 VAL A CG1 1
+ATOM 202 C CG2 . VAL A 1 42 ? -8.090 -32.958 8.334 1.00 16.05 ? 26 VAL A CG2 1
+ATOM 203 N N . GLY A 1 43 ? -8.577 -36.168 5.232 1.00 15.42 ? 27 GLY A N 1
+ATOM 204 C CA . GLY A 1 43 ? -8.220 -37.262 4.351 1.00 25.45 ? 27 GLY A CA 1
+ATOM 205 C C . GLY A 1 43 ? -8.688 -37.055 2.924 1.00 18.03 ? 27 GLY A C 1
+ATOM 206 O O . GLY A 1 43 ? -7.953 -37.343 1.985 1.00 23.27 ? 27 GLY A O 1
+ATOM 207 N N . VAL A 1 44 ? -9.909 -36.554 2.758 1.00 20.74 ? 28 VAL A N 1
+ATOM 208 C CA . VAL A 1 44 ? -10.451 -36.311 1.422 1.00 17.75 ? 28 VAL A CA 1
+ATOM 209 C C . VAL A 1 44 ? -9.630 -35.270 0.660 1.00 19.29 ? 28 VAL A C 1
+ATOM 210 O O . VAL A 1 44 ? -9.330 -35.448 -0.521 1.00 20.57 ? 28 VAL A O 1
+ATOM 211 C CB . VAL A 1 44 ? -11.920 -35.851 1.481 1.00 16.37 ? 28 VAL A CB 1
+ATOM 212 C CG1 . VAL A 1 44 ? -12.383 -35.355 0.122 1.00 19.64 ? 28 VAL A CG1 1
+ATOM 213 C CG2 . VAL A 1 44 ? -12.812 -36.992 1.968 1.00 17.52 ? 28 VAL A CG2 1
+ATOM 214 N N . HIS A 1 45 ? -9.253 -34.190 1.336 1.00 12.57 ? 29 HIS A N 1
+ATOM 215 C CA . HIS A 1 45 ? -8.529 -33.115 0.664 1.00 14.87 ? 29 HIS A CA 1
+ATOM 216 C C . HIS A 1 45 ? -7.109 -33.526 0.282 1.00 19.01 ? 29 HIS A C 1
+ATOM 217 O O . HIS A 1 45 ? -6.649 -33.216 -0.815 1.00 17.84 ? 29 HIS A O 1
+ATOM 218 C CB . HIS A 1 45 ? -8.503 -31.855 1.535 1.00 12.55 ? 29 HIS A CB 1
+ATOM 219 C CG . HIS A 1 45 ? -9.807 -31.119 1.558 1.00 32.52 ? 29 HIS A CG 1
+ATOM 220 N ND1 . HIS A 1 45 ? -10.863 -31.497 2.359 1.00 29.76 ? 29 HIS A ND1 1
+ATOM 221 C CD2 . HIS A 1 45 ? -10.235 -30.040 0.858 1.00 26.84 ? 29 HIS A CD2 1
+ATOM 222 C CE1 . HIS A 1 45 ? -11.880 -30.677 2.162 1.00 31.38 ? 29 HIS A CE1 1
+ATOM 223 N NE2 . HIS A 1 45 ? -11.524 -29.784 1.255 1.00 21.00 ? 29 HIS A NE2 1
+ATOM 224 N N . PHE A 1 46 ? -6.416 -34.236 1.166 1.00 17.54 ? 30 PHE A N 1
+ATOM 225 C CA . PHE A 1 46 ? -5.048 -34.636 0.853 1.00 29.17 ? 30 PHE A CA 1
+ATOM 226 C C . PHE A 1 46 ? -5.018 -35.794 -0.140 1.00 28.28 ? 30 PHE A C 1
+ATOM 227 O O . PHE A 1 46 ? -4.062 -35.939 -0.899 1.00 21.16 ? 30 PHE A O 1
+ATOM 228 C CB . PHE A 1 46 ? -4.280 -34.982 2.129 1.00 20.05 ? 30 PHE A CB 1
+ATOM 229 C CG . PHE A 1 46 ? -3.761 -33.770 2.850 1.00 17.08 ? 30 PHE A CG 1
+ATOM 230 C CD1 . PHE A 1 46 ? -2.571 -33.175 2.458 1.00 25.62 ? 30 PHE A CD1 1
+ATOM 231 C CD2 . PHE A 1 46 ? -4.478 -33.203 3.887 1.00 16.11 ? 30 PHE A CD2 1
+ATOM 232 C CE1 . PHE A 1 46 ? -2.099 -32.048 3.102 1.00 22.51 ? 30 PHE A CE1 1
+ATOM 233 C CE2 . PHE A 1 46 ? -4.010 -32.080 4.537 1.00 21.97 ? 30 PHE A CE2 1
+ATOM 234 C CZ . PHE A 1 46 ? -2.819 -31.500 4.143 1.00 28.54 ? 30 PHE A CZ 1
+ATOM 235 N N . ALA A 1 47 ? -6.071 -36.605 -0.146 1.00 23.97 ? 31 ALA A N 1
+ATOM 236 C CA . ALA A 1 47 ? -6.219 -37.633 -1.171 1.00 27.90 ? 31 ALA A CA 1
+ATOM 237 C C . ALA A 1 47 ? -6.395 -36.980 -2.540 1.00 29.06 ? 31 ALA A C 1
+ATOM 238 O O . ALA A 1 47 ? -5.756 -37.378 -3.516 1.00 20.00 ? 31 ALA A O 1
+ATOM 239 C CB . ALA A 1 47 ? -7.392 -38.539 -0.859 1.00 19.49 ? 31 ALA A CB 1
+ATOM 240 N N . ALA A 1 48 ? -7.261 -35.972 -2.601 1.00 16.51 ? 32 ALA A N 1
+ATOM 241 C CA . ALA A 1 48 ? -7.505 -35.242 -3.843 1.00 20.55 ? 32 ALA A CA 1
+ATOM 242 C C . ALA A 1 48 ? -6.246 -34.511 -4.304 1.00 20.88 ? 32 ALA A C 1
+ATOM 243 O O . ALA A 1 48 ? -5.978 -34.415 -5.500 1.00 19.04 ? 32 ALA A O 1
+ATOM 244 C CB . ALA A 1 48 ? -8.657 -34.259 -3.665 1.00 12.37 ? 32 ALA A CB 1
+ATOM 245 N N . LEU A 1 49 ? -5.477 -34.008 -3.342 1.00 20.18 ? 33 LEU A N 1
+ATOM 246 C CA . LEU A 1 49 ? -4.220 -33.325 -3.626 1.00 21.57 ? 33 LEU A CA 1
+ATOM 247 C C . LEU A 1 49 ? -3.308 -34.180 -4.501 1.00 21.77 ? 33 LEU A C 1
+ATOM 248 O O . LEU A 1 49 ? -2.718 -33.691 -5.461 1.00 21.67 ? 33 LEU A O 1
+ATOM 249 C CB . LEU A 1 49 ? -3.501 -32.966 -2.324 1.00 18.53 ? 33 LEU A CB 1
+ATOM 250 C CG . LEU A 1 49 ? -2.036 -32.541 -2.452 1.00 23.44 ? 33 LEU A CG 1
+ATOM 251 C CD1 . LEU A 1 49 ? -1.909 -31.213 -3.179 1.00 23.77 ? 33 LEU A CD1 1
+ATOM 252 C CD2 . LEU A 1 49 ? -1.388 -32.466 -1.088 1.00 17.15 ? 33 LEU A CD2 1
+ATOM 253 N N . ILE A 1 50 ? -3.208 -35.461 -4.166 1.00 21.48 ? 34 ILE A N 1
+ATOM 254 C CA . ILE A 1 50 ? -2.357 -36.375 -4.914 1.00 27.92 ? 34 ILE A CA 1
+ATOM 255 C C . ILE A 1 50 ? -2.900 -36.583 -6.320 1.00 28.26 ? 34 ILE A C 1
+ATOM 256 O O . ILE A 1 50 ? -2.137 -36.688 -7.273 1.00 22.37 ? 34 ILE A O 1
+ATOM 257 C CB . ILE A 1 50 ? -2.223 -37.733 -4.208 1.00 24.65 ? 34 ILE A CB 1
+ATOM 258 C CG1 . ILE A 1 50 ? -1.721 -37.535 -2.777 1.00 22.08 ? 34 ILE A CG1 1
+ATOM 259 C CG2 . ILE A 1 50 ? -1.282 -38.645 -4.980 1.00 45.09 ? 34 ILE A CG2 1
+ATOM 260 C CD1 . ILE A 1 50 ? -0.409 -36.774 -2.683 1.00 31.16 ? 34 ILE A CD1 1
+ATOM 261 N N . PHE A 1 51 ? -4.222 -36.632 -6.451 1.00 19.48 ? 35 PHE A N 1
+ATOM 262 C CA . PHE A 1 51 ? -4.830 -36.753 -7.770 1.00 16.00 ? 35 PHE A CA 1
+ATOM 263 C C . PHE A 1 51 ? -4.510 -35.553 -8.654 1.00 16.51 ? 35 PHE A C 1
+ATOM 264 O O . PHE A 1 51 ? -4.119 -35.717 -9.812 1.00 16.75 ? 35 PHE A O 1
+ATOM 265 C CB . PHE A 1 51 ? -6.347 -36.912 -7.673 1.00 20.26 ? 35 PHE A CB 1
+ATOM 266 C CG . PHE A 1 51 ? -7.024 -36.969 -9.011 1.00 30.99 ? 35 PHE A CG 1
+ATOM 267 C CD1 . PHE A 1 51 ? -7.083 -38.159 -9.716 1.00 28.15 ? 35 PHE A CD1 1
+ATOM 268 C CD2 . PHE A 1 51 ? -7.582 -35.830 -9.575 1.00 19.79 ? 35 PHE A CD2 1
+ATOM 269 C CE1 . PHE A 1 51 ? -7.696 -38.216 -10.953 1.00 40.10 ? 35 PHE A CE1 1
+ATOM 270 C CE2 . PHE A 1 51 ? -8.193 -35.880 -10.809 1.00 24.68 ? 35 PHE A CE2 1
+ATOM 271 C CZ . PHE A 1 51 ? -8.253 -37.077 -11.499 1.00 35.81 ? 35 PHE A CZ 1
+ATOM 272 N N . PHE A 1 52 ? -4.703 -34.350 -8.119 1.00 16.79 ? 36 PHE A N 1
+ATOM 273 C CA . PHE A 1 52 ? -4.447 -33.134 -8.886 1.00 17.19 ? 36 PHE A CA 1
+ATOM 274 C C . PHE A 1 52 ? -2.976 -33.044 -9.277 1.00 27.70 ? 36 PHE A C 1
+ATOM 275 O O . PHE A 1 52 ? -2.643 -32.599 -10.378 1.00 16.74 ? 36 PHE A O 1
+ATOM 276 C CB . PHE A 1 52 ? -4.857 -31.885 -8.095 1.00 17.38 ? 36 PHE A CB 1
+ATOM 277 C CG . PHE A 1 52 ? -6.345 -31.740 -7.908 1.00 17.05 ? 36 PHE A CG 1
+ATOM 278 C CD1 . PHE A 1 52 ? -7.192 -31.673 -9.004 1.00 20.47 ? 36 PHE A CD1 1
+ATOM 279 C CD2 . PHE A 1 52 ? -6.893 -31.647 -6.639 1.00 22.57 ? 36 PHE A CD2 1
+ATOM 280 C CE1 . PHE A 1 52 ? -8.563 -31.533 -8.837 1.00 21.98 ? 36 PHE A CE1 1
+ATOM 281 C CE2 . PHE A 1 52 ? -8.263 -31.506 -6.464 1.00 19.15 ? 36 PHE A CE2 1
+ATOM 282 C CZ . PHE A 1 52 ? -9.098 -31.450 -7.566 1.00 17.94 ? 36 PHE A CZ 1
+ATOM 283 N N . LEU A 1 53 ? -2.099 -33.473 -8.371 1.00 19.76 ? 37 LEU A N 1
+ATOM 284 C CA . LEU A 1 53 ? -0.662 -33.440 -8.625 1.00 19.05 ? 37 LEU A CA 1
+ATOM 285 C C . LEU A 1 53 ? -0.296 -34.281 -9.843 1.00 18.43 ? 37 LEU A C 1
+ATOM 286 O O . LEU A 1 53 ? 0.377 -33.802 -10.753 1.00 25.90 ? 37 LEU A O 1
+ATOM 287 C CB . LEU A 1 53 ? 0.119 -33.926 -7.397 1.00 18.04 ? 37 LEU A CB 1
+ATOM 288 C CG . LEU A 1 53 ? 1.639 -34.055 -7.549 1.00 26.04 ? 37 LEU A CG 1
+ATOM 289 C CD1 . LEU A 1 53 ? 2.271 -32.704 -7.831 1.00 25.11 ? 37 LEU A CD1 1
+ATOM 290 C CD2 . LEU A 1 53 ? 2.263 -34.689 -6.310 1.00 32.29 ? 37 LEU A CD2 1
+ATOM 291 N N . VAL A 1 54 ? -0.757 -35.526 -9.870 1.00 14.48 ? 38 VAL A N 1
+ATOM 292 C CA . VAL A 1 54 ? -0.354 -36.443 -10.929 1.00 32.82 ? 38 VAL A CA 1
+ATOM 293 C C . VAL A 1 54 ? -1.006 -36.121 -12.280 1.00 22.56 ? 38 VAL A C 1
+ATOM 294 O O . VAL A 1 54 ? -0.435 -36.420 -13.323 1.00 26.07 ? 38 VAL A O 1
+ATOM 295 C CB . VAL A 1 54 ? -0.663 -37.909 -10.550 1.00 27.67 ? 38 VAL A CB 1
+ATOM 296 C CG1 . VAL A 1 54 ? 0.038 -38.275 -9.243 1.00 25.68 ? 38 VAL A CG1 1
+ATOM 297 C CG2 . VAL A 1 54 ? -2.158 -38.138 -10.431 1.00 71.35 ? 38 VAL A CG2 1
+ATOM 298 N N . VAL A 1 55 ? -2.186 -35.505 -12.265 1.00 18.69 ? 39 VAL A N 1
+ATOM 299 C CA . VAL A 1 55 ? -2.892 -35.195 -13.509 1.00 21.55 ? 39 VAL A CA 1
+ATOM 300 C C . VAL A 1 55 ? -2.380 -33.876 -14.117 1.00 9.36 ? 39 VAL A C 1
+ATOM 301 O O . VAL A 1 55 ? -2.574 -33.605 -15.303 1.00 15.20 ? 39 VAL A O 1
+ATOM 302 C CB . VAL A 1 55 ? -4.433 -35.150 -13.269 1.00 22.17 ? 39 VAL A CB 1
+ATOM 303 C CG1 . VAL A 1 55 ? -5.190 -34.671 -14.496 1.00 58.73 ? 39 VAL A CG1 1
+ATOM 304 C CG2 . VAL A 1 55 ? -4.934 -36.531 -12.870 1.00 25.59 ? 39 VAL A CG2 1
+ATOM 305 N N . SER A 1 56 ? -1.685 -33.076 -13.314 1.00 15.37 ? 40 SER A N 1
+ATOM 306 C CA . SER A 1 56 ? -1.187 -31.777 -13.776 1.00 20.37 ? 40 SER A CA 1
+ATOM 307 C C . SER A 1 56 ? -0.282 -31.874 -15.011 1.00 19.27 ? 40 SER A C 1
+ATOM 308 O O . SER A 1 56 ? -0.213 -30.943 -15.811 1.00 17.12 ? 40 SER A O 1
+ATOM 309 C CB . SER A 1 56 ? -0.438 -31.066 -12.645 1.00 16.82 ? 40 SER A CB 1
+ATOM 310 O OG . SER A 1 56 ? 0.669 -31.836 -12.208 1.00 26.49 ? 40 SER A OG 1
+ATOM 311 N N . GLN A 1 57 ? 0.399 -33.003 -15.172 1.00 16.97 ? 41 GLN A N 1
+ATOM 312 C CA . GLN A 1 57 ? 1.290 -33.201 -16.318 1.00 21.20 ? 41 GLN A CA 1
+ATOM 313 C C . GLN A 1 57 ? 0.523 -33.369 -17.628 1.00 26.47 ? 41 GLN A C 1
+ATOM 314 O O . GLN A 1 57 ? 1.115 -33.342 -18.709 1.00 22.23 ? 41 GLN A O 1
+ATOM 315 C CB . GLN A 1 57 ? 2.180 -34.424 -16.094 1.00 22.28 ? 41 GLN A CB 1
+ATOM 316 C CG . GLN A 1 57 ? 1.392 -35.719 -15.979 1.00 28.71 ? 41 GLN A CG 1
+ATOM 317 C CD . GLN A 1 57 ? 2.248 -36.886 -15.541 1.00 41.64 ? 41 GLN A CD 1
+ATOM 318 O OE1 . GLN A 1 57 ? 3.236 -37.226 -16.191 1.00 40.40 ? 41 GLN A OE1 1
+ATOM 319 N NE2 . GLN A 1 57 ? 1.876 -37.503 -14.424 1.00 31.09 ? 41 GLN A NE2 1
+ATOM 320 N N . PHE A 1 58 ? -0.790 -33.555 -17.532 1.00 16.48 ? 42 PHE A N 1
+ATOM 321 C CA . PHE A 1 58 ? -1.613 -33.729 -18.726 1.00 16.45 ? 42 PHE A CA 1
+ATOM 322 C C . PHE A 1 58 ? -2.335 -32.442 -19.096 1.00 25.05 ? 42 PHE A C 1
+ATOM 323 O O . PHE A 1 58 ? -3.167 -32.428 -19.998 1.00 26.86 ? 42 PHE A O 1
+ATOM 324 C CB . PHE A 1 58 ? -2.622 -34.863 -18.531 1.00 19.14 ? 42 PHE A CB 1
+ATOM 325 C CG . PHE A 1 58 ? -1.995 -36.163 -18.116 1.00 25.90 ? 42 PHE A CG 1
+ATOM 326 C CD1 . PHE A 1 58 ? -1.008 -36.747 -18.892 1.00 25.04 ? 42 PHE A CD1 1
+ATOM 327 C CD2 . PHE A 1 58 ? -2.397 -36.805 -16.957 1.00 32.26 ? 42 PHE A CD2 1
+ATOM 328 C CE1 . PHE A 1 58 ? -0.425 -37.943 -18.516 1.00 24.83 ? 42 PHE A CE1 1
+ATOM 329 C CE2 . PHE A 1 58 ? -1.821 -38.002 -16.576 1.00 30.74 ? 42 PHE A CE2 1
+ATOM 330 C CZ . PHE A 1 58 ? -0.835 -38.572 -17.354 1.00 28.17 ? 42 PHE A CZ 1
+ATOM 331 N N . VAL A 1 59 ? -2.007 -31.360 -18.399 1.00 19.71 ? 43 VAL A N 1
+ATOM 332 C CA . VAL A 1 59 ? -2.614 -30.060 -18.669 1.00 19.09 ? 43 VAL A CA 1
+ATOM 333 C C . VAL A 1 59 ? -1.669 -29.163 -19.464 1.00 13.55 ? 43 VAL A C 1
+ATOM 334 O O . VAL A 1 59 ? -0.484 -29.072 -19.148 1.00 15.91 ? 43 VAL A O 1
+ATOM 335 C CB . VAL A 1 59 ? -2.999 -29.337 -17.370 1.00 20.02 ? 43 VAL A CB 1
+ATOM 336 C CG1 . VAL A 1 59 ? -3.713 -28.037 -17.682 1.00 18.69 ? 43 VAL A CG1 1
+ATOM 337 C CG2 . VAL A 1 59 ? -3.870 -30.230 -16.502 1.00 19.60 ? 43 VAL A CG2 1
+ATOM 338 N N . ALA A 1 60 ? -2.195 -28.500 -20.490 1.00 18.92 ? 44 ALA A N 1
+ATOM 339 C CA . ALA A 1 60 ? -1.396 -27.568 -21.282 1.00 21.63 ? 44 ALA A CA 1
+ATOM 340 C C . ALA A 1 60 ? -0.905 -26.410 -20.412 1.00 26.16 ? 44 ALA A C 1
+ATOM 341 O O . ALA A 1 60 ? -1.550 -26.066 -19.420 1.00 20.51 ? 44 ALA A O 1
+ATOM 342 C CB . ALA A 1 60 ? -2.203 -27.050 -22.466 1.00 18.14 ? 44 ALA A CB 1
+ATOM 343 N N . PRO A 1 61 ? 0.246 -25.815 -20.776 1.00 20.93 ? 45 PRO A N 1
+ATOM 344 C CA . PRO A 1 61 ? 0.864 -24.739 -19.990 1.00 21.16 ? 45 PRO A CA 1
+ATOM 345 C C . PRO A 1 61 ? -0.076 -23.577 -19.683 1.00 21.59 ? 45 PRO A C 1
+ATOM 346 O O . PRO A 1 61 ? -0.009 -23.024 -18.589 1.00 27.39 ? 45 PRO A O 1
+ATOM 347 C CB . PRO A 1 61 ? 2.013 -24.270 -20.889 1.00 28.81 ? 45 PRO A CB 1
+ATOM 348 C CG . PRO A 1 61 ? 2.374 -25.475 -21.685 1.00 26.21 ? 45 PRO A CG 1
+ATOM 349 C CD . PRO A 1 61 ? 1.076 -26.190 -21.938 1.00 17.58 ? 45 PRO A CD 1
+ATOM 350 N N . LYS A 1 62 ? -0.944 -23.219 -20.625 1.00 24.42 ? 46 LYS A N 1
+ATOM 351 C CA . LYS A 1 62 ? -1.828 -22.076 -20.421 1.00 29.81 ? 46 LYS A CA 1
+ATOM 352 C C . LYS A 1 62 ? -2.913 -22.345 -19.373 1.00 19.38 ? 46 LYS A C 1
+ATOM 353 O O . LYS A 1 62 ? -3.503 -21.407 -18.846 1.00 18.73 ? 46 LYS A O 1
+ATOM 354 C CB . LYS A 1 62 ? -2.476 -21.652 -21.742 1.00 30.58 ? 46 LYS A CB 1
+ATOM 355 C CG . LYS A 1 62 ? -3.453 -22.657 -22.330 1.00 35.53 ? 46 LYS A CG 1
+ATOM 356 C CD . LYS A 1 62 ? -4.299 -22.013 -23.423 1.00 41.81 ? 46 LYS A CD 1
+ATOM 357 C CE . LYS A 1 62 ? -5.121 -20.859 -22.862 1.00 57.77 ? 46 LYS A CE 1
+ATOM 358 N NZ . LYS A 1 62 ? -5.957 -20.190 -23.897 1.00 50.64 ? 46 LYS A NZ 1
+ATOM 359 N N . TYR A 1 63 ? -3.168 -23.615 -19.062 1.00 15.32 ? 47 TYR A N 1
+ATOM 360 C CA . TYR A 1 63 ? -4.166 -23.961 -18.043 1.00 19.51 ? 47 TYR A CA 1
+ATOM 361 C C . TYR A 1 63 ? -3.574 -24.588 -16.778 1.00 27.85 ? 47 TYR A C 1
+ATOM 362 O O . TYR A 1 63 ? -4.288 -24.778 -15.793 1.00 25.24 ? 47 TYR A O 1
+ATOM 363 C CB . TYR A 1 63 ? -5.205 -24.936 -18.607 1.00 22.10 ? 47 TYR A CB 1
+ATOM 364 C CG . TYR A 1 63 ? -5.991 -24.435 -19.792 1.00 25.46 ? 47 TYR A CG 1
+ATOM 365 C CD1 . TYR A 1 63 ? -6.820 -23.326 -19.685 1.00 18.03 ? 47 TYR A CD1 1
+ATOM 366 C CD2 . TYR A 1 63 ? -5.920 -25.088 -21.017 1.00 20.20 ? 47 TYR A CD2 1
+ATOM 367 C CE1 . TYR A 1 63 ? -7.548 -22.874 -20.771 1.00 15.53 ? 47 TYR A CE1 1
+ATOM 368 C CE2 . TYR A 1 63 ? -6.644 -24.644 -22.107 1.00 25.98 ? 47 TYR A CE2 1
+ATOM 369 C CZ . TYR A 1 63 ? -7.457 -23.537 -21.979 1.00 16.96 ? 47 TYR A CZ 1
+ATOM 370 O OH . TYR A 1 63 ? -8.178 -23.094 -23.065 1.00 22.05 ? 47 TYR A OH 1
+ATOM 371 N N . ARG A 1 64 ? -2.284 -24.919 -16.803 1.00 25.97 ? 48 ARG A N 1
+ATOM 372 C CA . ARG A 1 64 ? -1.702 -25.780 -15.769 1.00 24.72 ? 48 ARG A CA 1
+ATOM 373 C C . ARG A 1 64 ? -1.778 -25.160 -14.374 1.00 27.42 ? 48 ARG A C 1
+ATOM 374 O O . ARG A 1 64 ? -1.850 -25.873 -13.374 1.00 29.02 ? 48 ARG A O 1
+ATOM 375 C CB . ARG A 1 64 ? -0.250 -26.121 -16.114 1.00 18.38 ? 48 ARG A CB 1
+ATOM 376 C CG . ARG A 1 64 ? 0.313 -27.310 -15.337 1.00 30.63 ? 48 ARG A CG 1
+ATOM 377 C CD . ARG A 1 64 ? 1.678 -27.738 -15.872 1.00 32.60 ? 48 ARG A CD 1
+ATOM 378 N NE . ARG A 1 64 ? 1.604 -28.193 -17.258 1.00 26.92 ? 48 ARG A NE 1
+ATOM 379 C CZ . ARG A 1 64 ? 2.460 -27.841 -18.211 1.00 26.65 ? 48 ARG A CZ 1
+ATOM 380 N NH1 . ARG A 1 64 ? 3.468 -27.025 -17.934 1.00 19.35 ? 48 ARG A NH1 1
+ATOM 381 N NH2 . ARG A 1 64 ? 2.308 -28.304 -19.444 1.00 18.13 ? 48 ARG A NH2 1
+ATOM 382 N N . ILE A 1 65 ? -1.776 -23.834 -14.314 1.00 16.36 ? 49 ILE A N 1
+ATOM 383 C CA . ILE A 1 65 ? -1.903 -23.124 -13.046 1.00 19.43 ? 49 ILE A CA 1
+ATOM 384 C C . ILE A 1 65 ? -3.294 -23.322 -12.414 1.00 27.98 ? 49 ILE A C 1
+ATOM 385 O O . ILE A 1 65 ? -3.447 -23.264 -11.195 1.00 21.50 ? 49 ILE A O 1
+ATOM 386 C CB . ILE A 1 65 ? -1.614 -21.620 -13.241 1.00 21.25 ? 49 ILE A CB 1
+ATOM 387 C CG1 . ILE A 1 65 ? -1.885 -20.831 -11.958 1.00 22.40 ? 49 ILE A CG1 1
+ATOM 388 C CG2 . ILE A 1 65 ? -2.414 -21.075 -14.412 1.00 60.12 ? 49 ILE A CG2 1
+ATOM 389 C CD1 . ILE A 1 65 ? -1.561 -19.359 -12.070 1.00 73.09 ? 49 ILE A CD1 1
+ATOM 390 N N . ALA A 1 66 ? -4.307 -23.571 -13.238 1.00 18.14 ? 50 ALA A N 1
+ATOM 391 C CA . ALA A 1 66 ? -5.637 -23.853 -12.710 1.00 25.84 ? 50 ALA A CA 1
+ATOM 392 C C . ALA A 1 66 ? -5.612 -25.131 -11.876 1.00 22.59 ? 50 ALA A C 1
+ATOM 393 O O . ALA A 1 66 ? -6.274 -25.225 -10.839 1.00 20.43 ? 50 ALA A O 1
+ATOM 394 C CB . ALA A 1 66 ? -6.659 -23.967 -13.839 1.00 26.04 ? 50 ALA A CB 1
+ATOM 395 N N . THR A 1 67 ? -4.833 -26.109 -12.324 1.00 21.70 ? 51 THR A N 1
+ATOM 396 C CA . THR A 1 67 ? -4.717 -27.375 -11.611 1.00 13.01 ? 51 THR A CA 1
+ATOM 397 C C . THR A 1 67 ? -3.806 -27.227 -10.395 1.00 14.82 ? 51 THR A C 1
+ATOM 398 O O . THR A 1 67 ? -4.038 -27.854 -9.359 1.00 19.10 ? 51 THR A O 1
+ATOM 399 C CB . THR A 1 67 ? -4.203 -28.491 -12.538 1.00 28.13 ? 51 THR A CB 1
+ATOM 400 O OG1 . THR A 1 67 ? -5.131 -28.669 -13.616 1.00 26.57 ? 51 THR A OG1 1
+ATOM 401 C CG2 . THR A 1 67 ? -4.068 -29.809 -11.781 1.00 25.38 ? 51 THR A CG2 1
+ATOM 402 N N . ALA A 1 68 ? -2.786 -26.379 -10.513 1.00 15.82 ? 52 ALA A N 1
+ATOM 403 C CA . ALA A 1 68 ? -1.895 -26.100 -9.389 1.00 19.37 ? 52 ALA A CA 1
+ATOM 404 C C . ALA A 1 68 ? -2.651 -25.424 -8.249 1.00 21.96 ? 52 ALA A C 1
+ATOM 405 O O . ALA A 1 68 ? -2.399 -25.701 -7.078 1.00 17.15 ? 52 ALA A O 1
+ATOM 406 C CB . ALA A 1 68 ? -0.722 -25.232 -9.830 1.00 14.10 ? 52 ALA A CB 1
+ATOM 407 N N . LEU A 1 69 ? -3.575 -24.533 -8.597 1.00 18.42 ? 53 LEU A N 1
+ATOM 408 C CA . LEU A 1 69 ? -4.376 -23.839 -7.592 1.00 15.56 ? 53 LEU A CA 1
+ATOM 409 C C . LEU A 1 69 ? -5.251 -24.822 -6.810 1.00 10.96 ? 53 LEU A C 1
+ATOM 410 O O . LEU A 1 69 ? -5.523 -24.619 -5.626 1.00 17.27 ? 53 LEU A O 1
+ATOM 411 C CB . LEU A 1 69 ? -5.233 -22.757 -8.248 1.00 15.37 ? 53 LEU A CB 1
+ATOM 412 C CG . LEU A 1 69 ? -4.459 -21.493 -8.641 1.00 21.26 ? 53 LEU A CG 1
+ATOM 413 C CD1 . LEU A 1 69 ? -5.277 -20.600 -9.563 1.00 17.27 ? 53 LEU A CD1 1
+ATOM 414 C CD2 . LEU A 1 69 ? -4.038 -20.729 -7.397 1.00 19.33 ? 53 LEU A CD2 1
+ATOM 415 N N . SER A 1 70 ? -5.678 -25.895 -7.466 1.00 12.55 ? 54 SER A N 1
+ATOM 416 C CA . SER A 1 70 ? -6.431 -26.927 -6.766 1.00 12.93 ? 54 SER A CA 1
+ATOM 417 C C . SER A 1 70 ? -5.551 -27.625 -5.735 1.00 23.26 ? 54 SER A C 1
+ATOM 418 O O . SER A 1 70 ? -6.020 -27.963 -4.653 1.00 20.30 ? 54 SER A O 1
+ATOM 419 C CB . SER A 1 70 ? -7.025 -27.940 -7.746 1.00 17.37 ? 54 SER A CB 1
+ATOM 420 O OG . SER A 1 70 ? -8.279 -27.488 -8.232 1.00 21.14 ? 54 SER A OG 1
+ATOM 421 N N . CYS A 1 71 ? -4.278 -27.831 -6.060 1.00 16.76 ? 55 CYS A N 1
+ATOM 422 C CA . CYS A 1 71 ? -3.343 -28.405 -5.092 1.00 14.80 ? 55 CYS A CA 1
+ATOM 423 C C . CYS A 1 71 ? -3.180 -27.475 -3.901 1.00 12.60 ? 55 CYS A C 1
+ATOM 424 O O . CYS A 1 71 ? -3.192 -27.910 -2.746 1.00 18.12 ? 55 CYS A O 1
+ATOM 425 C CB . CYS A 1 71 ? -1.982 -28.673 -5.734 1.00 18.31 ? 55 CYS A CB 1
+ATOM 426 S SG . CYS A 1 71 ? -1.989 -30.002 -6.943 1.00 22.08 ? 55 CYS A SG 1
+ATOM 427 N N . ILE A 1 72 ? -3.030 -26.189 -4.198 1.00 15.93 ? 56 ILE A N 1
+ATOM 428 C CA . ILE A 1 72 ? -2.895 -25.163 -3.175 1.00 17.17 ? 56 ILE A CA 1
+ATOM 429 C C . ILE A 1 72 ? -4.128 -25.115 -2.269 1.00 28.82 ? 56 ILE A C 1
+ATOM 430 O O . ILE A 1 72 ? -4.002 -25.011 -1.051 1.00 20.36 ? 56 ILE A O 1
+ATOM 431 C CB . ILE A 1 72 ? -2.653 -23.776 -3.815 1.00 22.70 ? 56 ILE A CB 1
+ATOM 432 C CG1 . ILE A 1 72 ? -1.266 -23.732 -4.466 1.00 22.73 ? 56 ILE A CG1 1
+ATOM 433 C CG2 . ILE A 1 72 ? -2.798 -22.667 -2.787 1.00 13.95 ? 56 ILE A CG2 1
+ATOM 434 C CD1 . ILE A 1 72 ? -0.967 -22.436 -5.193 1.00 35.73 ? 56 ILE A CD1 1
+ATOM 435 N N . VAL A 1 73 ? -5.314 -25.211 -2.859 1.00 14.21 ? 57 VAL A N 1
+ATOM 436 C CA . VAL A 1 73 ? -6.551 -25.190 -2.075 1.00 17.37 ? 57 VAL A CA 1
+ATOM 437 C C . VAL A 1 73 ? -6.684 -26.446 -1.212 1.00 16.54 ? 57 VAL A C 1
+ATOM 438 O O . VAL A 1 73 ? -7.140 -26.375 -0.069 1.00 15.86 ? 57 VAL A O 1
+ATOM 439 C CB . VAL A 1 73 ? -7.794 -25.053 -2.981 1.00 20.56 ? 57 VAL A CB 1
+ATOM 440 C CG1 . VAL A 1 73 ? -9.082 -25.329 -2.191 1.00 16.05 ? 57 VAL A CG1 1
+ATOM 441 C CG2 . VAL A 1 73 ? -7.839 -23.670 -3.602 1.00 21.67 ? 57 VAL A CG2 1
+ATOM 442 N N . MET A 1 74 ? -6.267 -27.589 -1.754 1.00 17.78 ? 58 MET A N 1
+ATOM 443 C CA . MET A 1 74 ? -6.356 -28.848 -1.021 1.00 17.78 ? 58 MET A CA 1
+ATOM 444 C C . MET A 1 74 ? -5.530 -28.807 0.264 1.00 13.34 ? 58 MET A C 1
+ATOM 445 O O . MET A 1 74 ? -5.986 -29.258 1.314 1.00 15.60 ? 58 MET A O 1
+ATOM 446 C CB . MET A 1 74 ? -5.905 -30.025 -1.893 1.00 14.77 ? 58 MET A CB 1
+ATOM 447 C CG . MET A 1 74 ? -6.870 -30.416 -3.018 1.00 14.32 ? 58 MET A CG 1
+ATOM 448 S SD . MET A 1 74 ? -8.566 -30.707 -2.469 1.00 19.33 ? 58 MET A SD 1
+ATOM 449 C CE . MET A 1 74 ? -9.381 -29.206 -3.020 1.00 16.09 ? 58 MET A CE 1
+ATOM 450 N N . VAL A 1 75 ? -4.314 -28.273 0.192 1.00 13.30 ? 59 VAL A N 1
+ATOM 451 C CA . VAL A 1 75 ? -3.461 -28.267 1.375 1.00 14.70 ? 59 VAL A CA 1
+ATOM 452 C C . VAL A 1 75 ? -3.951 -27.213 2.359 1.00 12.72 ? 59 VAL A C 1
+ATOM 453 O O . VAL A 1 75 ? -3.947 -27.436 3.568 1.00 15.67 ? 59 VAL A O 1
+ATOM 454 C CB . VAL A 1 75 ? -1.961 -28.032 1.019 1.00 16.16 ? 59 VAL A CB 1
+ATOM 455 C CG1 . VAL A 1 75 ? -1.767 -26.744 0.241 1.00 30.62 ? 59 VAL A CG1 1
+ATOM 456 C CG2 . VAL A 1 75 ? -1.104 -28.026 2.276 1.00 18.07 ? 59 VAL A CG2 1
+ATOM 457 N N . SER A 1 76 ? -4.395 -26.073 1.834 1.00 17.90 ? 60 SER A N 1
+ATOM 458 C CA . SER A 1 76 ? -4.887 -24.975 2.661 1.00 20.58 ? 60 SER A CA 1
+ATOM 459 C C . SER A 1 76 ? -6.124 -25.399 3.455 1.00 24.97 ? 60 SER A C 1
+ATOM 460 O O . SER A 1 76 ? -6.185 -25.233 4.677 1.00 19.77 ? 60 SER A O 1
+ATOM 461 C CB . SER A 1 76 ? -5.206 -23.756 1.787 1.00 20.18 ? 60 SER A CB 1
+ATOM 462 O OG . SER A 1 76 ? -5.615 -22.650 2.570 1.00 32.41 ? 60 SER A OG 1
+ATOM 463 N N . ALA A 1 77 ? -7.106 -25.952 2.751 1.00 13.23 ? 61 ALA A N 1
+ATOM 464 C CA . ALA A 1 77 ? -8.311 -26.468 3.393 1.00 13.32 ? 61 ALA A CA 1
+ATOM 465 C C . ALA A 1 77 ? -7.990 -27.655 4.300 1.00 19.28 ? 61 ALA A C 1
+ATOM 466 O O . ALA A 1 77 ? -8.541 -27.779 5.386 1.00 19.72 ? 61 ALA A O 1
+ATOM 467 C CB . ALA A 1 77 ? -9.334 -26.868 2.346 1.00 22.02 ? 61 ALA A CB 1
+ATOM 468 N N . GLY A 1 78 ? -7.105 -28.534 3.842 1.00 14.54 ? 62 GLY A N 1
+ATOM 469 C CA . GLY A 1 78 ? -6.695 -29.682 4.631 1.00 15.16 ? 62 GLY A CA 1
+ATOM 470 C C . GLY A 1 78 ? -6.021 -29.292 5.936 1.00 17.91 ? 62 GLY A C 1
+ATOM 471 O O . GLY A 1 78 ? -6.214 -29.942 6.961 1.00 16.68 ? 62 GLY A O 1
+ATOM 472 N N . LEU A 1 79 ? -5.232 -28.222 5.903 1.00 13.88 ? 63 LEU A N 1
+ATOM 473 C CA . LEU A 1 79 ? -4.550 -27.749 7.105 1.00 21.54 ? 63 LEU A CA 1
+ATOM 474 C C . LEU A 1 79 ? -5.512 -27.081 8.091 1.00 18.36 ? 63 LEU A C 1
+ATOM 475 O O . LEU A 1 79 ? -5.363 -27.222 9.306 1.00 12.59 ? 63 LEU A O 1
+ATOM 476 C CB . LEU A 1 79 ? -3.425 -26.780 6.734 1.00 14.29 ? 63 LEU A CB 1
+ATOM 477 C CG . LEU A 1 79 ? -2.150 -27.404 6.158 1.00 21.12 ? 63 LEU A CG 1
+ATOM 478 C CD1 . LEU A 1 79 ? -1.172 -26.316 5.746 1.00 16.26 ? 63 LEU A CD1 1
+ATOM 479 C CD2 . LEU A 1 79 ? -1.505 -28.355 7.157 1.00 14.58 ? 63 LEU A CD2 1
+ATOM 480 N N . ILE A 1 80 ? -6.496 -26.348 7.578 1.00 14.51 ? 64 ILE A N 1
+ATOM 481 C CA . ILE A 1 80 ? -7.439 -25.680 8.468 1.00 15.19 ? 64 ILE A CA 1
+ATOM 482 C C . ILE A 1 80 ? -8.355 -26.727 9.108 1.00 13.91 ? 64 ILE A C 1
+ATOM 483 O O . ILE A 1 80 ? -8.688 -26.624 10.284 1.00 16.30 ? 64 ILE A O 1
+ATOM 484 C CB . ILE A 1 80 ? -8.270 -24.575 7.743 1.00 21.11 ? 64 ILE A CB 1
+ATOM 485 C CG1 . ILE A 1 80 ? -8.985 -23.690 8.764 1.00 46.65 ? 64 ILE A CG1 1
+ATOM 486 C CG2 . ILE A 1 80 ? -9.280 -25.157 6.774 1.00 39.82 ? 64 ILE A CG2 1
+ATOM 487 C CD1 . ILE A 1 80 ? -8.041 -22.915 9.659 1.00 47.79 ? 64 ILE A CD1 1
+ATOM 488 N N . LEU A 1 81 ? -8.720 -27.758 8.353 1.00 12.29 ? 65 LEU A N 1
+ATOM 489 C CA . LEU A 1 81 ? -9.511 -28.851 8.905 1.00 12.31 ? 65 LEU A CA 1
+ATOM 490 C C . LEU A 1 81 ? -8.719 -29.629 9.956 1.00 19.02 ? 65 LEU A C 1
+ATOM 491 O O . LEU A 1 81 ? -9.255 -29.975 11.005 1.00 12.21 ? 65 LEU A O 1
+ATOM 492 C CB . LEU A 1 81 ? -9.977 -29.791 7.796 1.00 16.36 ? 65 LEU A CB 1
+ATOM 493 C CG . LEU A 1 81 ? -11.034 -29.212 6.851 1.00 19.83 ? 65 LEU A CG 1
+ATOM 494 C CD1 . LEU A 1 81 ? -11.450 -30.240 5.812 1.00 15.31 ? 65 LEU A CD1 1
+ATOM 495 C CD2 . LEU A 1 81 ? -12.226 -28.742 7.646 1.00 21.04 ? 65 LEU A CD2 1
+ATOM 496 N N . ASN A 1 82 ? -7.448 -29.905 9.661 1.00 11.43 ? 66 ASN A N 1
+ATOM 497 C CA . ASN A 1 82 ? -6.557 -30.575 10.608 1.00 13.55 ? 66 ASN A CA 1
+ATOM 498 C C . ASN A 1 82 ? -6.420 -29.769 11.889 1.00 18.41 ? 66 ASN A C 1
+ATOM 499 O O . ASN A 1 82 ? -6.492 -30.311 12.995 1.00 15.84 ? 66 ASN A O 1
+ATOM 500 C CB . ASN A 1 82 ? -5.177 -30.809 9.975 1.00 13.17 ? 66 ASN A CB 1
+ATOM 501 C CG . ASN A 1 82 ? -4.204 -31.483 10.925 1.00 26.41 ? 66 ASN A CG 1
+ATOM 502 O OD1 . ASN A 1 82 ? -4.331 -32.667 11.222 1.00 24.71 ? 66 ASN A OD1 1
+ATOM 503 N ND2 . ASN A 1 82 ? -3.217 -30.731 11.394 1.00 24.05 ? 66 ASN A ND2 1
+ATOM 504 N N . SER A 1 83 ? -6.236 -28.464 11.725 1.00 17.08 ? 67 SER A N 1
+ATOM 505 C CA . SER A 1 83 ? -6.120 -27.543 12.848 1.00 16.36 ? 67 SER A CA 1
+ATOM 506 C C . SER A 1 83 ? -7.392 -27.526 13.697 1.00 23.58 ? 67 SER A C 1
+ATOM 507 O O . SER A 1 83 ? -7.321 -27.540 14.922 1.00 19.05 ? 67 SER A O 1
+ATOM 508 C CB . SER A 1 83 ? -5.800 -26.131 12.343 1.00 21.14 ? 67 SER A CB 1
+ATOM 509 O OG . SER A 1 83 ? -5.679 -25.214 13.417 1.00 20.00 ? 67 SER A OG 1
+ATOM 510 N N . GLN A 1 84 ? -8.553 -27.495 13.045 1.00 13.41 ? 68 GLN A N 1
+ATOM 511 C CA . GLN A 1 84 ? -9.823 -27.526 13.763 1.00 17.21 ? 68 GLN A CA 1
+ATOM 512 C C . GLN A 1 84 ? -9.981 -28.821 14.557 1.00 16.69 ? 68 GLN A C 1
+ATOM 513 O O . GLN A 1 84 ? -10.489 -28.805 15.674 1.00 20.40 ? 68 GLN A O 1
+ATOM 514 C CB . GLN A 1 84 ? -11.007 -27.368 12.800 1.00 13.17 ? 68 GLN A CB 1
+ATOM 515 C CG . GLN A 1 84 ? -11.119 -26.007 12.128 1.00 16.82 ? 68 GLN A CG 1
+ATOM 516 C CD . GLN A 1 84 ? -11.461 -24.891 13.094 1.00 33.91 ? 68 GLN A CD 1
+ATOM 517 O OE1 . GLN A 1 84 ? -10.597 -24.108 13.491 1.00 29.08 ? 68 GLN A OE1 1
+ATOM 518 N NE2 . GLN A 1 84 ? -12.729 -24.803 13.468 1.00 24.39 ? 68 GLN A NE2 1
+ATOM 519 N N . ALA A 1 85 ? -9.554 -29.938 13.973 1.00 14.54 ? 69 ALA A N 1
+ATOM 520 C CA . ALA A 1 85 ? -9.717 -31.244 14.611 1.00 13.85 ? 69 ALA A CA 1
+ATOM 521 C C . ALA A 1 85 ? -8.883 -31.339 15.881 1.00 22.06 ? 69 ALA A C 1
+ATOM 522 O O . ALA A 1 85 ? -9.340 -31.852 16.900 1.00 15.55 ? 69 ALA A O 1
+ATOM 523 C CB . ALA A 1 85 ? -9.339 -32.363 13.646 1.00 11.64 ? 69 ALA A CB 1
+ATOM 524 N N . VAL A 1 86 ? -7.652 -30.843 15.813 1.00 11.75 ? 70 VAL A N 1
+ATOM 525 C CA . VAL A 1 86 ? -6.764 -30.882 16.968 1.00 14.36 ? 70 VAL A CA 1
+ATOM 526 C C . VAL A 1 86 ? -7.227 -29.879 18.017 1.00 15.19 ? 70 VAL A C 1
+ATOM 527 O O . VAL A 1 86 ? -7.137 -30.143 19.214 1.00 19.27 ? 70 VAL A O 1
+ATOM 528 C CB . VAL A 1 86 ? -5.306 -30.601 16.574 1.00 14.94 ? 70 VAL A CB 1
+ATOM 529 C CG1 . VAL A 1 86 ? -4.400 -30.713 17.792 1.00 25.01 ? 70 VAL A CG1 1
+ATOM 530 C CG2 . VAL A 1 86 ? -4.861 -31.578 15.499 1.00 18.12 ? 70 VAL A CG2 1
+ATOM 531 N N . MET A 1 87 ? -7.746 -28.739 17.562 1.00 12.12 ? 71 MET A N 1
+ATOM 532 C CA . MET A 1 87 ? -8.335 -27.749 18.464 1.00 19.79 ? 71 MET A CA 1
+ATOM 533 C C . MET A 1 87 ? -9.549 -28.321 19.197 1.00 32.69 ? 71 MET A C 1
+ATOM 534 O O . MET A 1 87 ? -9.787 -28.010 20.363 1.00 18.64 ? 71 MET A O 1
+ATOM 535 C CB . MET A 1 87 ? -8.746 -26.489 17.695 1.00 14.72 ? 71 MET A CB 1
+ATOM 536 C CG . MET A 1 87 ? -7.629 -25.487 17.479 1.00 25.88 ? 71 MET A CG 1
+ATOM 537 S SD . MET A 1 87 ? -8.137 -24.114 16.425 1.00 36.93 ? 71 MET A SD 1
+ATOM 538 C CE . MET A 1 87 ? -9.696 -23.663 17.181 1.00 16.95 ? 71 MET A CE 1
+ATOM 539 N N . TRP A 1 88 ? -10.314 -29.151 18.495 1.00 15.80 ? 72 TRP A N 1
+ATOM 540 C CA . TRP A 1 88 ? -11.512 -29.780 19.048 1.00 17.19 ? 72 TRP A CA 1
+ATOM 541 C C . TRP A 1 88 ? -11.136 -30.719 20.190 1.00 15.62 ? 72 TRP A C 1
+ATOM 542 O O . TRP A 1 88 ? -11.715 -30.656 21.273 1.00 18.11 ? 72 TRP A O 1
+ATOM 543 C CB . TRP A 1 88 ? -12.262 -30.531 17.939 1.00 18.59 ? 72 TRP A CB 1
+ATOM 544 C CG . TRP A 1 88 ? -13.581 -31.169 18.330 1.00 12.79 ? 72 TRP A CG 1
+ATOM 545 C CD1 . TRP A 1 88 ? -13.889 -32.501 18.292 1.00 16.07 ? 72 TRP A CD1 1
+ATOM 546 C CD2 . TRP A 1 88 ? -14.766 -30.499 18.782 1.00 10.85 ? 72 TRP A CD2 1
+ATOM 547 N NE1 . TRP A 1 88 ? -15.185 -32.701 18.700 1.00 13.91 ? 72 TRP A NE1 1
+ATOM 548 C CE2 . TRP A 1 88 ? -15.746 -31.489 19.007 1.00 19.90 ? 72 TRP A CE2 1
+ATOM 549 C CE3 . TRP A 1 88 ? -15.095 -29.159 19.019 1.00 14.23 ? 72 TRP A CE3 1
+ATOM 550 C CZ2 . TRP A 1 88 ? -17.031 -31.182 19.461 1.00 12.96 ? 72 TRP A CZ2 1
+ATOM 551 C CZ3 . TRP A 1 88 ? -16.369 -28.857 19.471 1.00 22.96 ? 72 TRP A CZ3 1
+ATOM 552 C CH2 . TRP A 1 88 ? -17.321 -29.864 19.688 1.00 23.30 ? 72 TRP A CH2 1
+ATOM 553 N N . THR A 1 89 ? -10.144 -31.571 19.949 1.00 13.47 ? 73 THR A N 1
+ATOM 554 C CA . THR A 1 89 ? -9.698 -32.527 20.958 1.00 16.24 ? 73 THR A CA 1
+ATOM 555 C C . THR A 1 89 ? -8.920 -31.855 22.098 1.00 24.14 ? 73 THR A C 1
+ATOM 556 O O . THR A 1 89 ? -8.952 -32.330 23.234 1.00 23.07 ? 73 THR A O 1
+ATOM 557 C CB . THR A 1 89 ? -8.837 -33.644 20.331 1.00 22.21 ? 73 THR A CB 1
+ATOM 558 O OG1 . THR A 1 89 ? -7.785 -33.067 19.547 1.00 29.70 ? 73 THR A OG1 1
+ATOM 559 C CG2 . THR A 1 89 ? -9.691 -34.527 19.439 1.00 22.62 ? 73 THR A CG2 1
+ATOM 560 N N . ASP A 1 90 ? -8.235 -30.751 21.803 1.00 19.92 ? 74 ASP A N 1
+ATOM 561 C CA . ASP A 1 90 ? -7.541 -29.983 22.840 1.00 18.40 ? 74 ASP A CA 1
+ATOM 562 C C . ASP A 1 90 ? -8.516 -29.332 23.819 1.00 23.71 ? 74 ASP A C 1
+ATOM 563 O O . ASP A 1 90 ? -8.291 -29.320 25.029 1.00 21.31 ? 74 ASP A O 1
+ATOM 564 C CB . ASP A 1 90 ? -6.663 -28.888 22.223 1.00 15.87 ? 74 ASP A CB 1
+ATOM 565 C CG . ASP A 1 90 ? -5.307 -29.400 21.763 1.00 28.03 ? 74 ASP A CG 1
+ATOM 566 O OD1 . ASP A 1 90 ? -4.934 -30.539 22.116 1.00 24.10 ? 74 ASP A OD1 1
+ATOM 567 O OD2 . ASP A 1 90 ? -4.607 -28.645 21.053 1.00 29.00 ? 74 ASP A OD2 1
+ATOM 568 N N . ALA A 1 91 ? -9.595 -28.776 23.284 1.00 16.72 ? 75 ALA A N 1
+ATOM 569 C CA . ALA A 1 91 ? -10.505 -27.957 24.076 1.00 13.60 ? 75 ALA A CA 1
+ATOM 570 C C . ALA A 1 91 ? -11.430 -28.772 24.972 1.00 19.08 ? 75 ALA A C 1
+ATOM 571 O O . ALA A 1 91 ? -11.908 -28.266 25.983 1.00 20.37 ? 75 ALA A O 1
+ATOM 572 C CB . ALA A 1 91 ? -11.334 -27.061 23.159 1.00 13.71 ? 75 ALA A CB 1
+ATOM 573 N N . TYR A 1 92 ? -11.702 -30.021 24.610 1.00 15.37 ? 76 TYR A N 1
+ATOM 574 C CA . TYR A 1 92 ? -12.700 -30.786 25.360 1.00 18.06 ? 76 TYR A CA 1
+ATOM 575 C C . TYR A 1 92 ? -12.162 -32.092 25.936 1.00 31.28 ? 76 TYR A C 1
+ATOM 576 O O . TYR A 1 92 ? -11.353 -32.781 25.313 1.00 22.15 ? 76 TYR A O 1
+ATOM 577 C CB . TYR A 1 92 ? -13.925 -31.066 24.480 1.00 13.95 ? 76 TYR A CB 1
+ATOM 578 C CG . TYR A 1 92 ? -14.719 -29.815 24.162 1.00 20.80 ? 76 TYR A CG 1
+ATOM 579 C CD1 . TYR A 1 92 ? -15.752 -29.392 24.991 1.00 13.50 ? 76 TYR A CD1 1
+ATOM 580 C CD2 . TYR A 1 92 ? -14.420 -29.048 23.042 1.00 22.23 ? 76 TYR A CD2 1
+ATOM 581 C CE1 . TYR A 1 92 ? -16.472 -28.237 24.709 1.00 9.45 ? 76 TYR A CE1 1
+ATOM 582 C CE2 . TYR A 1 92 ? -15.131 -27.898 22.748 1.00 22.35 ? 76 TYR A CE2 1
+ATOM 583 C CZ . TYR A 1 92 ? -16.152 -27.495 23.582 1.00 12.14 ? 76 TYR A CZ 1
+ATOM 584 O OH . TYR A 1 92 ? -16.850 -26.348 23.287 1.00 23.49 ? 76 TYR A OH 1
+ATOM 585 N N . ALA A 1 93 ? -12.620 -32.413 27.142 1.00 23.44 ? 77 ALA A N 1
+ATOM 586 C CA . ALA A 1 93 ? -12.248 -33.656 27.809 1.00 14.82 ? 77 ALA A CA 1
+ATOM 587 C C . ALA A 1 93 ? -13.481 -34.325 28.398 1.00 21.03 ? 77 ALA A C 1
+ATOM 588 O O . ALA A 1 93 ? -14.435 -33.653 28.791 1.00 12.65 ? 77 ALA A O 1
+ATOM 589 C CB . ALA A 1 93 ? -11.220 -33.398 28.901 1.00 13.85 ? 77 ALA A CB 1
+ATOM 590 N N . TYR A 1 94 ? -13.455 -35.649 28.473 1.00 14.38 ? 78 TYR A N 1
+ATOM 591 C CA . TYR A 1 94 ? -14.594 -36.381 29.010 1.00 22.11 ? 78 TYR A CA 1
+ATOM 592 C C . TYR A 1 94 ? -14.609 -36.272 30.527 1.00 20.68 ? 78 TYR A C 1
+ATOM 593 O O . TYR A 1 94 ? -13.767 -36.856 31.205 1.00 24.60 ? 78 TYR A O 1
+ATOM 594 C CB . TYR A 1 94 ? -14.559 -37.847 28.576 1.00 27.37 ? 78 TYR A CB 1
+ATOM 595 C CG . TYR A 1 94 ? -15.870 -38.565 28.800 1.00 26.16 ? 78 TYR A CG 1
+ATOM 596 C CD1 . TYR A 1 94 ? -16.970 -38.304 27.993 1.00 24.18 ? 78 TYR A CD1 1
+ATOM 597 C CD2 . TYR A 1 94 ? -16.009 -39.504 29.815 1.00 39.00 ? 78 TYR A CD2 1
+ATOM 598 C CE1 . TYR A 1 94 ? -18.172 -38.954 28.191 1.00 31.13 ? 78 TYR A CE1 1
+ATOM 599 C CE2 . TYR A 1 94 ? -17.209 -40.162 30.019 1.00 36.06 ? 78 TYR A CE2 1
+ATOM 600 C CZ . TYR A 1 94 ? -18.287 -39.883 29.204 1.00 28.99 ? 78 TYR A CZ 1
+ATOM 601 O OH . TYR A 1 94 ? -19.484 -40.533 29.401 1.00 66.58 ? 78 TYR A OH 1
+ATOM 602 N N . VAL A 1 95 ? -15.564 -35.505 31.048 1.00 16.43 ? 79 VAL A N 1
+ATOM 603 C CA . VAL A 1 95 ? -15.677 -35.268 32.482 1.00 14.89 ? 79 VAL A CA 1
+ATOM 604 C C . VAL A 1 95 ? -17.115 -35.451 32.968 1.00 21.26 ? 79 VAL A C 1
+ATOM 605 O O . VAL A 1 95 ? -18.032 -34.792 32.473 1.00 20.40 ? 79 VAL A O 1
+ATOM 606 C CB . VAL A 1 95 ? -15.214 -33.847 32.866 1.00 19.57 ? 79 VAL A CB 1
+ATOM 607 C CG1 . VAL A 1 95 ? -15.484 -33.587 34.344 1.00 20.89 ? 79 VAL A CG1 1
+ATOM 608 C CG2 . VAL A 1 95 ? -13.741 -33.648 32.540 1.00 23.38 ? 79 VAL A CG2 1
+ATOM 609 N N . ASP A 1 96 ? -17.295 -36.339 33.942 1.00 20.43 ? 80 ASP A N 1
+ATOM 610 C CA . ASP A 1 96 ? -18.603 -36.611 34.543 1.00 31.54 ? 80 ASP A CA 1
+ATOM 611 C C . ASP A 1 96 ? -19.682 -36.919 33.502 1.00 22.47 ? 80 ASP A C 1
+ATOM 612 O O . ASP A 1 96 ? -20.789 -36.384 33.566 1.00 27.45 ? 80 ASP A O 1
+ATOM 613 C CB . ASP A 1 96 ? -19.049 -35.432 35.415 1.00 25.30 ? 80 ASP A CB 1
+ATOM 614 C CG . ASP A 1 96 ? -18.110 -35.176 36.585 1.00 46.55 ? 80 ASP A CG 1
+ATOM 615 O OD1 . ASP A 1 96 ? -17.379 -36.107 36.986 1.00 35.88 ? 80 ASP A OD1 1
+ATOM 616 O OD2 . ASP A 1 96 ? -18.103 -34.040 37.105 1.00 40.32 ? 80 ASP A OD2 1
+ATOM 617 N N . GLY A 1 97 ? -19.352 -37.767 32.536 1.00 25.68 ? 81 GLY A N 1
+ATOM 618 C CA . GLY A 1 97 ? -20.343 -38.254 31.592 1.00 31.48 ? 81 GLY A CA 1
+ATOM 619 C C . GLY A 1 97 ? -20.529 -37.471 30.301 1.00 21.75 ? 81 GLY A C 1
+ATOM 620 O O . GLY A 1 97 ? -21.368 -37.836 29.479 1.00 37.17 ? 81 GLY A O 1
+ATOM 621 N N . SER A 1 98 ? -19.764 -36.400 30.112 1.00 28.99 ? 82 SER A N 1
+ATOM 622 C CA . SER A 1 98 ? -19.864 -35.617 28.880 1.00 19.27 ? 82 SER A CA 1
+ATOM 623 C C . SER A 1 98 ? -18.565 -34.879 28.569 1.00 18.93 ? 82 SER A C 1
+ATOM 624 O O . SER A 1 98 ? -17.725 -34.678 29.447 1.00 15.90 ? 82 SER A O 1
+ATOM 625 C CB . SER A 1 98 ? -21.021 -34.614 28.969 1.00 12.91 ? 82 SER A CB 1
+ATOM 626 O OG . SER A 1 98 ? -20.709 -33.532 29.830 1.00 25.49 ? 82 SER A OG 1
+ATOM 627 N N . TYR A 1 99 ? -18.404 -34.476 27.314 1.00 13.23 ? 83 TYR A N 1
+ATOM 628 C CA . TYR A 1 99 ? -17.239 -33.698 26.923 1.00 13.57 ? 83 TYR A CA 1
+ATOM 629 C C . TYR A 1 99 ? -17.447 -32.241 27.309 1.00 16.33 ? 83 TYR A C 1
+ATOM 630 O O . TYR A 1 99 ? -18.415 -31.606 26.887 1.00 18.74 ? 83 TYR A O 1
+ATOM 631 C CB . TYR A 1 99 ? -16.966 -33.852 25.423 1.00 10.56 ? 83 TYR A CB 1
+ATOM 632 C CG . TYR A 1 99 ? -16.253 -35.152 25.118 1.00 18.01 ? 83 TYR A CG 1
+ATOM 633 C CD1 . TYR A 1 99 ? -14.865 -35.230 25.168 1.00 12.82 ? 83 TYR A CD1 1
+ATOM 634 C CD2 . TYR A 1 99 ? -16.966 -36.307 24.826 1.00 17.11 ? 83 TYR A CD2 1
+ATOM 635 C CE1 . TYR A 1 99 ? -14.207 -36.418 24.912 1.00 19.34 ? 83 TYR A CE1 1
+ATOM 636 C CE2 . TYR A 1 99 ? -16.315 -37.502 24.568 1.00 16.40 ? 83 TYR A CE2 1
+ATOM 637 C CZ . TYR A 1 99 ? -14.937 -37.549 24.614 1.00 23.94 ? 83 TYR A CZ 1
+ATOM 638 O OH . TYR A 1 99 ? -14.287 -38.732 24.364 1.00 22.71 ? 83 TYR A OH 1
+ATOM 639 N N . GLN A 1 100 ? -16.547 -31.728 28.142 1.00 22.56 ? 84 GLN A N 1
+ATOM 640 C CA . GLN A 1 100 ? -16.670 -30.371 28.661 1.00 12.76 ? 84 GLN A CA 1
+ATOM 641 C C . GLN A 1 100 ? -15.448 -29.529 28.336 1.00 17.17 ? 84 GLN A C 1
+ATOM 642 O O . GLN A 1 100 ? -14.326 -30.034 28.268 1.00 17.68 ? 84 GLN A O 1
+ATOM 643 C CB . GLN A 1 100 ? -16.895 -30.392 30.172 1.00 14.73 ? 84 GLN A CB 1
+ATOM 644 C CG . GLN A 1 100 ? -18.061 -31.265 30.604 1.00 18.03 ? 84 GLN A CG 1
+ATOM 645 C CD . GLN A 1 100 ? -18.405 -31.080 32.072 1.00 24.52 ? 84 GLN A CD 1
+ATOM 646 O OE1 . GLN A 1 100 ? -18.451 -29.958 32.569 1.00 29.55 ? 84 GLN A OE1 1
+ATOM 647 N NE2 . GLN A 1 100 ? -18.637 -32.185 32.773 1.00 20.94 ? 84 GLN A NE2 1
+ATOM 648 N N . LEU A 1 101 ? -15.683 -28.236 28.152 1.00 17.91 ? 85 LEU A N 1
+ATOM 649 C CA . LEU A 1 101 ? -14.641 -27.302 27.768 1.00 23.10 ? 85 LEU A CA 1
+ATOM 650 C C . LEU A 1 101 ? -13.560 -27.229 28.842 1.00 20.14 ? 85 LEU A C 1
+ATOM 651 O O . LEU A 1 101 ? -13.854 -27.161 30.033 1.00 23.09 ? 85 LEU A O 1
+ATOM 652 C CB . LEU A 1 101 ? -15.245 -25.920 27.510 1.00 27.31 ? 85 LEU A CB 1
+ATOM 653 C CG . LEU A 1 101 ? -14.349 -24.857 26.873 1.00 29.18 ? 85 LEU A CG 1
+ATOM 654 C CD1 . LEU A 1 101 ? -13.816 -25.345 25.546 1.00 27.40 ? 85 LEU A CD1 1
+ATOM 655 C CD2 . LEU A 1 101 ? -15.128 -23.567 26.694 1.00 36.38 ? 85 LEU A CD2 1
+ATOM 656 N N . GLN A 1 102 ? -12.306 -27.277 28.413 1.00 18.05 ? 86 GLN A N 1
+ATOM 657 C CA . GLN A 1 102 ? -11.186 -27.191 29.338 1.00 21.13 ? 86 GLN A CA 1
+ATOM 658 C C . GLN A 1 102 ? -10.558 -25.801 29.292 1.00 24.56 ? 86 GLN A C 1
+ATOM 659 O O . GLN A 1 102 ? -11.255 -24.797 29.440 1.00 31.00 ? 86 GLN A O 1
+ATOM 660 C CB . GLN A 1 102 ? -10.155 -28.273 29.022 1.00 20.08 ? 86 GLN A CB 1
+ATOM 661 C CG . GLN A 1 102 ? -10.703 -29.684 29.206 1.00 15.77 ? 86 GLN A CG 1
+ATOM 662 C CD . GLN A 1 102 ? -11.191 -29.936 30.624 1.00 26.83 ? 86 GLN A CD 1
+ATOM 663 O OE1 . GLN A 1 102 ? -10.400 -29.969 31.565 1.00 17.30 ? 86 GLN A OE1 1
+ATOM 664 N NE2 . GLN A 1 102 ? -12.501 -30.110 30.783 1.00 15.12 ? 86 GLN A NE2 1
+ATOM 665 N N . ASP A 1 103 ? -9.247 -25.746 29.086 1.00 29.88 ? 87 ASP A N 1
+ATOM 666 C CA . ASP A 1 103 ? -8.522 -24.480 29.098 1.00 39.05 ? 87 ASP A CA 1
+ATOM 667 C C . ASP A 1 103 ? -8.419 -23.865 27.706 1.00 54.70 ? 87 ASP A C 1
+ATOM 668 O O . ASP A 1 103 ? -8.588 -22.657 27.535 1.00 35.23 ? 87 ASP A O 1
+ATOM 669 C CB . ASP A 1 103 ? -7.124 -24.680 29.683 1.00 38.20 ? 87 ASP A CB 1
+ATOM 670 C CG . ASP A 1 103 ? -7.158 -25.160 31.119 1.00 53.64 ? 87 ASP A CG 1
+ATOM 671 O OD1 . ASP A 1 103 ? -8.062 -24.731 31.868 1.00 58.31 ? 87 ASP A OD1 1
+ATOM 672 O OD2 . ASP A 1 103 ? -6.287 -25.971 31.497 1.00 89.15 ? 87 ASP A OD2 1
+ATOM 673 N N . LEU A 1 104 ? -8.132 -24.702 26.716 1.00 38.61 ? 88 LEU A N 1
+ATOM 674 C CA . LEU A 1 104 ? -8.025 -24.243 25.337 1.00 35.88 ? 88 LEU A CA 1
+ATOM 675 C C . LEU A 1 104 ? -9.404 -24.050 24.719 1.00 64.70 ? 88 LEU A C 1
+ATOM 676 O O . LEU A 1 104 ? -10.394 -24.597 25.203 1.00 58.01 ? 88 LEU A O 1
+ATOM 677 C CB . LEU A 1 104 ? -7.202 -25.230 24.511 1.00 23.60 ? 88 LEU A CB 1
+ATOM 678 C CG . LEU A 1 104 ? -5.765 -25.372 25.017 1.00 39.35 ? 88 LEU A CG 1
+ATOM 679 C CD1 . LEU A 1 104 ? -4.999 -26.404 24.216 1.00 41.33 ? 88 LEU A CD1 1
+ATOM 680 C CD2 . LEU A 1 104 ? -5.062 -24.026 24.977 1.00 34.95 ? 88 LEU A CD2 1
+ATOM 681 N N . THR A 1 105 ? -9.460 -23.270 23.645 1.00 39.97 ? 89 THR A N 1
+ATOM 682 C CA . THR A 1 105 ? -10.733 -22.909 23.044 1.00 49.08 ? 89 THR A CA 1
+ATOM 683 C C . THR A 1 105 ? -10.886 -23.449 21.629 1.00 58.76 ? 89 THR A C 1
+ATOM 684 O O . THR A 1 105 ? -9.909 -23.809 20.972 1.00 35.69 ? 89 THR A O 1
+ATOM 685 C CB . THR A 1 105 ? -10.916 -21.384 23.006 1.00 68.70 ? 89 THR A CB 1
+ATOM 686 O OG1 . THR A 1 105 ? -9.762 -20.784 22.404 1.00 64.97 ? 89 THR A OG1 1
+ATOM 687 C CG2 . THR A 1 105 ? -11.093 -20.833 24.414 1.00 52.08 ? 89 THR A CG2 1
+ATOM 688 N N . PHE A 1 106 ? -12.131 -23.502 21.174 1.00 40.06 ? 90 PHE A N 1
+ATOM 689 C CA . PHE A 1 106 ? -12.438 -23.891 19.809 1.00 47.42 ? 90 PHE A CA 1
+ATOM 690 C C . PHE A 1 106 ? -13.249 -22.787 19.146 1.00 30.77 ? 90 PHE A C 1
+ATOM 691 O O . PHE A 1 106 ? -14.184 -22.255 19.744 1.00 65.57 ? 90 PHE A O 1
+ATOM 692 C CB . PHE A 1 106 ? -13.205 -25.212 19.782 1.00 28.99 ? 90 PHE A CB 1
+ATOM 693 C CG . PHE A 1 106 ? -13.572 -25.670 18.401 1.00 41.82 ? 90 PHE A CG 1
+ATOM 694 C CD1 . PHE A 1 106 ? -14.792 -25.325 17.843 1.00 36.10 ? 90 PHE A CD1 1
+ATOM 695 C CD2 . PHE A 1 106 ? -12.697 -26.449 17.661 1.00 22.52 ? 90 PHE A CD2 1
+ATOM 696 C CE1 . PHE A 1 106 ? -15.131 -25.742 16.573 1.00 30.58 ? 90 PHE A CE1 1
+ATOM 697 C CE2 . PHE A 1 106 ? -13.033 -26.872 16.389 1.00 18.76 ? 90 PHE A CE2 1
+ATOM 698 C CZ . PHE A 1 106 ? -14.251 -26.518 15.845 1.00 29.48 ? 90 PHE A CZ 1
+ATOM 699 N N . SER A 1 107 ? -12.891 -22.443 17.913 1.00 39.05 ? 91 SER A N 1
+ATOM 700 C CA . SER A 1 107 ? -13.589 -21.386 17.192 1.00 59.14 ? 91 SER A CA 1
+ATOM 701 C C . SER A 1 107 ? -13.576 -21.624 15.687 1.00 40.01 ? 91 SER A C 1
+ATOM 702 O O . SER A 1 107 ? -12.579 -22.083 15.132 1.00 34.39 ? 91 SER A O 1
+ATOM 703 C CB . SER A 1 107 ? -12.964 -20.024 17.508 1.00 72.33 ? 91 SER A CB 1
+ATOM 704 O OG . SER A 1 107 ? -13.607 -18.986 16.788 1.00 66.66 ? 91 SER A OG 1
+ATOM 705 N N . ASN A 1 108 ? -14.687 -21.304 15.031 1.00 33.65 ? 92 ASN A N 1
+ATOM 706 C CA . ASN A 1 108 ? -14.757 -21.387 13.579 1.00 22.82 ? 92 ASN A CA 1
+ATOM 707 C C . ASN A 1 108 ? -14.171 -20.146 12.927 1.00 24.19 ? 92 ASN A C 1
+ATOM 708 O O . ASN A 1 108 ? -14.119 -20.048 11.702 1.00 29.47 ? 92 ASN A O 1
+ATOM 709 C CB . ASN A 1 108 ? -16.202 -21.585 13.112 1.00 33.79 ? 92 ASN A CB 1
+ATOM 710 C CG . ASN A 1 108 ? -16.760 -22.935 13.506 1.00 42.41 ? 92 ASN A CG 1
+ATOM 711 O OD1 . ASN A 1 108 ? -16.392 -23.960 12.933 1.00 39.68 ? 92 ASN A OD1 1
+ATOM 712 N ND2 . ASN A 1 108 ? -17.660 -22.942 14.482 1.00 50.58 ? 92 ASN A ND2 1
+ATOM 713 N N . GLY A 1 109 ? -13.728 -19.202 13.755 1.00 23.99 ? 93 GLY A N 1
+ATOM 714 C CA . GLY A 1 109 ? -13.189 -17.943 13.273 1.00 25.70 ? 93 GLY A CA 1
+ATOM 715 C C . GLY A 1 109 ? -12.002 -18.102 12.342 1.00 37.85 ? 93 GLY A C 1
+ATOM 716 O O . GLY A 1 109 ? -11.809 -17.304 11.421 1.00 24.55 ? 93 GLY A O 1
+ATOM 717 N N . TYR A 1 110 ? -11.203 -19.136 12.578 1.00 23.30 ? 94 TYR A N 1
+ATOM 718 C CA . TYR A 1 110 ? -10.026 -19.382 11.758 1.00 21.04 ? 94 TYR A CA 1
+ATOM 719 C C . TYR A 1 110 ? -10.393 -19.852 10.350 1.00 18.59 ? 94 TYR A C 1
+ATOM 720 O O . TYR A 1 110 ? -9.600 -19.706 9.419 1.00 14.27 ? 94 TYR A O 1
+ATOM 721 C CB . TYR A 1 110 ? -9.113 -20.405 12.433 1.00 21.49 ? 94 TYR A CB 1
+ATOM 722 C CG . TYR A 1 110 ? -8.496 -19.893 13.714 1.00 43.96 ? 94 TYR A CG 1
+ATOM 723 C CD1 . TYR A 1 110 ? -7.406 -19.035 13.685 1.00 37.35 ? 94 TYR A CD1 1
+ATOM 724 C CD2 . TYR A 1 110 ? -9.010 -20.258 14.951 1.00 28.73 ? 94 TYR A CD2 1
+ATOM 725 C CE1 . TYR A 1 110 ? -6.840 -18.559 14.850 1.00 38.98 ? 94 TYR A CE1 1
+ATOM 726 C CE2 . TYR A 1 110 ? -8.449 -19.787 16.124 1.00 56.63 ? 94 TYR A CE2 1
+ATOM 727 C CZ . TYR A 1 110 ? -7.364 -18.937 16.066 1.00 50.81 ? 94 TYR A CZ 1
+ATOM 728 O OH . TYR A 1 110 ? -6.800 -18.463 17.229 1.00 101.53 ? 94 TYR A OH 1
+ATOM 729 N N . ARG A 1 111 ? -11.581 -20.428 10.190 1.00 18.93 ? 95 ARG A N 1
+ATOM 730 C CA . ARG A 1 111 ? -12.060 -20.773 8.854 1.00 25.03 ? 95 ARG A CA 1
+ATOM 731 C C . ARG A 1 111 ? -12.188 -19.513 8.010 1.00 13.43 ? 95 ARG A C 1
+ATOM 732 O O . ARG A 1 111 ? -11.840 -19.500 6.834 1.00 17.15 ? 95 ARG A O 1
+ATOM 733 C CB . ARG A 1 111 ? -13.411 -21.482 8.907 1.00 19.05 ? 95 ARG A CB 1
+ATOM 734 C CG . ARG A 1 111 ? -13.377 -22.946 9.289 1.00 30.21 ? 95 ARG A CG 1
+ATOM 735 C CD . ARG A 1 111 ? -14.775 -23.518 9.137 1.00 32.08 ? 95 ARG A CD 1
+ATOM 736 N NE . ARG A 1 111 ? -14.857 -24.937 9.458 1.00 32.03 ? 95 ARG A NE 1
+ATOM 737 C CZ . ARG A 1 111 ? -14.754 -25.914 8.565 1.00 26.60 ? 95 ARG A CZ 1
+ATOM 738 N NH1 . ARG A 1 111 ? -14.854 -27.175 8.959 1.00 31.88 ? 95 ARG A NH1 1
+ATOM 739 N NH2 . ARG A 1 111 ? -14.553 -25.632 7.282 1.00 22.85 ? 95 ARG A NH2 1
+ATOM 740 N N . TYR A 1 112 ? -12.703 -18.456 8.629 1.00 18.38 ? 96 TYR A N 1
+ATOM 741 C CA . TYR A 1 112 ? -12.924 -17.190 7.942 1.00 19.00 ? 96 TYR A CA 1
+ATOM 742 C C . TYR A 1 112 ? -11.620 -16.596 7.428 1.00 22.45 ? 96 TYR A C 1
+ATOM 743 O O . TYR A 1 112 ? -11.546 -16.131 6.287 1.00 19.95 ? 96 TYR A O 1
+ATOM 744 C CB . TYR A 1 112 ? -13.631 -16.204 8.876 1.00 13.95 ? 96 TYR A CB 1
+ATOM 745 C CG . TYR A 1 112 ? -15.100 -16.522 9.079 1.00 16.48 ? 96 TYR A CG 1
+ATOM 746 C CD1 . TYR A 1 112 ? -15.497 -17.639 9.802 1.00 23.23 ? 96 TYR A CD1 1
+ATOM 747 C CD2 . TYR A 1 112 ? -16.087 -15.703 8.545 1.00 21.65 ? 96 TYR A CD2 1
+ATOM 748 C CE1 . TYR A 1 112 ? -16.837 -17.938 9.982 1.00 16.95 ? 96 TYR A CE1 1
+ATOM 749 C CE2 . TYR A 1 112 ? -17.433 -15.989 8.728 1.00 14.39 ? 96 TYR A CE2 1
+ATOM 750 C CZ . TYR A 1 112 ? -17.799 -17.107 9.444 1.00 14.52 ? 96 TYR A CZ 1
+ATOM 751 O OH . TYR A 1 112 ? -19.132 -17.397 9.623 1.00 24.19 ? 96 TYR A OH 1
+ATOM 752 N N . VAL A 1 113 ? -10.592 -16.622 8.272 1.00 18.47 ? 97 VAL A N 1
+ATOM 753 C CA . VAL A 1 113 ? -9.276 -16.115 7.902 1.00 17.83 ? 97 VAL A CA 1
+ATOM 754 C C . VAL A 1 113 ? -8.726 -16.899 6.714 1.00 20.24 ? 97 VAL A C 1
+ATOM 755 O O . VAL A 1 113 ? -8.144 -16.329 5.793 1.00 19.28 ? 97 VAL A O 1
+ATOM 756 C CB . VAL A 1 113 ? -8.283 -16.196 9.089 1.00 21.25 ? 97 VAL A CB 1
+ATOM 757 C CG1 . VAL A 1 113 ? -6.912 -15.673 8.684 1.00 23.68 ? 97 VAL A CG1 1
+ATOM 758 C CG2 . VAL A 1 113 ? -8.814 -15.417 10.272 1.00 20.76 ? 97 VAL A CG2 1
+ATOM 759 N N . ASN A 1 114 ? -8.932 -18.212 6.730 1.00 19.17 ? 98 ASN A N 1
+ATOM 760 C CA . ASN A 1 114 ? -8.421 -19.064 5.665 1.00 16.74 ? 98 ASN A CA 1
+ATOM 761 C C . ASN A 1 114 ? -9.111 -18.802 4.325 1.00 22.05 ? 98 ASN A C 1
+ATOM 762 O O . ASN A 1 114 ? -8.494 -18.934 3.267 1.00 16.04 ? 98 ASN A O 1
+ATOM 763 C CB . ASN A 1 114 ? -8.572 -20.532 6.048 1.00 17.51 ? 98 ASN A CB 1
+ATOM 764 C CG . ASN A 1 114 ? -7.587 -21.423 5.320 1.00 35.61 ? 98 ASN A CG 1
+ATOM 765 O OD1 . ASN A 1 114 ? -7.947 -22.143 4.390 1.00 44.36 ? 98 ASN A OD1 1
+ATOM 766 N ND2 . ASN A 1 114 ? -6.329 -21.366 5.735 1.00 29.90 ? 98 ASN A ND2 1
+ATOM 767 N N . TRP A 1 115 ? -10.387 -18.427 4.377 1.00 17.51 ? 99 TRP A N 1
+ATOM 768 C CA . TRP A 1 115 ? -11.146 -18.085 3.170 1.00 14.19 ? 99 TRP A CA 1
+ATOM 769 C C . TRP A 1 115 ? -10.539 -16.897 2.424 1.00 20.56 ? 99 TRP A C 1
+ATOM 770 O O . TRP A 1 115 ? -10.669 -16.787 1.206 1.00 15.29 ? 99 TRP A O 1
+ATOM 771 C CB . TRP A 1 115 ? -12.598 -17.770 3.520 1.00 10.91 ? 99 TRP A CB 1
+ATOM 772 C CG . TRP A 1 115 ? -13.377 -18.938 4.037 1.00 16.24 ? 99 TRP A CG 1
+ATOM 773 C CD1 . TRP A 1 115 ? -13.047 -20.260 3.942 1.00 13.09 ? 99 TRP A CD1 1
+ATOM 774 C CD2 . TRP A 1 115 ? -14.620 -18.885 4.743 1.00 16.48 ? 99 TRP A CD2 1
+ATOM 775 N NE1 . TRP A 1 115 ? -14.015 -21.033 4.541 1.00 13.19 ? 99 TRP A NE1 1
+ATOM 776 C CE2 . TRP A 1 115 ? -14.989 -20.211 5.046 1.00 11.86 ? 99 TRP A CE2 1
+ATOM 777 C CE3 . TRP A 1 115 ? -15.459 -17.842 5.152 1.00 15.89 ? 99 TRP A CE3 1
+ATOM 778 C CZ2 . TRP A 1 115 ? -16.157 -20.521 5.735 1.00 19.36 ? 99 TRP A CZ2 1
+ATOM 779 C CZ3 . TRP A 1 115 ? -16.617 -18.152 5.833 1.00 12.36 ? 99 TRP A CZ3 1
+ATOM 780 C CH2 . TRP A 1 115 ? -16.957 -19.480 6.116 1.00 18.92 ? 99 TRP A CH2 1
+ATOM 781 N N . MET A 1 116 ? -9.887 -16.005 3.161 1.00 12.42 ? 100 MET A N 1
+ATOM 782 C CA . MET A 1 116 ? -9.212 -14.852 2.566 1.00 16.40 ? 100 MET A CA 1
+ATOM 783 C C . MET A 1 116 ? -8.211 -15.275 1.496 1.00 21.71 ? 100 MET A C 1
+ATOM 784 O O . MET A 1 116 ? -7.937 -14.526 0.559 1.00 18.11 ? 100 MET A O 1
+ATOM 785 C CB . MET A 1 116 ? -8.500 -14.033 3.648 1.00 20.01 ? 100 MET A CB 1
+ATOM 786 C CG . MET A 1 116 ? -9.436 -13.428 4.682 1.00 16.88 ? 100 MET A CG 1
+ATOM 787 S SD . MET A 1 116 ? -10.412 -12.084 3.983 1.00 22.28 ? 100 MET A SD 1
+ATOM 788 C CE . MET A 1 116 ? -9.144 -10.854 3.659 1.00 20.95 ? 100 MET A CE 1
+ATOM 789 N N . ALA A 1 117 ? -7.671 -16.480 1.650 1.00 11.46 ? 101 ALA A N 1
+ATOM 790 C CA . ALA A 1 117 ? -6.713 -17.036 0.703 1.00 15.60 ? 101 ALA A CA 1
+ATOM 791 C C . ALA A 1 117 ? -7.368 -18.024 -0.261 1.00 20.17 ? 101 ALA A C 1
+ATOM 792 O O . ALA A 1 117 ? -7.118 -17.981 -1.465 1.00 20.26 ? 101 ALA A O 1
+ATOM 793 C CB . ALA A 1 117 ? -5.564 -17.715 1.451 1.00 20.35 ? 101 ALA A CB 1
+ATOM 794 N N . THR A 1 118 ? -8.213 -18.908 0.263 1.00 19.01 ? 102 THR A N 1
+ATOM 795 C CA . THR A 1 118 ? -8.755 -19.994 -0.549 1.00 13.76 ? 102 THR A CA 1
+ATOM 796 C C . THR A 1 118 ? -9.775 -19.525 -1.583 1.00 18.70 ? 102 THR A C 1
+ATOM 797 O O . THR A 1 118 ? -9.781 -20.012 -2.708 1.00 20.09 ? 102 THR A O 1
+ATOM 798 C CB . THR A 1 118 ? -9.408 -21.089 0.323 1.00 15.31 ? 102 THR A CB 1
+ATOM 799 O OG1 . THR A 1 118 ? -10.367 -20.501 1.205 1.00 34.10 ? 102 THR A OG1 1
+ATOM 800 C CG2 . THR A 1 118 ? -8.354 -21.802 1.145 1.00 27.13 ? 102 THR A CG2 1
+ATOM 801 N N . ILE A 1 119 ? -10.638 -18.589 -1.207 1.00 16.57 ? 103 ILE A N 1
+ATOM 802 C CA . ILE A 1 119 ? -11.663 -18.119 -2.133 1.00 18.46 ? 103 ILE A CA 1
+ATOM 803 C C . ILE A 1 119 ? -11.058 -17.407 -3.356 1.00 21.22 ? 103 ILE A C 1
+ATOM 804 O O . ILE A 1 119 ? -11.495 -17.663 -4.478 1.00 19.57 ? 103 ILE A O 1
+ATOM 805 C CB . ILE A 1 119 ? -12.688 -17.205 -1.424 1.00 19.15 ? 103 ILE A CB 1
+ATOM 806 C CG1 . ILE A 1 119 ? -13.508 -18.023 -0.421 1.00 19.26 ? 103 ILE A CG1 1
+ATOM 807 C CG2 . ILE A 1 119 ? -13.610 -16.543 -2.439 1.00 19.63 ? 103 ILE A CG2 1
+ATOM 808 C CD1 . ILE A 1 119 ? -14.627 -17.242 0.263 1.00 18.18 ? 103 ILE A CD1 1
+ATOM 809 N N . PRO A 1 120 ? -10.046 -16.533 -3.160 1.00 18.46 ? 104 PRO A N 1
+ATOM 810 C CA . PRO A 1 120 ? -9.389 -16.014 -4.366 1.00 19.91 ? 104 PRO A CA 1
+ATOM 811 C C . PRO A 1 120 ? -8.819 -17.118 -5.259 1.00 14.97 ? 104 PRO A C 1
+ATOM 812 O O . PRO A 1 120 ? -8.894 -16.994 -6.476 1.00 17.66 ? 104 PRO A O 1
+ATOM 813 C CB . PRO A 1 120 ? -8.267 -15.138 -3.801 1.00 12.48 ? 104 PRO A CB 1
+ATOM 814 C CG . PRO A 1 120 ? -8.807 -14.658 -2.506 1.00 21.11 ? 104 PRO A CG 1
+ATOM 815 C CD . PRO A 1 120 ? -9.583 -15.824 -1.949 1.00 25.30 ? 104 PRO A CD 1
+ATOM 816 N N . CYS A 1 121 ? -8.278 -18.179 -4.664 1.00 15.56 ? 105 CYS A N 1
+ATOM 817 C CA . CYS A 1 121 ? -7.726 -19.284 -5.449 1.00 17.58 ? 105 CYS A CA 1
+ATOM 818 C C . CYS A 1 121 ? -8.801 -19.995 -6.258 1.00 16.51 ? 105 CYS A C 1
+ATOM 819 O O . CYS A 1 121 ? -8.573 -20.367 -7.411 1.00 17.56 ? 105 CYS A O 1
+ATOM 820 C CB . CYS A 1 121 ? -7.016 -20.296 -4.549 1.00 23.25 ? 105 CYS A CB 1
+ATOM 821 S SG . CYS A 1 121 ? -5.439 -19.732 -3.891 1.00 24.44 ? 105 CYS A SG 1
+ATOM 822 N N . LEU A 1 122 ? -9.965 -20.196 -5.650 1.00 12.13 ? 106 LEU A N 1
+ATOM 823 C CA . LEU A 1 122 ? -11.060 -20.875 -6.334 1.00 16.22 ? 106 LEU A CA 1
+ATOM 824 C C . LEU A 1 122 ? -11.547 -20.025 -7.509 1.00 15.20 ? 106 LEU A C 1
+ATOM 825 O O . LEU A 1 122 ? -11.878 -20.546 -8.575 1.00 17.50 ? 106 LEU A O 1
+ATOM 826 C CB . LEU A 1 122 ? -12.211 -21.163 -5.365 1.00 11.60 ? 106 LEU A CB 1
+ATOM 827 C CG . LEU A 1 122 ? -11.998 -22.202 -4.257 1.00 12.85 ? 106 LEU A CG 1
+ATOM 828 C CD1 . LEU A 1 122 ? -13.189 -22.212 -3.307 1.00 20.07 ? 106 LEU A CD1 1
+ATOM 829 C CD2 . LEU A 1 122 ? -11.776 -23.593 -4.838 1.00 8.05 ? 106 LEU A CD2 1
+ATOM 830 N N . LEU A 1 123 ? -11.571 -18.713 -7.309 1.00 14.05 ? 107 LEU A N 1
+ATOM 831 C CA . LEU A 1 123 ? -12.026 -17.782 -8.339 1.00 20.89 ? 107 LEU A CA 1
+ATOM 832 C C . LEU A 1 123 ? -11.007 -17.662 -9.471 1.00 15.38 ? 107 LEU A C 1
+ATOM 833 O O . LEU A 1 123 ? -11.376 -17.544 -10.641 1.00 22.31 ? 107 LEU A O 1
+ATOM 834 C CB . LEU A 1 123 ? -12.298 -16.402 -7.725 1.00 14.02 ? 107 LEU A CB 1
+ATOM 835 C CG . LEU A 1 123 ? -13.459 -16.311 -6.730 1.00 24.82 ? 107 LEU A CG 1
+ATOM 836 C CD1 . LEU A 1 123 ? -13.473 -14.956 -6.034 1.00 22.30 ? 107 LEU A CD1 1
+ATOM 837 C CD2 . LEU A 1 123 ? -14.787 -16.577 -7.427 1.00 20.66 ? 107 LEU A CD2 1
+ATOM 838 N N . LEU A 1 124 ? -9.725 -17.707 -9.123 1.00 17.19 ? 108 LEU A N 1
+ATOM 839 C CA . LEU A 1 124 ? -8.679 -17.533 -10.124 1.00 15.93 ? 108 LEU A CA 1
+ATOM 840 C C . LEU A 1 124 ? -8.642 -18.708 -11.098 1.00 15.63 ? 108 LEU A C 1
+ATOM 841 O O . LEU A 1 124 ? -8.498 -18.508 -12.299 1.00 21.04 ? 108 LEU A O 1
+ATOM 842 C CB . LEU A 1 124 ? -7.313 -17.350 -9.461 1.00 15.43 ? 108 LEU A CB 1
+ATOM 843 C CG . LEU A 1 124 ? -6.156 -17.081 -10.428 1.00 27.23 ? 108 LEU A CG 1
+ATOM 844 C CD1 . LEU A 1 124 ? -6.472 -15.900 -11.336 1.00 27.98 ? 108 LEU A CD1 1
+ATOM 845 C CD2 . LEU A 1 124 ? -4.852 -16.845 -9.677 1.00 36.59 ? 108 LEU A CD2 1
+ATOM 846 N N . GLN A 1 125 ? -8.785 -19.930 -10.596 1.00 14.05 ? 109 GLN A N 1
+ATOM 847 C CA . GLN A 1 125 ? -8.719 -21.085 -11.487 1.00 19.77 ? 109 GLN A CA 1
+ATOM 848 C C . GLN A 1 125 ? -9.928 -21.121 -12.427 1.00 18.58 ? 109 GLN A C 1
+ATOM 849 O O . GLN A 1 125 ? -9.842 -21.652 -13.531 1.00 15.09 ? 109 GLN A O 1
+ATOM 850 C CB . GLN A 1 125 ? -8.597 -22.394 -10.692 1.00 21.26 ? 109 GLN A CB 1
+ATOM 851 C CG . GLN A 1 125 ? -9.683 -22.644 -9.672 1.00 16.44 ? 109 GLN A CG 1
+ATOM 852 C CD . GLN A 1 125 ? -9.480 -23.942 -8.897 1.00 29.96 ? 109 GLN A CD 1
+ATOM 853 O OE1 . GLN A 1 125 ? -10.160 -24.196 -7.906 1.00 22.44 ? 109 GLN A OE1 1
+ATOM 854 N NE2 . GLN A 1 125 ? -8.547 -24.770 -9.352 1.00 22.08 ? 109 GLN A NE2 1
+ATOM 855 N N . LEU A 1 126 ? -11.043 -20.535 -12.004 1.00 15.40 ? 110 LEU A N 1
+ATOM 856 C CA . LEU A 1 126 ? -12.195 -20.392 -12.888 1.00 8.87 ? 110 LEU A CA 1
+ATOM 857 C C . LEU A 1 126 ? -11.902 -19.428 -14.035 1.00 10.49 ? 110 LEU A C 1
+ATOM 858 O O . LEU A 1 126 ? -12.207 -19.716 -15.186 1.00 16.43 ? 110 LEU A O 1
+ATOM 859 C CB . LEU A 1 126 ? -13.425 -19.905 -12.115 1.00 17.55 ? 110 LEU A CB 1
+ATOM 860 C CG . LEU A 1 126 ? -14.606 -19.487 -12.999 1.00 20.05 ? 110 LEU A CG 1
+ATOM 861 C CD1 . LEU A 1 126 ? -15.184 -20.682 -13.748 1.00 18.23 ? 110 LEU A CD1 1
+ATOM 862 C CD2 . LEU A 1 126 ? -15.682 -18.782 -12.187 1.00 26.59 ? 110 LEU A CD2 1
+ATOM 863 N N . LEU A 1 127 ? -11.314 -18.281 -13.711 1.00 16.72 ? 111 LEU A N 1
+ATOM 864 C CA . LEU A 1 127 ? -10.992 -17.275 -14.719 1.00 17.81 ? 111 LEU A CA 1
+ATOM 865 C C . LEU A 1 127 ? -10.011 -17.829 -15.750 1.00 20.11 ? 111 LEU A C 1
+ATOM 866 O O . LEU A 1 127 ? -10.097 -17.525 -16.940 1.00 19.91 ? 111 LEU A O 1
+ATOM 867 C CB . LEU A 1 127 ? -10.413 -16.022 -14.061 1.00 14.99 ? 111 LEU A CB 1
+ATOM 868 C CG . LEU A 1 127 ? -11.302 -15.277 -13.067 1.00 22.30 ? 111 LEU A CG 1
+ATOM 869 C CD1 . LEU A 1 127 ? -10.676 -13.939 -12.707 1.00 21.57 ? 111 LEU A CD1 1
+ATOM 870 C CD2 . LEU A 1 127 ? -12.720 -15.093 -13.615 1.00 12.47 ? 111 LEU A CD2 1
+ATOM 871 N N . ILE A 1 128 ? -9.093 -18.665 -15.284 1.00 14.57 ? 112 ILE A N 1
+ATOM 872 C CA . ILE A 1 128 ? -8.092 -19.268 -16.154 1.00 17.25 ? 112 ILE A CA 1
+ATOM 873 C C . ILE A 1 128 ? -8.729 -20.189 -17.198 1.00 15.61 ? 112 ILE A C 1
+ATOM 874 O O . ILE A 1 128 ? -8.443 -20.059 -18.387 1.00 18.23 ? 112 ILE A O 1
+ATOM 875 C CB . ILE A 1 128 ? -7.046 -20.046 -15.332 1.00 13.82 ? 112 ILE A CB 1
+ATOM 876 C CG1 . ILE A 1 128 ? -6.256 -19.077 -14.454 1.00 24.50 ? 112 ILE A CG1 1
+ATOM 877 C CG2 . ILE A 1 128 ? -6.082 -20.801 -16.252 1.00 15.62 ? 112 ILE A CG2 1
+ATOM 878 C CD1 . ILE A 1 128 ? -5.514 -19.743 -13.334 1.00 31.56 ? 112 ILE A CD1 1
+ATOM 879 N N . VAL A 1 129 ? -9.609 -21.097 -16.775 1.00 15.40 ? 113 VAL A N 1
+ATOM 880 C CA . VAL A 1 129 ? -10.229 -22.014 -17.738 1.00 12.39 ? 113 VAL A CA 1
+ATOM 881 C C . VAL A 1 129 ? -11.280 -21.308 -18.597 1.00 24.84 ? 113 VAL A C 1
+ATOM 882 O O . VAL A 1 129 ? -11.685 -21.830 -19.634 1.00 12.95 ? 113 VAL A O 1
+ATOM 883 C CB . VAL A 1 129 ? -10.874 -23.245 -17.055 1.00 19.38 ? 113 VAL A CB 1
+ATOM 884 C CG1 . VAL A 1 129 ? -9.813 -24.090 -16.369 1.00 18.58 ? 113 VAL A CG1 1
+ATOM 885 C CG2 . VAL A 1 129 ? -11.976 -22.826 -16.081 1.00 18.68 ? 113 VAL A CG2 1
+ATOM 886 N N . LEU A 1 130 ? -11.708 -20.121 -18.175 1.00 15.64 ? 114 LEU A N 1
+ATOM 887 C CA . LEU A 1 130 ? -12.575 -19.283 -19.004 1.00 15.79 ? 114 LEU A CA 1
+ATOM 888 C C . LEU A 1 130 ? -11.782 -18.588 -20.109 1.00 21.77 ? 114 LEU A C 1
+ATOM 889 O O . LEU A 1 130 ? -12.341 -17.814 -20.893 1.00 23.68 ? 114 LEU A O 1
+ATOM 890 C CB . LEU A 1 130 ? -13.293 -18.234 -18.152 1.00 19.00 ? 114 LEU A CB 1
+ATOM 891 C CG . LEU A 1 130 ? -14.491 -18.698 -17.332 1.00 22.18 ? 114 LEU A CG 1
+ATOM 892 C CD1 . LEU A 1 130 ? -15.072 -17.534 -16.540 1.00 24.76 ? 114 LEU A CD1 1
+ATOM 893 C CD2 . LEU A 1 130 ? -15.538 -19.312 -18.241 1.00 21.14 ? 114 LEU A CD2 1
+ATOM 894 N N . ASN A 1 131 ? -10.479 -18.863 -20.144 1.00 18.41 ? 115 ASN A N 1
+ATOM 895 C CA . ASN A 1 131 ? -9.565 -18.339 -21.158 1.00 20.64 ? 115 ASN A CA 1
+ATOM 896 C C . ASN A 1 131 ? -9.399 -16.825 -21.088 1.00 30.14 ? 115 ASN A C 1
+ATOM 897 O O . ASN A 1 131 ? -9.080 -16.183 -22.083 1.00 27.98 ? 115 ASN A O 1
+ATOM 898 C CB . ASN A 1 131 ? -10.032 -18.756 -22.557 1.00 19.97 ? 115 ASN A CB 1
+ATOM 899 C CG . ASN A 1 131 ? -10.078 -20.259 -22.724 1.00 25.68 ? 115 ASN A CG 1
+ATOM 900 O OD1 . ASN A 1 131 ? -9.090 -20.947 -22.477 1.00 22.02 ? 115 ASN A OD1 1
+ATOM 901 N ND2 . ASN A 1 131 ? -11.237 -20.784 -23.116 1.00 22.60 ? 115 ASN A ND2 1
+ATOM 902 N N . LEU A 1 132 ? -9.609 -16.256 -19.906 1.00 21.83 ? 116 LEU A N 1
+ATOM 903 C CA . LEU A 1 132 ? -9.328 -14.840 -19.699 1.00 26.56 ? 116 LEU A CA 1
+ATOM 904 C C . LEU A 1 132 ? -7.822 -14.623 -19.680 1.00 35.49 ? 116 LEU A C 1
+ATOM 905 O O . LEU A 1 132 ? -7.073 -15.466 -19.183 1.00 32.01 ? 116 LEU A O 1
+ATOM 906 C CB . LEU A 1 132 ? -9.958 -14.335 -18.399 1.00 23.93 ? 116 LEU A CB 1
+ATOM 907 C CG . LEU A 1 132 ? -11.486 -14.276 -18.366 1.00 27.99 ? 116 LEU A CG 1
+ATOM 908 C CD1 . LEU A 1 132 ? -11.970 -13.562 -17.112 1.00 30.66 ? 116 LEU A CD1 1
+ATOM 909 C CD2 . LEU A 1 132 ? -12.013 -13.589 -19.610 1.00 37.57 ? 116 LEU A CD2 1
+ATOM 910 N N . LYS A 1 133 ? -7.379 -13.498 -20.231 1.00 28.94 ? 117 LYS A N 1
+ATOM 911 C CA . LYS A 1 133 ? -5.952 -13.220 -20.345 1.00 38.53 ? 117 LYS A CA 1
+ATOM 912 C C . LYS A 1 133 ? -5.627 -11.765 -20.041 1.00 27.92 ? 117 LYS A C 1
+ATOM 913 O O . LYS A 1 133 ? -6.497 -10.897 -20.115 1.00 36.68 ? 117 LYS A O 1
+ATOM 914 C CB . LYS A 1 133 ? -5.445 -13.569 -21.750 1.00 34.54 ? 117 LYS A CB 1
+ATOM 915 C CG . LYS A 1 133 ? -5.556 -15.036 -22.129 1.00 61.79 ? 117 LYS A CG 1
+ATOM 916 C CD . LYS A 1 133 ? -5.064 -15.271 -23.551 1.00 77.03 ? 117 LYS A CD 1
+ATOM 917 C CE . LYS A 1 133 ? -5.213 -16.729 -23.961 1.00 90.51 ? 117 LYS A CE 1
+ATOM 918 N NZ . LYS A 1 133 ? -6.635 -17.172 -23.971 1.00 58.53 ? 117 LYS A NZ 1
+ATOM 919 N N . GLY A 1 134 ? -4.367 -11.517 -19.695 1.00 38.65 ? 118 GLY A N 1
+ATOM 920 C CA . GLY A 1 134 ? -3.826 -10.174 -19.572 1.00 48.96 ? 118 GLY A CA 1
+ATOM 921 C C . GLY A 1 134 ? -4.619 -9.183 -18.743 1.00 52.47 ? 118 GLY A C 1
+ATOM 922 O O . GLY A 1 134 ? -4.860 -9.400 -17.556 1.00 34.36 ? 118 GLY A O 1
+ATOM 923 N N . LYS A 1 135 ? -5.024 -8.091 -19.386 1.00 31.75 ? 119 LYS A N 1
+ATOM 924 C CA . LYS A 1 135 ? -5.686 -6.980 -18.710 1.00 32.29 ? 119 LYS A CA 1
+ATOM 925 C C . LYS A 1 135 ? -7.039 -7.368 -18.124 1.00 24.64 ? 119 LYS A C 1
+ATOM 926 O O . LYS A 1 135 ? -7.344 -7.027 -16.981 1.00 35.79 ? 119 LYS A O 1
+ATOM 927 C CB . LYS A 1 135 ? -5.865 -5.808 -19.677 1.00 47.74 ? 119 LYS A CB 1
+ATOM 928 C CG . LYS A 1 135 ? -6.391 -4.539 -19.029 1.00 45.54 ? 119 LYS A CG 1
+ATOM 929 C CD . LYS A 1 135 ? -5.298 -3.817 -18.260 1.00 108.53 ? 119 LYS A CD 1
+ATOM 930 C CE . LYS A 1 135 ? -5.830 -2.557 -17.594 1.00 90.25 ? 119 LYS A CE 1
+ATOM 931 N NZ . LYS A 1 135 ? -6.823 -2.872 -16.531 1.00 108.59 ? 119 LYS A NZ 1
+ATOM 932 N N . GLU A 1 136 ? -7.852 -8.066 -18.914 1.00 24.94 ? 120 GLU A N 1
+ATOM 933 C CA . GLU A 1 136 ? -9.177 -8.479 -18.463 1.00 40.09 ? 120 GLU A CA 1
+ATOM 934 C C . GLU A 1 136 ? -9.070 -9.454 -17.293 1.00 29.32 ? 120 GLU A C 1
+ATOM 935 O O . GLU A 1 136 ? -9.886 -9.426 -16.377 1.00 29.76 ? 120 GLU A O 1
+ATOM 936 C CB . GLU A 1 136 ? -9.974 -9.115 -19.608 1.00 30.32 ? 120 GLU A CB 1
+ATOM 937 C CG . GLU A 1 136 ? -11.407 -9.473 -19.219 1.00 41.75 ? 120 GLU A CG 1
+ATOM 938 C CD . GLU A 1 136 ? -12.177 -10.162 -20.331 1.00 70.29 ? 120 GLU A CD 1
+ATOM 939 O OE1 . GLU A 1 136 ? -11.573 -10.470 -21.380 1.00 66.08 ? 120 GLU A OE1 1
+ATOM 940 O OE2 . GLU A 1 136 ? -13.392 -10.397 -20.150 1.00 61.77 ? 120 GLU A OE2 1
+ATOM 941 N N . LEU A 1 137 ? -8.056 -10.312 -17.332 1.00 28.83 ? 121 LEU A N 1
+ATOM 942 C CA . LEU A 1 137 ? -7.824 -11.268 -16.259 1.00 27.67 ? 121 LEU A CA 1
+ATOM 943 C C . LEU A 1 137 ? -7.473 -10.543 -14.963 1.00 32.97 ? 121 LEU A C 1
+ATOM 944 O O . LEU A 1 137 ? -8.073 -10.798 -13.921 1.00 24.50 ? 121 LEU A O 1
+ATOM 945 C CB . LEU A 1 137 ? -6.710 -12.251 -16.638 1.00 19.00 ? 121 LEU A CB 1
+ATOM 946 C CG . LEU A 1 137 ? -6.298 -13.234 -15.537 1.00 23.27 ? 121 LEU A CG 1
+ATOM 947 C CD1 . LEU A 1 137 ? -7.467 -14.126 -15.131 1.00 19.61 ? 121 LEU A CD1 1
+ATOM 948 C CD2 . LEU A 1 137 ? -5.100 -14.072 -15.965 1.00 31.26 ? 121 LEU A CD2 1
+ATOM 949 N N . PHE A 1 138 ? -6.508 -9.631 -15.039 1.00 31.15 ? 122 PHE A N 1
+ATOM 950 C CA . PHE A 1 138 ? -6.064 -8.890 -13.864 1.00 29.95 ? 122 PHE A CA 1
+ATOM 951 C C . PHE A 1 138 ? -7.188 -8.053 -13.253 1.00 20.71 ? 122 PHE A C 1
+ATOM 952 O O . PHE A 1 138 ? -7.382 -8.057 -12.037 1.00 25.26 ? 122 PHE A O 1
+ATOM 953 C CB . PHE A 1 138 ? -4.877 -7.989 -14.215 1.00 32.28 ? 122 PHE A CB 1
+ATOM 954 C CG . PHE A 1 138 ? -4.407 -7.136 -13.069 1.00 57.18 ? 122 PHE A CG 1
+ATOM 955 C CD1 . PHE A 1 138 ? -3.570 -7.659 -12.097 1.00 68.91 ? 122 PHE A CD1 1
+ATOM 956 C CD2 . PHE A 1 138 ? -4.805 -5.812 -12.963 1.00 48.46 ? 122 PHE A CD2 1
+ATOM 957 C CE1 . PHE A 1 138 ? -3.138 -6.878 -11.039 1.00 69.40 ? 122 PHE A CE1 1
+ATOM 958 C CE2 . PHE A 1 138 ? -4.376 -5.026 -11.908 1.00 52.84 ? 122 PHE A CE2 1
+ATOM 959 C CZ . PHE A 1 138 ? -3.542 -5.560 -10.945 1.00 50.92 ? 122 PHE A CZ 1
+ATOM 960 N N . SER A 1 139 ? -7.925 -7.336 -14.096 1.00 27.75 ? 123 SER A N 1
+ATOM 961 C CA . SER A 1 139 ? -9.002 -6.473 -13.617 1.00 30.22 ? 123 SER A CA 1
+ATOM 962 C C . SER A 1 139 ? -10.172 -7.274 -13.036 1.00 28.90 ? 123 SER A C 1
+ATOM 963 O O . SER A 1 139 ? -10.732 -6.898 -12.007 1.00 29.36 ? 123 SER A O 1
+ATOM 964 C CB . SER A 1 139 ? -9.497 -5.560 -14.743 1.00 26.73 ? 123 SER A CB 1
+ATOM 965 O OG . SER A 1 139 ? -10.001 -6.317 -15.828 1.00 73.67 ? 123 SER A OG 1
+ATOM 966 N N . THR A 1 140 ? -10.544 -8.371 -13.692 1.00 26.14 ? 124 THR A N 1
+ATOM 967 C CA . THR A 1 140 ? -11.643 -9.205 -13.204 1.00 23.43 ? 124 THR A CA 1
+ATOM 968 C C . THR A 1 140 ? -11.285 -9.855 -11.870 1.00 20.04 ? 124 THR A C 1
+ATOM 969 O O . THR A 1 140 ? -12.096 -9.878 -10.941 1.00 28.54 ? 124 THR A O 1
+ATOM 970 C CB . THR A 1 140 ? -12.020 -10.309 -14.208 1.00 23.88 ? 124 THR A CB 1
+ATOM 971 O OG1 . THR A 1 140 ? -12.334 -9.721 -15.476 1.00 29.15 ? 124 THR A OG1 1
+ATOM 972 C CG2 . THR A 1 140 ? -13.227 -11.101 -13.706 1.00 21.76 ? 124 THR A CG2 1
+ATOM 973 N N . ALA A 1 141 ? -10.068 -10.380 -11.783 1.00 18.70 ? 125 ALA A N 1
+ATOM 974 C CA . ALA A 1 141 ? -9.591 -11.004 -10.557 1.00 27.59 ? 125 ALA A CA 1
+ATOM 975 C C . ALA A 1 141 ? -9.576 -9.998 -9.415 1.00 22.60 ? 125 ALA A C 1
+ATOM 976 O O . ALA A 1 141 ? -9.949 -10.315 -8.288 1.00 22.93 ? 125 ALA A O 1
+ATOM 977 C CB . ALA A 1 141 ? -8.203 -11.594 -10.762 1.00 21.06 ? 125 ALA A CB 1
+ATOM 978 N N . THR A 1 142 ? -9.149 -8.779 -9.717 1.00 23.71 ? 126 THR A N 1
+ATOM 979 C CA . THR A 1 142 ? -9.049 -7.741 -8.700 1.00 21.75 ? 126 THR A CA 1
+ATOM 980 C C . THR A 1 142 ? -10.420 -7.416 -8.128 1.00 23.65 ? 126 THR A C 1
+ATOM 981 O O . THR A 1 142 ? -10.588 -7.364 -6.915 1.00 24.90 ? 126 THR A O 1
+ATOM 982 C CB . THR A 1 142 ? -8.409 -6.465 -9.259 1.00 29.20 ? 126 THR A CB 1
+ATOM 983 O OG1 . THR A 1 142 ? -7.087 -6.765 -9.718 1.00 35.29 ? 126 THR A OG1 1
+ATOM 984 C CG2 . THR A 1 142 ? -8.329 -5.392 -8.184 1.00 32.99 ? 126 THR A CG2 1
+ATOM 985 N N . TRP A 1 143 ? -11.403 -7.215 -9.001 1.00 16.04 ? 127 TRP A N 1
+ATOM 986 C CA . TRP A 1 143 ? -12.757 -6.913 -8.548 1.00 17.58 ? 127 TRP A CA 1
+ATOM 987 C C . TRP A 1 143 ? -13.377 -8.086 -7.797 1.00 27.50 ? 127 TRP A C 1
+ATOM 988 O O . TRP A 1 143 ? -14.111 -7.895 -6.827 1.00 21.84 ? 127 TRP A O 1
+ATOM 989 C CB . TRP A 1 143 ? -13.648 -6.523 -9.730 1.00 37.50 ? 127 TRP A CB 1
+ATOM 990 C CG . TRP A 1 143 ? -13.363 -5.157 -10.258 1.00 34.97 ? 127 TRP A CG 1
+ATOM 991 C CD1 . TRP A 1 143 ? -12.822 -4.842 -11.469 1.00 33.99 ? 127 TRP A CD1 1
+ATOM 992 C CD2 . TRP A 1 143 ? -13.592 -3.914 -9.585 1.00 28.91 ? 127 TRP A CD2 1
+ATOM 993 N NE1 . TRP A 1 143 ? -12.706 -3.479 -11.595 1.00 39.49 ? 127 TRP A NE1 1
+ATOM 994 C CE2 . TRP A 1 143 ? -13.172 -2.886 -10.451 1.00 47.41 ? 127 TRP A CE2 1
+ATOM 995 C CE3 . TRP A 1 143 ? -14.117 -3.571 -8.336 1.00 37.36 ? 127 TRP A CE3 1
+ATOM 996 C CZ2 . TRP A 1 143 ? -13.259 -1.539 -10.108 1.00 36.94 ? 127 TRP A CZ2 1
+ATOM 997 C CZ3 . TRP A 1 143 ? -14.202 -2.233 -7.996 1.00 44.82 ? 127 TRP A CZ3 1
+ATOM 998 C CH2 . TRP A 1 143 ? -13.776 -1.234 -8.879 1.00 49.08 ? 127 TRP A CH2 1
+ATOM 999 N N . LEU A 1 144 ? -13.088 -9.299 -8.258 1.00 20.39 ? 128 LEU A N 1
+ATOM 1000 C CA . LEU A 1 144 ? -13.602 -10.500 -7.612 1.00 20.63 ? 128 LEU A CA 1
+ATOM 1001 C C . LEU A 1 144 ? -13.048 -10.656 -6.205 1.00 17.14 ? 128 LEU A C 1
+ATOM 1002 O O . LEU A 1 144 ? -13.784 -10.952 -5.267 1.00 23.59 ? 128 LEU A O 1
+ATOM 1003 C CB . LEU A 1 144 ? -13.268 -11.740 -8.441 1.00 16.02 ? 128 LEU A CB 1
+ATOM 1004 C CG . LEU A 1 144 ? -14.275 -12.066 -9.541 1.00 24.01 ? 128 LEU A CG 1
+ATOM 1005 C CD1 . LEU A 1 144 ? -13.804 -13.250 -10.361 1.00 16.75 ? 128 LEU A CD1 1
+ATOM 1006 C CD2 . LEU A 1 144 ? -15.637 -12.342 -8.920 1.00 20.11 ? 128 LEU A CD2 1
+ATOM 1007 N N . ILE A 1 145 ? -11.741 -10.456 -6.073 1.00 19.30 ? 129 ILE A N 1
+ATOM 1008 C CA . ILE A 1 145 ? -11.057 -10.637 -4.803 1.00 20.36 ? 129 ILE A CA 1
+ATOM 1009 C C . ILE A 1 145 ? -11.484 -9.568 -3.800 1.00 19.57 ? 129 ILE A C 1
+ATOM 1010 O O . ILE A 1 145 ? -11.647 -9.855 -2.614 1.00 22.57 ? 129 ILE A O 1
+ATOM 1011 C CB . ILE A 1 145 ? -9.527 -10.625 -5.002 1.00 21.27 ? 129 ILE A CB 1
+ATOM 1012 C CG1 . ILE A 1 145 ? -9.098 -11.881 -5.764 1.00 24.55 ? 129 ILE A CG1 1
+ATOM 1013 C CG2 . ILE A 1 145 ? -8.800 -10.560 -3.668 1.00 28.35 ? 129 ILE A CG2 1
+ATOM 1014 C CD1 . ILE A 1 145 ? -7.651 -11.868 -6.200 1.00 38.97 ? 129 ILE A CD1 1
+ATOM 1015 N N . LEU A 1 146 ? -11.689 -8.343 -4.280 1.00 17.50 ? 130 LEU A N 1
+ATOM 1016 C CA . LEU A 1 146 ? -12.175 -7.265 -3.419 1.00 23.98 ? 130 LEU A CA 1
+ATOM 1017 C C . LEU A 1 146 ? -13.597 -7.542 -2.931 1.00 23.65 ? 130 LEU A C 1
+ATOM 1018 O O . LEU A 1 146 ? -13.941 -7.252 -1.782 1.00 23.67 ? 130 LEU A O 1
+ATOM 1019 C CB . LEU A 1 146 ? -12.125 -5.922 -4.155 1.00 21.10 ? 130 LEU A CB 1
+ATOM 1020 C CG . LEU A 1 146 ? -10.731 -5.336 -4.398 1.00 29.89 ? 130 LEU A CG 1
+ATOM 1021 C CD1 . LEU A 1 146 ? -10.817 -4.067 -5.233 1.00 32.31 ? 130 LEU A CD1 1
+ATOM 1022 C CD2 . LEU A 1 146 ? -10.023 -5.065 -3.079 1.00 27.06 ? 130 LEU A CD2 1
+ATOM 1023 N N . ALA A 1 147 ? -14.426 -8.099 -3.808 1.00 18.43 ? 131 ALA A N 1
+ATOM 1024 C CA . ALA A 1 147 ? -15.787 -8.459 -3.427 1.00 14.24 ? 131 ALA A CA 1
+ATOM 1025 C C . ALA A 1 147 ? -15.786 -9.603 -2.411 1.00 23.03 ? 131 ALA A C 1
+ATOM 1026 O O . ALA A 1 147 ? -16.553 -9.585 -1.449 1.00 18.38 ? 131 ALA A O 1
+ATOM 1027 C CB . ALA A 1 147 ? -16.599 -8.838 -4.652 1.00 17.96 ? 131 ALA A CB 1
+ATOM 1028 N N . ALA A 1 148 ? -14.924 -10.595 -2.635 1.00 21.94 ? 132 ALA A N 1
+ATOM 1029 C CA . ALA A 1 148 ? -14.830 -11.752 -1.745 1.00 21.74 ? 132 ALA A CA 1
+ATOM 1030 C C . ALA A 1 148 ? -14.316 -11.355 -0.365 1.00 21.69 ? 132 ALA A C 1
+ATOM 1031 O O . ALA A 1 148 ? -14.826 -11.817 0.651 1.00 19.73 ? 132 ALA A O 1
+ATOM 1032 C CB . ALA A 1 148 ? -13.930 -12.819 -2.356 1.00 14.13 ? 132 ALA A CB 1
+ATOM 1033 N N . TRP A 1 149 ? -13.302 -10.498 -0.337 1.00 13.73 ? 133 TRP A N 1
+ATOM 1034 C CA . TRP A 1 149 ? -12.740 -10.019 0.920 1.00 23.20 ? 133 TRP A CA 1
+ATOM 1035 C C . TRP A 1 149 ? -13.743 -9.185 1.716 1.00 18.12 ? 133 TRP A C 1
+ATOM 1036 O O . TRP A 1 149 ? -13.775 -9.253 2.939 1.00 19.17 ? 133 TRP A O 1
+ATOM 1037 C CB . TRP A 1 149 ? -11.470 -9.210 0.657 1.00 17.86 ? 133 TRP A CB 1
+ATOM 1038 C CG . TRP A 1 149 ? -10.277 -10.071 0.375 1.00 18.60 ? 133 TRP A CG 1
+ATOM 1039 C CD1 . TRP A 1 149 ? -10.209 -11.434 0.457 1.00 21.99 ? 133 TRP A CD1 1
+ATOM 1040 C CD2 . TRP A 1 149 ? -8.976 -9.628 -0.027 1.00 29.85 ? 133 TRP A CD2 1
+ATOM 1041 N NE1 . TRP A 1 149 ? -8.943 -11.866 0.132 1.00 24.62 ? 133 TRP A NE1 1
+ATOM 1042 C CE2 . TRP A 1 149 ? -8.168 -10.776 -0.169 1.00 26.86 ? 133 TRP A CE2 1
+ATOM 1043 C CE3 . TRP A 1 149 ? -8.414 -8.373 -0.281 1.00 39.08 ? 133 TRP A CE3 1
+ATOM 1044 C CZ2 . TRP A 1 149 ? -6.831 -10.705 -0.555 1.00 31.45 ? 133 TRP A CZ2 1
+ATOM 1045 C CZ3 . TRP A 1 149 ? -7.085 -8.304 -0.664 1.00 37.26 ? 133 TRP A CZ3 1
+ATOM 1046 C CH2 . TRP A 1 149 ? -6.309 -9.464 -0.798 1.00 30.33 ? 133 TRP A CH2 1
+ATOM 1047 N N . GLY A 1 150 ? -14.561 -8.402 1.023 1.00 16.66 ? 134 GLY A N 1
+ATOM 1048 C CA . GLY A 1 150 ? -15.614 -7.652 1.684 1.00 15.54 ? 134 GLY A CA 1
+ATOM 1049 C C . GLY A 1 150 ? -16.625 -8.588 2.327 1.00 23.48 ? 134 GLY A C 1
+ATOM 1050 O O . GLY A 1 150 ? -17.078 -8.368 3.450 1.00 18.41 ? 134 GLY A O 1
+ATOM 1051 N N . MET A 1 151 ? -16.977 -9.643 1.603 1.00 15.25 ? 135 MET A N 1
+ATOM 1052 C CA . MET A 1 151 ? -17.888 -10.662 2.107 1.00 12.66 ? 135 MET A CA 1
+ATOM 1053 C C . MET A 1 151 ? -17.337 -11.350 3.360 1.00 11.98 ? 135 MET A C 1
+ATOM 1054 O O . MET A 1 151 ? -18.024 -11.473 4.372 1.00 12.64 ? 135 MET A O 1
+ATOM 1055 C CB . MET A 1 151 ? -18.153 -11.698 1.013 1.00 13.21 ? 135 MET A CB 1
+ATOM 1056 C CG . MET A 1 151 ? -19.087 -12.822 1.408 1.00 11.46 ? 135 MET A CG 1
+ATOM 1057 S SD . MET A 1 151 ? -19.207 -14.077 0.115 1.00 17.65 ? 135 MET A SD 1
+ATOM 1058 C CE . MET A 1 151 ? -17.541 -14.750 0.107 1.00 16.94 ? 135 MET A CE 1
+ATOM 1059 N N . ILE A 1 152 ? -16.091 -11.801 3.269 1.00 14.50 ? 136 ILE A N 1
+ATOM 1060 C CA . ILE A 1 152 ? -15.449 -12.567 4.331 1.00 13.39 ? 136 ILE A CA 1
+ATOM 1061 C C . ILE A 1 152 ? -15.235 -11.744 5.603 1.00 14.24 ? 136 ILE A C 1
+ATOM 1062 O O . ILE A 1 152 ? -15.530 -12.203 6.708 1.00 16.79 ? 136 ILE A O 1
+ATOM 1063 C CB . ILE A 1 152 ? -14.092 -13.118 3.857 1.00 9.52 ? 136 ILE A CB 1
+ATOM 1064 C CG1 . ILE A 1 152 ? -14.297 -14.101 2.700 1.00 14.93 ? 136 ILE A CG1 1
+ATOM 1065 C CG2 . ILE A 1 152 ? -13.354 -13.795 5.011 1.00 16.79 ? 136 ILE A CG2 1
+ATOM 1066 C CD1 . ILE A 1 152 ? -13.033 -14.388 1.924 1.00 16.24 ? 136 ILE A CD1 1
+ATOM 1067 N N . ILE A 1 153 ? -14.732 -10.525 5.439 1.00 19.35 ? 137 ILE A N 1
+ATOM 1068 C CA . ILE A 1 153 ? -14.436 -9.654 6.573 1.00 16.41 ? 137 ILE A CA 1
+ATOM 1069 C C . ILE A 1 153 ? -15.705 -9.247 7.326 1.00 16.24 ? 137 ILE A C 1
+ATOM 1070 O O . ILE A 1 153 ? -15.744 -9.279 8.557 1.00 16.76 ? 137 ILE A O 1
+ATOM 1071 C CB . ILE A 1 153 ? -13.679 -8.392 6.116 1.00 18.51 ? 137 ILE A CB 1
+ATOM 1072 C CG1 . ILE A 1 153 ? -12.274 -8.767 5.636 1.00 16.27 ? 137 ILE A CG1 1
+ATOM 1073 C CG2 . ILE A 1 153 ? -13.601 -7.366 7.242 1.00 19.64 ? 137 ILE A CG2 1
+ATOM 1074 C CD1 . ILE A 1 153 ? -11.566 -7.650 4.892 1.00 22.81 ? 137 ILE A CD1 1
+ATOM 1075 N N . THR A 1 154 ? -16.748 -8.874 6.592 1.00 14.85 ? 138 THR A N 1
+ATOM 1076 C CA . THR A 1 154 ? -17.999 -8.491 7.238 1.00 11.42 ? 138 THR A CA 1
+ATOM 1077 C C . THR A 1 154 ? -18.656 -9.700 7.897 1.00 17.73 ? 138 THR A C 1
+ATOM 1078 O O . THR A 1 154 ? -19.286 -9.579 8.948 1.00 20.44 ? 138 THR A O 1
+ATOM 1079 C CB . THR A 1 154 ? -18.975 -7.841 6.245 1.00 18.71 ? 138 THR A CB 1
+ATOM 1080 O OG1 . THR A 1 154 ? -19.170 -8.705 5.117 1.00 18.38 ? 138 THR A OG1 1
+ATOM 1081 C CG2 . THR A 1 154 ? -18.424 -6.510 5.770 1.00 14.84 ? 138 THR A CG2 1
+ATOM 1082 N N . GLY A 1 155 ? -18.503 -10.865 7.279 1.00 19.33 ? 139 GLY A N 1
+ATOM 1083 C CA . GLY A 1 155 ? -19.011 -12.094 7.858 1.00 13.01 ? 139 GLY A CA 1
+ATOM 1084 C C . GLY A 1 155 ? -18.240 -12.468 9.113 1.00 17.70 ? 139 GLY A C 1
+ATOM 1085 O O . GLY A 1 155 ? -18.824 -12.937 10.092 1.00 14.49 ? 139 GLY A O 1
+ATOM 1086 N N . TYR A 1 156 ? -16.926 -12.259 9.085 1.00 19.65 ? 140 TYR A N 1
+ATOM 1087 C CA . TYR A 1 156 ? -16.089 -12.536 10.247 1.00 15.41 ? 140 TYR A CA 1
+ATOM 1088 C C . TYR A 1 156 ? -16.504 -11.673 11.430 1.00 16.75 ? 140 TYR A C 1
+ATOM 1089 O O . TYR A 1 156 ? -16.625 -12.160 12.552 1.00 16.36 ? 140 TYR A O 1
+ATOM 1090 C CB . TYR A 1 156 ? -14.607 -12.303 9.941 1.00 19.68 ? 140 TYR A CB 1
+ATOM 1091 C CG . TYR A 1 156 ? -13.754 -12.376 11.188 1.00 21.77 ? 140 TYR A CG 1
+ATOM 1092 C CD1 . TYR A 1 156 ? -13.342 -13.601 11.699 1.00 19.18 ? 140 TYR A CD1 1
+ATOM 1093 C CD2 . TYR A 1 156 ? -13.389 -11.221 11.877 1.00 20.95 ? 140 TYR A CD2 1
+ATOM 1094 C CE1 . TYR A 1 156 ? -12.578 -13.674 12.852 1.00 24.39 ? 140 TYR A CE1 1
+ATOM 1095 C CE2 . TYR A 1 156 ? -12.629 -11.285 13.029 1.00 27.70 ? 140 TYR A CE2 1
+ATOM 1096 C CZ . TYR A 1 156 ? -12.225 -12.512 13.511 1.00 31.26 ? 140 TYR A CZ 1
+ATOM 1097 O OH . TYR A 1 156 ? -11.462 -12.575 14.654 1.00 35.76 ? 140 TYR A OH 1
+ATOM 1098 N N . VAL A 1 157 ? -16.712 -10.386 11.173 1.00 15.26 ? 141 VAL A N 1
+ATOM 1099 C CA . VAL A 1 157 ? -17.167 -9.473 12.211 1.00 19.58 ? 141 VAL A CA 1
+ATOM 1100 C C . VAL A 1 157 ? -18.529 -9.909 12.748 1.00 22.09 ? 141 VAL A C 1
+ATOM 1101 O O . VAL A 1 157 ? -18.759 -9.914 13.958 1.00 21.40 ? 141 VAL A O 1
+ATOM 1102 C CB . VAL A 1 157 ? -17.251 -8.025 11.692 1.00 20.64 ? 141 VAL A CB 1
+ATOM 1103 C CG1 . VAL A 1 157 ? -17.777 -7.102 12.776 1.00 22.81 ? 141 VAL A CG1 1
+ATOM 1104 C CG2 . VAL A 1 157 ? -15.886 -7.562 11.221 1.00 14.74 ? 141 VAL A CG2 1
+ATOM 1105 N N . GLY A 1 158 ? -19.423 -10.290 11.841 1.00 16.27 ? 142 GLY A N 1
+ATOM 1106 C CA . GLY A 1 158 ? -20.754 -10.731 12.222 1.00 15.79 ? 142 GLY A CA 1
+ATOM 1107 C C . GLY A 1 158 ? -20.785 -11.890 13.206 1.00 16.79 ? 142 GLY A C 1
+ATOM 1108 O O . GLY A 1 158 ? -21.519 -11.851 14.194 1.00 17.15 ? 142 GLY A O 1
+ATOM 1109 N N . GLN A 1 159 ? -19.985 -12.921 12.946 1.00 19.22 ? 143 GLN A N 1
+ATOM 1110 C CA . GLN A 1 159 ? -20.006 -14.118 13.782 1.00 14.85 ? 143 GLN A CA 1
+ATOM 1111 C C . GLN A 1 159 ? -19.356 -13.901 15.154 1.00 17.23 ? 143 GLN A C 1
+ATOM 1112 O O . GLN A 1 159 ? -19.433 -14.767 16.024 1.00 20.41 ? 143 GLN A O 1
+ATOM 1113 C CB . GLN A 1 159 ? -19.336 -15.283 13.055 1.00 7.25 ? 143 GLN A CB 1
+ATOM 1114 C CG . GLN A 1 159 ? -17.912 -15.026 12.606 1.00 15.08 ? 143 GLN A CG 1
+ATOM 1115 C CD . GLN A 1 159 ? -16.899 -15.423 13.651 1.00 28.71 ? 143 GLN A CD 1
+ATOM 1116 O OE1 . GLN A 1 159 ? -17.030 -16.467 14.289 1.00 21.51 ? 143 GLN A OE1 1
+ATOM 1117 N NE2 . GLN A 1 159 ? -15.887 -14.587 13.842 1.00 17.34 ? 143 GLN A NE2 1
+ATOM 1118 N N . LEU A 1 160 ? -18.733 -12.743 15.352 1.00 23.90 ? 144 LEU A N 1
+ATOM 1119 C CA . LEU A 1 160 ? -18.240 -12.370 16.676 1.00 23.70 ? 144 LEU A CA 1
+ATOM 1120 C C . LEU A 1 160 ? -19.405 -12.124 17.635 1.00 26.83 ? 144 LEU A C 1
+ATOM 1121 O O . LEU A 1 160 ? -19.224 -12.110 18.851 1.00 22.91 ? 144 LEU A O 1
+ATOM 1122 C CB . LEU A 1 160 ? -17.358 -11.124 16.599 1.00 19.40 ? 144 LEU A CB 1
+ATOM 1123 C CG . LEU A 1 160 ? -16.055 -11.223 15.807 1.00 22.88 ? 144 LEU A CG 1
+ATOM 1124 C CD1 . LEU A 1 160 ? -15.365 -9.875 15.784 1.00 30.56 ? 144 LEU A CD1 1
+ATOM 1125 C CD2 . LEU A 1 160 ? -15.139 -12.289 16.387 1.00 24.68 ? 144 LEU A CD2 1
+ATOM 1126 N N . TYR A 1 161 ? -20.600 -11.936 17.079 1.00 21.30 ? 145 TYR A N 1
+ATOM 1127 C CA . TYR A 1 161 ? -21.776 -11.592 17.873 1.00 19.92 ? 145 TYR A CA 1
+ATOM 1128 C C . TYR A 1 161 ? -22.815 -12.704 17.930 1.00 23.35 ? 145 TYR A C 1
+ATOM 1129 O O . TYR A 1 161 ? -23.941 -12.476 18.374 1.00 23.64 ? 145 TYR A O 1
+ATOM 1130 C CB . TYR A 1 161 ? -22.433 -10.324 17.317 1.00 19.02 ? 145 TYR A CB 1
+ATOM 1131 C CG . TYR A 1 161 ? -21.542 -9.110 17.386 1.00 26.31 ? 145 TYR A CG 1
+ATOM 1132 C CD1 . TYR A 1 161 ? -21.477 -8.339 18.540 1.00 22.42 ? 145 TYR A CD1 1
+ATOM 1133 C CD2 . TYR A 1 161 ? -20.760 -8.736 16.303 1.00 27.65 ? 145 TYR A CD2 1
+ATOM 1134 C CE1 . TYR A 1 161 ? -20.660 -7.232 18.612 1.00 26.76 ? 145 TYR A CE1 1
+ATOM 1135 C CE2 . TYR A 1 161 ? -19.940 -7.629 16.364 1.00 28.15 ? 145 TYR A CE2 1
+ATOM 1136 C CZ . TYR A 1 161 ? -19.895 -6.879 17.522 1.00 32.01 ? 145 TYR A CZ 1
+ATOM 1137 O OH . TYR A 1 161 ? -19.079 -5.774 17.588 1.00 32.76 ? 145 TYR A OH 1
+ATOM 1138 N N . GLU A 1 162 ? -22.442 -13.904 17.493 1.00 14.19 ? 146 GLU A N 1
+ATOM 1139 C CA . GLU A 1 162 ? -23.416 -14.982 17.347 1.00 25.51 ? 146 GLU A CA 1
+ATOM 1140 C C . GLU A 1 162 ? -23.964 -15.447 18.698 1.00 28.51 ? 146 GLU A C 1
+ATOM 1141 O O . GLU A 1 162 ? -25.008 -16.092 18.757 1.00 24.22 ? 146 GLU A O 1
+ATOM 1142 C CB . GLU A 1 162 ? -22.809 -16.163 16.575 1.00 17.20 ? 146 GLU A CB 1
+ATOM 1143 C CG . GLU A 1 162 ? -21.752 -16.961 17.327 1.00 23.48 ? 146 GLU A CG 1
+ATOM 1144 C CD . GLU A 1 162 ? -21.192 -18.111 16.500 1.00 32.23 ? 146 GLU A CD 1
+ATOM 1145 O OE1 . GLU A 1 162 ? -21.153 -17.995 15.256 1.00 27.10 ? 146 GLU A OE1 1
+ATOM 1146 O OE2 . GLU A 1 162 ? -20.798 -19.137 17.092 1.00 27.35 ? 146 GLU A OE2 1
+ATOM 1147 N N . VAL A 1 163 ? -23.272 -15.105 19.781 1.00 26.52 ? 147 VAL A N 1
+ATOM 1148 C CA . VAL A 1 163 ? -23.785 -15.374 21.122 1.00 30.85 ? 147 VAL A CA 1
+ATOM 1149 C C . VAL A 1 163 ? -24.353 -14.105 21.761 1.00 28.30 ? 147 VAL A C 1
+ATOM 1150 O O . VAL A 1 163 ? -25.461 -14.109 22.299 1.00 33.28 ? 147 VAL A O 1
+ATOM 1151 C CB . VAL A 1 163 ? -22.694 -15.956 22.048 1.00 29.99 ? 147 VAL A CB 1
+ATOM 1152 C CG1 . VAL A 1 163 ? -23.185 -16.002 23.488 1.00 29.83 ? 147 VAL A CG1 1
+ATOM 1153 C CG2 . VAL A 1 163 ? -22.270 -17.338 21.576 1.00 18.91 ? 147 VAL A CG2 1
+ATOM 1154 N N . ASP A 1 164 ? -23.594 -13.018 21.681 1.00 30.58 ? 148 ASP A N 1
+ATOM 1155 C CA . ASP A 1 164 ? -23.931 -11.786 22.393 1.00 35.31 ? 148 ASP A CA 1
+ATOM 1156 C C . ASP A 1 164 ? -25.044 -10.963 21.747 1.00 48.46 ? 148 ASP A C 1
+ATOM 1157 O O . ASP A 1 164 ? -25.855 -10.364 22.450 1.00 28.66 ? 148 ASP A O 1
+ATOM 1158 C CB . ASP A 1 164 ? -22.684 -10.909 22.537 1.00 33.41 ? 148 ASP A CB 1
+ATOM 1159 C CG . ASP A 1 164 ? -21.593 -11.575 23.355 1.00 78.54 ? 148 ASP A CG 1
+ATOM 1160 O OD1 . ASP A 1 164 ? -21.912 -12.509 24.121 1.00 39.75 ? 148 ASP A OD1 1
+ATOM 1161 O OD2 . ASP A 1 164 ? -20.421 -11.158 23.240 1.00 40.02 ? 148 ASP A OD2 1
+ATOM 1162 N N . ASP A 1 165 ? -25.081 -10.923 20.417 1.00 27.60 ? 149 ASP A N 1
+ATOM 1163 C CA . ASP A 1 165 ? -25.974 -10.000 19.721 1.00 22.60 ? 149 ASP A CA 1
+ATOM 1164 C C . ASP A 1 165 ? -26.440 -10.539 18.369 1.00 31.04 ? 149 ASP A C 1
+ATOM 1165 O O . ASP A 1 165 ? -25.886 -10.182 17.327 1.00 26.89 ? 149 ASP A O 1
+ATOM 1166 C CB . ASP A 1 165 ? -25.270 -8.652 19.532 1.00 23.76 ? 149 ASP A CB 1
+ATOM 1167 C CG . ASP A 1 165 ? -26.231 -7.524 19.198 1.00 31.50 ? 149 ASP A CG 1
+ATOM 1168 O OD1 . ASP A 1 165 ? -27.386 -7.806 18.817 1.00 29.07 ? 149 ASP A OD1 1
+ATOM 1169 O OD2 . ASP A 1 165 ? -25.818 -6.350 19.304 1.00 32.45 ? 149 ASP A OD2 1
+ATOM 1170 N N . ILE A 1 166 ? -27.473 -11.379 18.397 1.00 24.96 ? 150 ILE A N 1
+ATOM 1171 C CA . ILE A 1 166 ? -28.013 -12.008 17.189 1.00 24.34 ? 150 ILE A CA 1
+ATOM 1172 C C . ILE A 1 166 ? -28.433 -10.981 16.136 1.00 38.27 ? 150 ILE A C 1
+ATOM 1173 O O . ILE A 1 166 ? -28.242 -11.193 14.936 1.00 29.44 ? 150 ILE A O 1
+ATOM 1174 C CB . ILE A 1 166 ? -29.218 -12.913 17.527 1.00 32.74 ? 150 ILE A CB 1
+ATOM 1175 C CG1 . ILE A 1 166 ? -28.736 -14.178 18.231 1.00 47.17 ? 150 ILE A CG1 1
+ATOM 1176 C CG2 . ILE A 1 166 ? -29.976 -13.310 16.271 1.00 38.21 ? 150 ILE A CG2 1
+ATOM 1177 C CD1 . ILE A 1 166 ? -27.807 -15.010 17.385 1.00 36.53 ? 150 ILE A CD1 1
+ATOM 1178 N N . ALA A 1 167 ? -28.992 -9.865 16.591 1.00 21.61 ? 151 ALA A N 1
+ATOM 1179 C CA . ALA A 1 167 ? -29.389 -8.790 15.689 1.00 21.51 ? 151 ALA A CA 1
+ATOM 1180 C C . ALA A 1 167 ? -28.191 -8.271 14.902 1.00 24.37 ? 151 ALA A C 1
+ATOM 1181 O O . ALA A 1 167 ? -28.290 -8.007 13.705 1.00 21.48 ? 151 ALA A O 1
+ATOM 1182 C CB . ALA A 1 167 ? -30.040 -7.660 16.467 1.00 25.18 ? 151 ALA A CB 1
+ATOM 1183 N N . GLN A 1 168 ? -27.058 -8.132 15.580 1.00 16.17 ? 152 GLN A N 1
+ATOM 1184 C CA . GLN A 1 168 ? -25.855 -7.620 14.939 1.00 20.24 ? 152 GLN A CA 1
+ATOM 1185 C C . GLN A 1 168 ? -25.290 -8.647 13.965 1.00 23.83 ? 152 GLN A C 1
+ATOM 1186 O O . GLN A 1 168 ? -24.801 -8.290 12.896 1.00 22.39 ? 152 GLN A O 1
+ATOM 1187 C CB . GLN A 1 168 ? -24.805 -7.234 15.982 1.00 17.69 ? 152 GLN A CB 1
+ATOM 1188 C CG . GLN A 1 168 ? -23.540 -6.661 15.376 1.00 25.94 ? 152 GLN A CG 1
+ATOM 1189 C CD . GLN A 1 168 ? -22.902 -5.587 16.233 1.00 55.13 ? 152 GLN A CD 1
+ATOM 1190 O OE1 . GLN A 1 168 ? -22.010 -4.872 15.778 1.00 39.54 ? 152 GLN A OE1 1
+ATOM 1191 N NE2 . GLN A 1 168 ? -23.357 -5.465 17.477 1.00 38.47 ? 152 GLN A NE2 1
+ATOM 1192 N N . LEU A 1 169 ? -25.372 -9.920 14.340 1.00 23.85 ? 153 LEU A N 1
+ATOM 1193 C CA . LEU A 1 169 ? -25.004 -11.013 13.448 1.00 27.33 ? 153 LEU A CA 1
+ATOM 1194 C C . LEU A 1 169 ? -25.788 -10.939 12.140 1.00 24.50 ? 153 LEU A C 1
+ATOM 1195 O O . LEU A 1 169 ? -25.230 -11.114 11.058 1.00 22.42 ? 153 LEU A O 1
+ATOM 1196 C CB . LEU A 1 169 ? -25.249 -12.360 14.125 1.00 30.76 ? 153 LEU A CB 1
+ATOM 1197 C CG . LEU A 1 169 ? -25.094 -13.605 13.251 1.00 33.43 ? 153 LEU A CG 1
+ATOM 1198 C CD1 . LEU A 1 169 ? -23.716 -14.218 13.440 1.00 19.45 ? 153 LEU A CD1 1
+ATOM 1199 C CD2 . LEU A 1 169 ? -26.186 -14.618 13.558 1.00 37.50 ? 153 LEU A CD2 1
+ATOM 1200 N N . MET A 1 170 ? -27.082 -10.665 12.244 1.00 17.69 ? 154 MET A N 1
+ATOM 1201 C CA . MET A 1 170 ? -27.943 -10.617 11.065 1.00 30.68 ? 154 MET A CA 1
+ATOM 1202 C C . MET A 1 170 ? -27.630 -9.437 10.152 1.00 20.75 ? 154 MET A C 1
+ATOM 1203 O O . MET A 1 170 ? -27.622 -9.580 8.930 1.00 22.48 ? 154 MET A O 1
+ATOM 1204 C CB . MET A 1 170 ? -29.409 -10.569 11.484 1.00 22.36 ? 154 MET A CB 1
+ATOM 1205 C CG . MET A 1 170 ? -29.925 -11.881 12.052 1.00 40.86 ? 154 MET A CG 1
+ATOM 1206 S SD . MET A 1 170 ? -31.563 -11.704 12.775 1.00 68.41 ? 154 MET A SD 1
+ATOM 1207 C CE . MET A 1 170 ? -31.951 -13.405 13.172 1.00 50.37 ? 154 MET A CE 1
+ATOM 1208 N N . ILE A 1 171 ? -27.370 -8.275 10.740 1.00 21.10 ? 155 ILE A N 1
+ATOM 1209 C CA . ILE A 1 171 ? -27.087 -7.084 9.945 1.00 25.09 ? 155 ILE A CA 1
+ATOM 1210 C C . ILE A 1 171 ? -25.768 -7.212 9.199 1.00 22.08 ? 155 ILE A C 1
+ATOM 1211 O O . ILE A 1 171 ? -25.688 -6.892 8.010 1.00 20.90 ? 155 ILE A O 1
+ATOM 1212 C CB . ILE A 1 171 ? -27.056 -5.815 10.812 1.00 27.12 ? 155 ILE A CB 1
+ATOM 1213 C CG1 . ILE A 1 171 ? -28.384 -5.660 11.550 1.00 37.56 ? 155 ILE A CG1 1
+ATOM 1214 C CG2 . ILE A 1 171 ? -26.777 -4.588 9.952 1.00 21.25 ? 155 ILE A CG2 1
+ATOM 1215 C CD1 . ILE A 1 171 ? -29.592 -5.756 10.648 1.00 28.18 ? 155 ILE A CD1 1
+ATOM 1216 N N . TRP A 1 172 ? -24.733 -7.677 9.894 1.00 19.82 ? 156 TRP A N 1
+ATOM 1217 C CA . TRP A 1 172 ? -23.442 -7.909 9.252 1.00 20.70 ? 156 TRP A CA 1
+ATOM 1218 C C . TRP A 1 172 ? -23.568 -8.971 8.166 1.00 16.67 ? 156 TRP A C 1
+ATOM 1219 O O . TRP A 1 172 ? -22.892 -8.905 7.142 1.00 15.41 ? 156 TRP A O 1
+ATOM 1220 C CB . TRP A 1 172 ? -22.392 -8.337 10.273 1.00 13.54 ? 156 TRP A CB 1
+ATOM 1221 C CG . TRP A 1 172 ? -21.818 -7.218 11.087 1.00 19.78 ? 156 TRP A CG 1
+ATOM 1222 C CD1 . TRP A 1 172 ? -22.010 -6.995 12.417 1.00 25.40 ? 156 TRP A CD1 1
+ATOM 1223 C CD2 . TRP A 1 172 ? -20.950 -6.174 10.627 1.00 21.17 ? 156 TRP A CD2 1
+ATOM 1224 N NE1 . TRP A 1 172 ? -21.318 -5.877 12.816 1.00 31.45 ? 156 TRP A NE1 1
+ATOM 1225 C CE2 . TRP A 1 172 ? -20.659 -5.354 11.736 1.00 27.15 ? 156 TRP A CE2 1
+ATOM 1226 C CE3 . TRP A 1 172 ? -20.395 -5.851 9.385 1.00 20.46 ? 156 TRP A CE3 1
+ATOM 1227 C CZ2 . TRP A 1 172 ? -19.833 -4.235 11.642 1.00 34.93 ? 156 TRP A CZ2 1
+ATOM 1228 C CZ3 . TRP A 1 172 ? -19.574 -4.738 9.294 1.00 26.63 ? 156 TRP A CZ3 1
+ATOM 1229 C CH2 . TRP A 1 172 ? -19.302 -3.943 10.415 1.00 30.20 ? 156 TRP A CH2 1
+ATOM 1230 N N . GLY A 1 173 ? -24.445 -9.943 8.400 1.00 14.77 ? 157 GLY A N 1
+ATOM 1231 C CA . GLY A 1 173 ? -24.701 -10.995 7.435 1.00 21.22 ? 157 GLY A CA 1
+ATOM 1232 C C . GLY A 1 173 ? -25.403 -10.455 6.204 1.00 20.13 ? 157 GLY A C 1
+ATOM 1233 O O . GLY A 1 173 ? -25.204 -10.953 5.102 1.00 25.26 ? 157 GLY A O 1
+ATOM 1234 N N . ALA A 1 174 ? -26.225 -9.429 6.396 1.00 21.15 ? 158 ALA A N 1
+ATOM 1235 C CA . ALA A 1 174 ? -26.922 -8.796 5.283 1.00 17.99 ? 158 ALA A CA 1
+ATOM 1236 C C . ALA A 1 174 ? -25.929 -8.088 4.384 1.00 12.65 ? 158 ALA A C 1
+ATOM 1237 O O . ALA A 1 174 ? -25.991 -8.209 3.164 1.00 15.77 ? 158 ALA A O 1
+ATOM 1238 C CB . ALA A 1 174 ? -27.973 -7.818 5.792 1.00 23.25 ? 158 ALA A CB 1
+ATOM 1239 N N . VAL A 1 175 ? -25.013 -7.347 5.001 1.00 17.62 ? 159 VAL A N 1
+ATOM 1240 C CA . VAL A 1 175 ? -23.957 -6.656 4.272 1.00 20.17 ? 159 VAL A CA 1
+ATOM 1241 C C . VAL A 1 175 ? -23.067 -7.655 3.543 1.00 26.48 ? 159 VAL A C 1
+ATOM 1242 O O . VAL A 1 175 ? -22.704 -7.451 2.385 1.00 19.97 ? 159 VAL A O 1
+ATOM 1243 C CB . VAL A 1 175 ? -23.095 -5.793 5.213 1.00 18.16 ? 159 VAL A CB 1
+ATOM 1244 C CG1 . VAL A 1 175 ? -21.962 -5.128 4.445 1.00 24.65 ? 159 VAL A CG1 1
+ATOM 1245 C CG2 . VAL A 1 175 ? -23.957 -4.752 5.910 1.00 23.24 ? 159 VAL A CG2 1
+ATOM 1246 N N . SER A 1 176 ? -22.733 -8.742 4.230 1.00 17.09 ? 160 SER A N 1
+ATOM 1247 C CA . SER A 1 176 ? -21.896 -9.787 3.661 1.00 19.66 ? 160 SER A CA 1
+ATOM 1248 C C . SER A 1 176 ? -22.569 -10.417 2.441 1.00 17.20 ? 160 SER A C 1
+ATOM 1249 O O . SER A 1 176 ? -21.922 -10.692 1.431 1.00 17.82 ? 160 SER A O 1
+ATOM 1250 C CB . SER A 1 176 ? -21.599 -10.856 4.719 1.00 14.39 ? 160 SER A CB 1
+ATOM 1251 O OG . SER A 1 176 ? -20.671 -11.809 4.232 1.00 25.03 ? 160 SER A OG 1
+ATOM 1252 N N . THR A 1 177 ? -23.874 -10.637 2.550 1.00 15.70 ? 161 THR A N 1
+ATOM 1253 C CA . THR A 1 177 ? -24.655 -11.238 1.482 1.00 23.77 ? 161 THR A CA 1
+ATOM 1254 C C . THR A 1 177 ? -24.684 -10.334 0.247 1.00 16.41 ? 161 THR A C 1
+ATOM 1255 O O . THR A 1 177 ? -24.692 -10.821 -0.882 1.00 23.67 ? 161 THR A O 1
+ATOM 1256 C CB . THR A 1 177 ? -26.089 -11.549 1.962 1.00 26.98 ? 161 THR A CB 1
+ATOM 1257 O OG1 . THR A 1 177 ? -26.031 -12.529 3.007 1.00 19.69 ? 161 THR A OG1 1
+ATOM 1258 C CG2 . THR A 1 177 ? -26.950 -12.089 0.825 1.00 24.01 ? 161 THR A CG2 1
+ATOM 1259 N N . ALA A 1 178 ? -24.664 -9.021 0.467 1.00 27.50 ? 162 ALA A N 1
+ATOM 1260 C CA . ALA A 1 178 ? -24.615 -8.060 -0.635 1.00 23.91 ? 162 ALA A CA 1
+ATOM 1261 C C . ALA A 1 178 ? -23.341 -8.233 -1.463 1.00 27.75 ? 162 ALA A C 1
+ATOM 1262 O O . ALA A 1 178 ? -23.393 -8.272 -2.691 1.00 21.17 ? 162 ALA A O 1
+ATOM 1263 C CB . ALA A 1 178 ? -24.716 -6.635 -0.108 1.00 19.08 ? 162 ALA A CB 1
+ATOM 1264 N N . PHE A 1 179 ? -22.200 -8.323 -0.785 1.00 11.54 ? 163 PHE A N 1
+ATOM 1265 C CA . PHE A 1 179 ? -20.933 -8.628 -1.446 1.00 11.76 ? 163 PHE A CA 1
+ATOM 1266 C C . PHE A 1 179 ? -21.009 -9.972 -2.169 1.00 14.42 ? 163 PHE A C 1
+ATOM 1267 O O . PHE A 1 179 ? -20.517 -10.117 -3.287 1.00 22.79 ? 163 PHE A O 1
+ATOM 1268 C CB . PHE A 1 179 ? -19.775 -8.667 -0.440 1.00 15.94 ? 163 PHE A CB 1
+ATOM 1269 C CG . PHE A 1 179 ? -19.310 -7.314 0.021 1.00 30.01 ? 163 PHE A CG 1
+ATOM 1270 C CD1 . PHE A 1 179 ? -18.495 -6.535 -0.784 1.00 24.77 ? 163 PHE A CD1 1
+ATOM 1271 C CD2 . PHE A 1 179 ? -19.663 -6.835 1.269 1.00 21.92 ? 163 PHE A CD2 1
+ATOM 1272 C CE1 . PHE A 1 179 ? -18.057 -5.293 -0.359 1.00 35.89 ? 163 PHE A CE1 1
+ATOM 1273 C CE2 . PHE A 1 179 ? -19.222 -5.593 1.703 1.00 20.96 ? 163 PHE A CE2 1
+ATOM 1274 C CZ . PHE A 1 179 ? -18.422 -4.823 0.888 1.00 24.76 ? 163 PHE A CZ 1
+ATOM 1275 N N . PHE A 1 180 ? -21.615 -10.949 -1.502 1.00 15.75 ? 164 PHE A N 1
+ATOM 1276 C CA . PHE A 1 180 ? -21.783 -12.300 -2.033 1.00 17.04 ? 164 PHE A CA 1
+ATOM 1277 C C . PHE A 1 180 ? -22.534 -12.282 -3.358 1.00 20.17 ? 164 PHE A C 1
+ATOM 1278 O O . PHE A 1 180 ? -22.094 -12.866 -4.344 1.00 14.94 ? 164 PHE A O 1
+ATOM 1279 C CB . PHE A 1 180 ? -22.523 -13.160 -1.004 1.00 14.68 ? 164 PHE A CB 1
+ATOM 1280 C CG . PHE A 1 180 ? -22.767 -14.582 -1.433 1.00 13.28 ? 164 PHE A CG 1
+ATOM 1281 C CD1 . PHE A 1 180 ? -21.746 -15.356 -1.952 1.00 17.67 ? 164 PHE A CD1 1
+ATOM 1282 C CD2 . PHE A 1 180 ? -24.014 -15.161 -1.255 1.00 25.67 ? 164 PHE A CD2 1
+ATOM 1283 C CE1 . PHE A 1 180 ? -21.974 -16.674 -2.323 1.00 19.23 ? 164 PHE A CE1 1
+ATOM 1284 C CE2 . PHE A 1 180 ? -24.247 -16.476 -1.619 1.00 29.64 ? 164 PHE A CE2 1
+ATOM 1285 C CZ . PHE A 1 180 ? -23.225 -17.233 -2.154 1.00 22.98 ? 164 PHE A CZ 1
+ATOM 1286 N N . VAL A 1 181 ? -23.670 -11.597 -3.369 1.00 15.10 ? 165 VAL A N 1
+ATOM 1287 C CA . VAL A 1 181 ? -24.506 -11.503 -4.559 1.00 16.25 ? 165 VAL A CA 1
+ATOM 1288 C C . VAL A 1 181 ? -23.803 -10.775 -5.706 1.00 19.15 ? 165 VAL A C 1
+ATOM 1289 O O . VAL A 1 181 ? -23.880 -11.196 -6.866 1.00 16.91 ? 165 VAL A O 1
+ATOM 1290 C CB . VAL A 1 181 ? -25.836 -10.796 -4.227 1.00 18.15 ? 165 VAL A CB 1
+ATOM 1291 C CG1 . VAL A 1 181 ? -26.580 -10.420 -5.497 1.00 27.22 ? 165 VAL A CG1 1
+ATOM 1292 C CG2 . VAL A 1 181 ? -26.683 -11.690 -3.340 1.00 14.30 ? 165 VAL A CG2 1
+ATOM 1293 N N . VAL A 1 182 ? -23.109 -9.690 -5.381 1.00 17.11 ? 166 VAL A N 1
+ATOM 1294 C CA . VAL A 1 182 ? -22.350 -8.951 -6.387 1.00 17.19 ? 166 VAL A CA 1
+ATOM 1295 C C . VAL A 1 182 ? -21.214 -9.804 -6.946 1.00 23.52 ? 166 VAL A C 1
+ATOM 1296 O O . VAL A 1 182 ? -20.972 -9.821 -8.155 1.00 17.71 ? 166 VAL A O 1
+ATOM 1297 C CB . VAL A 1 182 ? -21.787 -7.636 -5.811 1.00 25.87 ? 166 VAL A CB 1
+ATOM 1298 C CG1 . VAL A 1 182 ? -20.715 -7.054 -6.725 1.00 24.57 ? 166 VAL A CG1 1
+ATOM 1299 C CG2 . VAL A 1 182 ? -22.915 -6.635 -5.597 1.00 21.70 ? 166 VAL A CG2 1
+ATOM 1300 N N . MET A 1 183 ? -20.522 -10.518 -6.065 1.00 16.72 ? 167 MET A N 1
+ATOM 1301 C CA . MET A 1 183 ? -19.464 -11.428 -6.494 1.00 16.96 ? 167 MET A CA 1
+ATOM 1302 C C . MET A 1 183 ? -20.002 -12.465 -7.473 1.00 14.67 ? 167 MET A C 1
+ATOM 1303 O O . MET A 1 183 ? -19.405 -12.713 -8.522 1.00 19.31 ? 167 MET A O 1
+ATOM 1304 C CB . MET A 1 183 ? -18.834 -12.127 -5.289 1.00 15.44 ? 167 MET A CB 1
+ATOM 1305 C CG . MET A 1 183 ? -17.733 -13.122 -5.647 1.00 20.68 ? 167 MET A CG 1
+ATOM 1306 S SD . MET A 1 183 ? -17.131 -14.015 -4.194 1.00 25.71 ? 167 MET A SD 1
+ATOM 1307 C CE . MET A 1 183 ? -18.638 -14.800 -3.631 1.00 46.16 ? 167 MET A CE 1
+ATOM 1308 N N . ASN A 1 184 ? -21.136 -13.063 -7.121 1.00 16.55 ? 168 ASN A N 1
+ATOM 1309 C CA . ASN A 1 184 ? -21.764 -14.078 -7.962 1.00 20.38 ? 168 ASN A CA 1
+ATOM 1310 C C . ASN A 1 184 ? -22.197 -13.519 -9.311 1.00 27.64 ? 168 ASN A C 1
+ATOM 1311 O O . ASN A 1 184 ? -22.161 -14.216 -10.323 1.00 19.75 ? 168 ASN A O 1
+ATOM 1312 C CB . ASN A 1 184 ? -22.969 -14.699 -7.244 1.00 19.21 ? 168 ASN A CB 1
+ATOM 1313 C CG . ASN A 1 184 ? -22.560 -15.588 -6.082 1.00 27.08 ? 168 ASN A CG 1
+ATOM 1314 O OD1 . ASN A 1 184 ? -21.418 -16.033 -6.003 1.00 39.74 ? 168 ASN A OD1 1
+ATOM 1315 N ND2 . ASN A 1 184 ? -23.497 -15.856 -5.179 1.00 29.54 ? 168 ASN A ND2 1
+ATOM 1316 N N . TRP A 1 185 ? -22.599 -12.254 -9.323 1.00 19.77 ? 169 TRP A N 1
+ATOM 1317 C CA . TRP A 1 185 ? -23.001 -11.604 -10.563 1.00 25.78 ? 169 TRP A CA 1
+ATOM 1318 C C . TRP A 1 185 ? -21.813 -11.451 -11.503 1.00 20.53 ? 169 TRP A C 1
+ATOM 1319 O O . TRP A 1 185 ? -21.933 -11.690 -12.702 1.00 22.60 ? 169 TRP A O 1
+ATOM 1320 C CB . TRP A 1 185 ? -23.631 -10.241 -10.283 1.00 26.57 ? 169 TRP A CB 1
+ATOM 1321 C CG . TRP A 1 185 ? -23.736 -9.382 -11.500 1.00 25.85 ? 169 TRP A CG 1
+ATOM 1322 C CD1 . TRP A 1 185 ? -24.666 -9.478 -12.494 1.00 16.39 ? 169 TRP A CD1 1
+ATOM 1323 C CD2 . TRP A 1 185 ? -22.871 -8.299 -11.862 1.00 18.92 ? 169 TRP A CD2 1
+ATOM 1324 N NE1 . TRP A 1 185 ? -24.436 -8.520 -13.451 1.00 17.65 ? 169 TRP A NE1 1
+ATOM 1325 C CE2 . TRP A 1 185 ? -23.341 -7.781 -13.085 1.00 18.61 ? 169 TRP A CE2 1
+ATOM 1326 C CE3 . TRP A 1 185 ? -21.748 -7.716 -11.269 1.00 22.40 ? 169 TRP A CE3 1
+ATOM 1327 C CZ2 . TRP A 1 185 ? -22.727 -6.710 -13.726 1.00 18.83 ? 169 TRP A CZ2 1
+ATOM 1328 C CZ3 . TRP A 1 185 ? -21.137 -6.652 -11.907 1.00 23.75 ? 169 TRP A CZ3 1
+ATOM 1329 C CH2 . TRP A 1 185 ? -21.627 -6.160 -13.124 1.00 20.09 ? 169 TRP A CH2 1
+ATOM 1330 N N . ILE A 1 186 ? -20.667 -11.058 -10.957 1.00 19.27 ? 170 ILE A N 1
+ATOM 1331 C CA . ILE A 1 186 ? -19.451 -10.952 -11.752 1.00 22.60 ? 170 ILE A CA 1
+ATOM 1332 C C . ILE A 1 186 ? -19.084 -12.307 -12.351 1.00 21.86 ? 170 ILE A C 1
+ATOM 1333 O O . ILE A 1 186 ? -18.795 -12.418 -13.543 1.00 24.80 ? 170 ILE A O 1
+ATOM 1334 C CB . ILE A 1 186 ? -18.269 -10.432 -10.918 1.00 29.30 ? 170 ILE A CB 1
+ATOM 1335 C CG1 . ILE A 1 186 ? -18.574 -9.035 -10.377 1.00 23.50 ? 170 ILE A CG1 1
+ATOM 1336 C CG2 . ILE A 1 186 ? -17.002 -10.419 -11.753 1.00 15.45 ? 170 ILE A CG2 1
+ATOM 1337 C CD1 . ILE A 1 186 ? -17.458 -8.438 -9.544 1.00 20.73 ? 170 ILE A CD1 1
+ATOM 1338 N N . VAL A 1 187 ? -19.112 -13.336 -11.512 1.00 18.71 ? 171 VAL A N 1
+ATOM 1339 C CA . VAL A 1 187 ? -18.793 -14.692 -11.938 1.00 26.33 ? 171 VAL A CA 1
+ATOM 1340 C C . VAL A 1 187 ? -19.733 -15.162 -13.054 1.00 22.50 ? 171 VAL A C 1
+ATOM 1341 O O . VAL A 1 187 ? -19.280 -15.595 -14.114 1.00 20.17 ? 171 VAL A O 1
+ATOM 1342 C CB . VAL A 1 187 ? -18.862 -15.673 -10.751 1.00 28.14 ? 171 VAL A CB 1
+ATOM 1343 C CG1 . VAL A 1 187 ? -18.791 -17.108 -11.236 1.00 18.90 ? 171 VAL A CG1 1
+ATOM 1344 C CG2 . VAL A 1 187 ? -17.740 -15.377 -9.744 1.00 14.69 ? 171 VAL A CG2 1
+ATOM 1345 N N . GLY A 1 188 ? -21.037 -15.059 -12.815 1.00 21.57 ? 172 GLY A N 1
+ATOM 1346 C CA . GLY A 1 188 ? -22.030 -15.457 -13.799 1.00 26.47 ? 172 GLY A CA 1
+ATOM 1347 C C . GLY A 1 188 ? -21.880 -14.717 -15.116 1.00 20.89 ? 172 GLY A C 1
+ATOM 1348 O O . GLY A 1 188 ? -21.950 -15.313 -16.191 1.00 28.44 ? 172 GLY A O 1
+ATOM 1349 N N . THR A 1 189 ? -21.655 -13.412 -15.030 1.00 18.25 ? 173 THR A N 1
+ATOM 1350 C CA . THR A 1 189 ? -21.483 -12.590 -16.217 1.00 20.01 ? 173 THR A CA 1
+ATOM 1351 C C . THR A 1 189 ? -20.266 -13.035 -17.028 1.00 33.30 ? 173 THR A C 1
+ATOM 1352 O O . THR A 1 189 ? -20.337 -13.128 -18.248 1.00 22.16 ? 173 THR A O 1
+ATOM 1353 C CB . THR A 1 189 ? -21.352 -11.098 -15.848 1.00 21.62 ? 173 THR A CB 1
+ATOM 1354 O OG1 . THR A 1 189 ? -22.582 -10.647 -15.263 1.00 25.61 ? 173 THR A OG1 1
+ATOM 1355 C CG2 . THR A 1 189 ? -21.055 -10.261 -17.084 1.00 28.92 ? 173 THR A CG2 1
+ATOM 1356 N N . LYS A 1 190 ? -19.159 -13.330 -16.354 1.00 20.39 ? 174 LYS A N 1
+ATOM 1357 C CA . LYS A 1 190 ? -17.957 -13.784 -17.055 1.00 20.20 ? 174 LYS A CA 1
+ATOM 1358 C C . LYS A 1 190 ? -18.141 -15.182 -17.643 1.00 23.88 ? 174 LYS A C 1
+ATOM 1359 O O . LYS A 1 190 ? -17.695 -15.453 -18.756 1.00 26.02 ? 174 LYS A O 1
+ATOM 1360 C CB . LYS A 1 190 ? -16.744 -13.766 -16.121 1.00 18.32 ? 174 LYS A CB 1
+ATOM 1361 C CG . LYS A 1 190 ? -16.295 -12.369 -15.719 1.00 26.43 ? 174 LYS A CG 1
+ATOM 1362 C CD . LYS A 1 190 ? -15.936 -11.534 -16.940 1.00 32.84 ? 174 LYS A CD 1
+ATOM 1363 C CE . LYS A 1 190 ? -15.512 -10.128 -16.544 1.00 46.60 ? 174 LYS A CE 1
+ATOM 1364 N NZ . LYS A 1 190 ? -15.175 -9.294 -17.732 1.00 40.03 ? 174 LYS A NZ 1
+ATOM 1365 N N . ILE A 1 191 ? -18.796 -16.066 -16.895 1.00 17.13 ? 175 ILE A N 1
+ATOM 1366 C CA . ILE A 1 191 ? -19.032 -17.428 -17.364 1.00 20.52 ? 175 ILE A CA 1
+ATOM 1367 C C . ILE A 1 191 ? -19.904 -17.463 -18.619 1.00 33.97 ? 175 ILE A C 1
+ATOM 1368 O O . ILE A 1 191 ? -19.521 -18.048 -19.631 1.00 25.67 ? 175 ILE A O 1
+ATOM 1369 C CB . ILE A 1 191 ? -19.687 -18.292 -16.273 1.00 19.21 ? 175 ILE A CB 1
+ATOM 1370 C CG1 . ILE A 1 191 ? -18.664 -18.636 -15.188 1.00 19.52 ? 175 ILE A CG1 1
+ATOM 1371 C CG2 . ILE A 1 191 ? -20.234 -19.580 -16.867 1.00 28.05 ? 175 ILE A CG2 1
+ATOM 1372 C CD1 . ILE A 1 191 ? -19.197 -19.560 -14.122 1.00 22.73 ? 175 ILE A CD1 1
+ATOM 1373 N N . PHE A 1 192 ? -21.069 -16.828 -18.562 1.00 23.75 ? 176 PHE A N 1
+ATOM 1374 C CA . PHE A 1 192 ? -22.009 -16.907 -19.675 1.00 45.18 ? 176 PHE A CA 1
+ATOM 1375 C C . PHE A 1 192 ? -21.562 -16.072 -20.875 1.00 36.06 ? 176 PHE A C 1
+ATOM 1376 O O . PHE A 1 192 ? -22.006 -16.308 -21.996 1.00 42.46 ? 176 PHE A O 1
+ATOM 1377 C CB . PHE A 1 192 ? -23.413 -16.499 -19.215 1.00 35.10 ? 176 PHE A CB 1
+ATOM 1378 C CG . PHE A 1 192 ? -24.040 -17.490 -18.273 1.00 33.49 ? 176 PHE A CG 1
+ATOM 1379 C CD1 . PHE A 1 192 ? -24.416 -18.746 -18.724 1.00 50.21 ? 176 PHE A CD1 1
+ATOM 1380 C CD2 . PHE A 1 192 ? -24.232 -17.180 -16.938 1.00 47.83 ? 176 PHE A CD2 1
+ATOM 1381 C CE1 . PHE A 1 192 ? -24.980 -19.671 -17.863 1.00 31.99 ? 176 PHE A CE1 1
+ATOM 1382 C CE2 . PHE A 1 192 ? -24.796 -18.101 -16.070 1.00 35.25 ? 176 PHE A CE2 1
+ATOM 1383 C CZ . PHE A 1 192 ? -25.170 -19.346 -16.534 1.00 52.88 ? 176 PHE A CZ 1
+ATOM 1384 N N . LYS A 1 193 ? -20.666 -15.117 -20.648 1.00 25.38 ? 177 LYS A N 1
+ATOM 1385 C CA . LYS A 1 193 ? -20.100 -14.344 -21.751 1.00 26.05 ? 177 LYS A CA 1
+ATOM 1386 C C . LYS A 1 193 ? -18.965 -15.088 -22.463 1.00 42.91 ? 177 LYS A C 1
+ATOM 1387 O O . LYS A 1 193 ? -18.907 -15.112 -23.692 1.00 77.38 ? 177 LYS A O 1
+ATOM 1388 C CB . LYS A 1 193 ? -19.593 -12.993 -21.251 1.00 23.15 ? 177 LYS A CB 1
+ATOM 1389 C CG . LYS A 1 193 ? -18.768 -12.224 -22.274 1.00 35.48 ? 177 LYS A CG 1
+ATOM 1390 C CD . LYS A 1 193 ? -18.018 -11.075 -21.619 1.00 91.50 ? 177 LYS A CD 1
+ATOM 1391 C CE . LYS A 1 193 ? -17.055 -10.413 -22.593 1.00 102.04 ? 177 LYS A CE 1
+ATOM 1392 N NZ . LYS A 1 193 ? -16.253 -9.338 -21.942 1.00 84.27 ? 177 LYS A NZ 1
+ATOM 1393 N N . ASN A 1 194 ? -18.068 -15.697 -21.690 1.00 28.09 ? 178 ASN A N 1
+ATOM 1394 C CA . ASN A 1 194 ? -16.882 -16.347 -22.248 1.00 22.93 ? 178 ASN A CA 1
+ATOM 1395 C C . ASN A 1 194 ? -17.087 -17.820 -22.549 1.00 25.58 ? 178 ASN A C 1
+ATOM 1396 O O . ASN A 1 194 ? -16.166 -18.504 -22.998 1.00 29.26 ? 178 ASN A O 1
+ATOM 1397 C CB . ASN A 1 194 ? -15.694 -16.192 -21.299 1.00 24.85 ? 178 ASN A CB 1
+ATOM 1398 C CG . ASN A 1 194 ? -15.233 -14.762 -21.183 1.00 41.14 ? 178 ASN A CG 1
+ATOM 1399 O OD1 . ASN A 1 194 ? -14.429 -14.292 -21.989 1.00 36.93 ? 178 ASN A OD1 1
+ATOM 1400 N ND2 . ASN A 1 194 ? -15.735 -14.058 -20.176 1.00 32.93 ? 178 ASN A ND2 1
+ATOM 1401 N N . ARG A 1 195 ? -18.296 -18.300 -22.287 1.00 26.18 ? 179 ARG A N 1
+ATOM 1402 C CA . ARG A 1 195 ? -18.665 -19.687 -22.540 1.00 31.06 ? 179 ARG A CA 1
+ATOM 1403 C C . ARG A 1 195 ? -18.361 -20.108 -23.981 1.00 63.37 ? 179 ARG A C 1
+ATOM 1404 O O . ARG A 1 195 ? -17.916 -21.229 -24.234 1.00 36.12 ? 179 ARG A O 1
+ATOM 1405 C CB . ARG A 1 195 ? -20.150 -19.884 -22.225 1.00 33.12 ? 179 ARG A CB 1
+ATOM 1406 C CG . ARG A 1 195 ? -20.678 -21.269 -22.498 1.00 52.70 ? 179 ARG A CG 1
+ATOM 1407 C CD . ARG A 1 195 ? -22.055 -21.457 -21.883 1.00 41.73 ? 179 ARG A CD 1
+ATOM 1408 N NE . ARG A 1 195 ? -23.010 -20.442 -22.314 1.00 54.14 ? 179 ARG A NE 1
+ATOM 1409 C CZ . ARG A 1 195 ? -24.291 -20.427 -21.955 1.00 77.94 ? 179 ARG A CZ 1
+ATOM 1410 N NH1 . ARG A 1 195 ? -24.769 -21.377 -21.163 1.00 54.73 ? 179 ARG A NH1 1
+ATOM 1411 N NH2 . ARG A 1 195 ? -25.095 -19.468 -22.392 1.00 62.06 ? 179 ARG A NH2 1
+ATOM 1412 N N . ALA A 1 196 ? -18.576 -19.189 -24.917 1.00 38.40 ? 180 ALA A N 1
+ATOM 1413 C CA . ALA A 1 196 ? -18.401 -19.472 -26.341 1.00 47.99 ? 180 ALA A CA 1
+ATOM 1414 C C . ALA A 1 196 ? -16.942 -19.709 -26.738 1.00 35.65 ? 180 ALA A C 1
+ATOM 1415 O O . ALA A 1 196 ? -16.671 -20.360 -27.746 1.00 46.32 ? 180 ALA A O 1
+ATOM 1416 C CB . ALA A 1 196 ? -18.985 -18.335 -27.167 1.00 44.62 ? 180 ALA A CB 1
+ATOM 1417 N N . THR A 1 197 ? -16.006 -19.187 -25.950 1.00 42.27 ? 181 THR A N 1
+ATOM 1418 C CA . THR A 1 197 ? -14.585 -19.303 -26.276 1.00 43.28 ? 181 THR A CA 1
+ATOM 1419 C C . THR A 1 197 ? -14.010 -20.670 -25.918 1.00 36.78 ? 181 THR A C 1
+ATOM 1420 O O . THR A 1 197 ? -12.863 -20.973 -26.246 1.00 39.93 ? 181 THR A O 1
+ATOM 1421 C CB . THR A 1 197 ? -13.744 -18.230 -25.549 1.00 57.51 ? 181 THR A CB 1
+ATOM 1422 O OG1 . THR A 1 197 ? -13.499 -18.636 -24.192 1.00 31.73 ? 181 THR A OG1 1
+ATOM 1423 C CG2 . THR A 1 197 ? -14.458 -16.889 -25.569 1.00 49.88 ? 181 THR A CG2 1
+ATOM 1424 N N . MET A 1 198 ? -14.805 -21.494 -25.247 1.00 32.07 ? 182 MET A N 1
+ATOM 1425 C CA . MET A 1 198 ? -14.283 -22.717 -24.656 1.00 42.02 ? 182 MET A CA 1
+ATOM 1426 C C . MET A 1 198 ? -14.412 -23.931 -25.562 1.00 37.98 ? 182 MET A C 1
+ATOM 1427 O O . MET A 1 198 ? -15.397 -24.093 -26.281 1.00 31.27 ? 182 MET A O 1
+ATOM 1428 C CB . MET A 1 198 ? -14.968 -22.966 -23.319 1.00 32.83 ? 182 MET A CB 1
+ATOM 1429 C CG . MET A 1 198 ? -14.722 -21.826 -22.346 1.00 30.62 ? 182 MET A CG 1
+ATOM 1430 S SD . MET A 1 198 ? -15.526 -22.048 -20.764 1.00 32.46 ? 182 MET A SD 1
+ATOM 1431 C CE . MET A 1 198 ? -14.689 -23.502 -20.136 1.00 24.34 ? 182 MET A CE 1
+ATOM 1432 N N . LEU A 1 199 ? -13.400 -24.788 -25.491 1.00 23.08 ? 183 LEU A N 1
+ATOM 1433 C CA . LEU A 1 199 ? -13.195 -25.863 -26.451 1.00 21.32 ? 183 LEU A CA 1
+ATOM 1434 C C . LEU A 1 199 ? -13.611 -27.230 -25.929 1.00 23.09 ? 183 LEU A C 1
+ATOM 1435 O O . LEU A 1 199 ? -13.814 -27.410 -24.729 1.00 26.19 ? 183 LEU A O 1
+ATOM 1436 C CB . LEU A 1 199 ? -11.718 -25.914 -26.851 1.00 22.97 ? 183 LEU A CB 1
+ATOM 1437 C CG . LEU A 1 199 ? -10.992 -24.579 -27.029 1.00 36.80 ? 183 LEU A CG 1
+ATOM 1438 C CD1 . LEU A 1 199 ? -9.487 -24.792 -27.114 1.00 35.55 ? 183 LEU A CD1 1
+ATOM 1439 C CD2 . LEU A 1 199 ? -11.500 -23.859 -28.267 1.00 36.11 ? 183 LEU A CD2 1
+ATOM 1440 N N . GLY A 1 200 ? -13.718 -28.190 -26.845 1.00 21.57 ? 184 GLY A N 1
+ATOM 1441 C CA . GLY A 1 200 ? -13.931 -29.583 -26.496 1.00 18.88 ? 184 GLY A CA 1
+ATOM 1442 C C . GLY A 1 200 ? -15.230 -29.853 -25.768 1.00 26.34 ? 184 GLY A C 1
+ATOM 1443 O O . GLY A 1 200 ? -15.347 -30.836 -25.037 1.00 26.01 ? 184 GLY A O 1
+ATOM 1444 N N . GLY A 1 201 ? -16.206 -28.973 -25.962 1.00 24.16 ? 185 GLY A N 1
+ATOM 1445 C CA . GLY A 1 201 ? -17.515 -29.135 -25.357 1.00 30.38 ? 185 GLY A CA 1
+ATOM 1446 C C . GLY A 1 201 ? -17.600 -28.647 -23.922 1.00 28.76 ? 185 GLY A C 1
+ATOM 1447 O O . GLY A 1 201 ? -18.605 -28.870 -23.247 1.00 33.02 ? 185 GLY A O 1
+ATOM 1448 N N . THR A 1 202 ? -16.555 -27.970 -23.455 1.00 26.86 ? 186 THR A N 1
+ATOM 1449 C CA . THR A 1 202 ? -16.520 -27.495 -22.074 1.00 21.22 ? 186 THR A CA 1
+ATOM 1450 C C . THR A 1 202 ? -17.380 -26.247 -21.889 1.00 34.44 ? 186 THR A C 1
+ATOM 1451 O O . THR A 1 202 ? -17.557 -25.771 -20.768 1.00 24.32 ? 186 THR A O 1
+ATOM 1452 C CB . THR A 1 202 ? -15.082 -27.194 -21.611 1.00 20.22 ? 186 THR A CB 1
+ATOM 1453 O OG1 . THR A 1 202 ? -14.503 -26.181 -22.443 1.00 19.93 ? 186 THR A OG1 1
+ATOM 1454 C CG2 . THR A 1 202 ? -14.232 -28.451 -21.683 1.00 17.09 ? 186 THR A CG2 1
+ATOM 1455 N N . ASP A 1 203 ? -17.911 -25.723 -22.991 1.00 22.60 ? 187 ASP A N 1
+ATOM 1456 C CA . ASP A 1 203 ? -18.882 -24.635 -22.929 1.00 20.72 ? 187 ASP A CA 1
+ATOM 1457 C C . ASP A 1 203 ? -20.136 -25.110 -22.198 1.00 24.08 ? 187 ASP A C 1
+ATOM 1458 O O . ASP A 1 203 ? -20.789 -24.342 -21.499 1.00 30.23 ? 187 ASP A O 1
+ATOM 1459 C CB . ASP A 1 203 ? -19.234 -24.132 -24.331 1.00 31.12 ? 187 ASP A CB 1
+ATOM 1460 C CG . ASP A 1 203 ? -19.787 -25.226 -25.224 1.00 42.46 ? 187 ASP A CG 1
+ATOM 1461 O OD1 . ASP A 1 203 ? -19.168 -26.308 -25.297 1.00 49.15 ? 187 ASP A OD1 1
+ATOM 1462 O OD2 . ASP A 1 203 ? -20.846 -25.006 -25.847 1.00 73.36 ? 187 ASP A OD2 1
+ATOM 1463 N N . SER A 1 204 ? -20.457 -26.388 -22.361 1.00 24.13 ? 188 SER A N 1
+ATOM 1464 C CA . SER A 1 204 ? -21.563 -27.002 -21.638 1.00 27.86 ? 188 SER A CA 1
+ATOM 1465 C C . SER A 1 204 ? -21.189 -27.282 -20.185 1.00 33.17 ? 188 SER A C 1
+ATOM 1466 O O . SER A 1 204 ? -21.997 -27.092 -19.275 1.00 28.98 ? 188 SER A O 1
+ATOM 1467 C CB . SER A 1 204 ? -21.992 -28.303 -22.320 1.00 33.85 ? 188 SER A CB 1
+ATOM 1468 O OG . SER A 1 204 ? -22.843 -29.057 -21.474 1.00 45.84 ? 188 SER A OG 1
+ATOM 1469 N N . THR A 1 205 ? -19.958 -27.737 -19.976 1.00 23.50 ? 189 THR A N 1
+ATOM 1470 C CA . THR A 1 205 ? -19.504 -28.139 -18.651 1.00 16.34 ? 189 THR A CA 1
+ATOM 1471 C C . THR A 1 205 ? -19.412 -26.961 -17.685 1.00 22.17 ? 189 THR A C 1
+ATOM 1472 O O . THR A 1 205 ? -19.782 -27.078 -16.519 1.00 20.36 ? 189 THR A O 1
+ATOM 1473 C CB . THR A 1 205 ? -18.129 -28.825 -18.717 1.00 25.82 ? 189 THR A CB 1
+ATOM 1474 O OG1 . THR A 1 205 ? -18.095 -29.732 -19.826 1.00 27.66 ? 189 THR A OG1 1
+ATOM 1475 C CG2 . THR A 1 205 ? -17.850 -29.584 -17.420 1.00 20.56 ? 189 THR A CG2 1
+ATOM 1476 N N . ILE A 1 206 ? -18.920 -25.829 -18.180 1.00 15.62 ? 190 ILE A N 1
+ATOM 1477 C CA . ILE A 1 206 ? -18.690 -24.656 -17.347 1.00 21.56 ? 190 ILE A CA 1
+ATOM 1478 C C . ILE A 1 206 ? -19.997 -24.107 -16.764 1.00 24.28 ? 190 ILE A C 1
+ATOM 1479 O O . ILE A 1 206 ? -19.997 -23.475 -15.707 1.00 19.22 ? 190 ILE A O 1
+ATOM 1480 C CB . ILE A 1 206 ? -17.957 -23.546 -18.143 1.00 20.54 ? 190 ILE A CB 1
+ATOM 1481 C CG1 . ILE A 1 206 ? -17.387 -22.485 -17.200 1.00 20.68 ? 190 ILE A CG1 1
+ATOM 1482 C CG2 . ILE A 1 206 ? -18.871 -22.928 -19.197 1.00 26.49 ? 190 ILE A CG2 1
+ATOM 1483 C CD1 . ILE A 1 206 ? -16.337 -23.020 -16.248 1.00 18.29 ? 190 ILE A CD1 1
+ATOM 1484 N N . THR A 1 207 ? -21.107 -24.369 -17.448 1.00 17.11 ? 191 THR A N 1
+ATOM 1485 C CA . THR A 1 207 ? -22.426 -23.978 -16.964 1.00 25.59 ? 191 THR A CA 1
+ATOM 1486 C C . THR A 1 207 ? -22.811 -24.744 -15.697 1.00 19.75 ? 191 THR A C 1
+ATOM 1487 O O . THR A 1 207 ? -23.370 -24.168 -14.764 1.00 22.95 ? 191 THR A O 1
+ATOM 1488 C CB . THR A 1 207 ? -23.499 -24.199 -18.051 1.00 30.33 ? 191 THR A CB 1
+ATOM 1489 O OG1 . THR A 1 207 ? -23.196 -23.376 -19.184 1.00 40.55 ? 191 THR A OG1 1
+ATOM 1490 C CG2 . THR A 1 207 ? -24.884 -23.848 -17.532 1.00 34.25 ? 191 THR A CG2 1
+ATOM 1491 N N . LYS A 1 208 ? -22.508 -26.040 -15.658 1.00 18.51 ? 192 LYS A N 1
+ATOM 1492 C CA . LYS A 1 208 ? -22.767 -26.826 -14.455 1.00 20.60 ? 192 LYS A CA 1
+ATOM 1493 C C . LYS A 1 208 ? -21.860 -26.382 -13.313 1.00 16.54 ? 192 LYS A C 1
+ATOM 1494 O O . LYS A 1 208 ? -22.223 -26.501 -12.145 1.00 19.92 ? 192 LYS A O 1
+ATOM 1495 C CB . LYS A 1 208 ? -22.578 -28.324 -14.713 1.00 21.56 ? 192 LYS A CB 1
+ATOM 1496 C CG . LYS A 1 208 ? -23.742 -28.984 -15.433 1.00 29.72 ? 192 LYS A CG 1
+ATOM 1497 C CD . LYS A 1 208 ? -23.464 -29.096 -16.917 1.00 36.43 ? 192 LYS A CD 1
+ATOM 1498 C CE . LYS A 1 208 ? -24.562 -28.462 -17.739 1.00 44.86 ? 192 LYS A CE 1
+ATOM 1499 N NZ . LYS A 1 208 ? -24.362 -28.740 -19.191 1.00 26.37 ? 192 LYS A NZ 1
+ATOM 1500 N N . VAL A 1 209 ? -20.676 -25.883 -13.653 1.00 13.41 ? 193 VAL A N 1
+ATOM 1501 C CA . VAL A 1 209 ? -19.751 -25.395 -12.640 1.00 13.28 ? 193 VAL A CA 1
+ATOM 1502 C C . VAL A 1 209 ? -20.351 -24.185 -11.931 1.00 23.14 ? 193 VAL A C 1
+ATOM 1503 O O . VAL A 1 209 ? -20.286 -24.089 -10.710 1.00 20.49 ? 193 VAL A O 1
+ATOM 1504 C CB . VAL A 1 209 ? -18.380 -25.029 -13.247 1.00 22.78 ? 193 VAL A CB 1
+ATOM 1505 C CG1 . VAL A 1 209 ? -17.564 -24.201 -12.271 1.00 23.43 ? 193 VAL A CG1 1
+ATOM 1506 C CG2 . VAL A 1 209 ? -17.618 -26.295 -13.634 1.00 23.69 ? 193 VAL A CG2 1
+ATOM 1507 N N . PHE A 1 210 ? -20.944 -23.276 -12.701 1.00 12.88 ? 194 PHE A N 1
+ATOM 1508 C CA . PHE A 1 210 ? -21.611 -22.105 -12.137 1.00 22.93 ? 194 PHE A CA 1
+ATOM 1509 C C . PHE A 1 210 ? -22.678 -22.511 -11.125 1.00 23.44 ? 194 PHE A C 1
+ATOM 1510 O O . PHE A 1 210 ? -22.730 -21.978 -10.015 1.00 19.55 ? 194 PHE A O 1
+ATOM 1511 C CB . PHE A 1 210 ? -22.245 -21.254 -13.245 1.00 20.70 ? 194 PHE A CB 1
+ATOM 1512 C CG . PHE A 1 210 ? -23.177 -20.185 -12.734 1.00 22.69 ? 194 PHE A CG 1
+ATOM 1513 C CD1 . PHE A 1 210 ? -22.679 -18.993 -12.233 1.00 26.10 ? 194 PHE A CD1 1
+ATOM 1514 C CD2 . PHE A 1 210 ? -24.551 -20.375 -12.752 1.00 29.57 ? 194 PHE A CD2 1
+ATOM 1515 C CE1 . PHE A 1 210 ? -23.535 -18.010 -11.759 1.00 20.96 ? 194 PHE A CE1 1
+ATOM 1516 C CE2 . PHE A 1 210 ? -25.412 -19.397 -12.279 1.00 45.47 ? 194 PHE A CE2 1
+ATOM 1517 C CZ . PHE A 1 210 ? -24.904 -18.213 -11.782 1.00 28.28 ? 194 PHE A CZ 1
+ATOM 1518 N N . TRP A 1 211 ? -23.523 -23.462 -11.508 1.00 15.92 ? 195 TRP A N 1
+ATOM 1519 C CA . TRP A 1 211 ? -24.613 -23.889 -10.639 1.00 18.71 ? 195 TRP A CA 1
+ATOM 1520 C C . TRP A 1 211 ? -24.093 -24.660 -9.432 1.00 27.14 ? 195 TRP A C 1
+ATOM 1521 O O . TRP A 1 211 ? -24.669 -24.582 -8.347 1.00 17.76 ? 195 TRP A O 1
+ATOM 1522 C CB . TRP A 1 211 ? -25.630 -24.726 -11.420 1.00 21.25 ? 195 TRP A CB 1
+ATOM 1523 C CG . TRP A 1 211 ? -26.498 -23.888 -12.307 1.00 24.20 ? 195 TRP A CG 1
+ATOM 1524 C CD1 . TRP A 1 211 ? -26.415 -23.770 -13.664 1.00 25.62 ? 195 TRP A CD1 1
+ATOM 1525 C CD2 . TRP A 1 211 ? -27.571 -23.033 -11.894 1.00 18.06 ? 195 TRP A CD2 1
+ATOM 1526 N NE1 . TRP A 1 211 ? -27.375 -22.898 -14.122 1.00 30.37 ? 195 TRP A NE1 1
+ATOM 1527 C CE2 . TRP A 1 211 ? -28.096 -22.431 -13.054 1.00 21.10 ? 195 TRP A CE2 1
+ATOM 1528 C CE3 . TRP A 1 211 ? -28.141 -22.720 -10.655 1.00 22.36 ? 195 TRP A CE3 1
+ATOM 1529 C CZ2 . TRP A 1 211 ? -29.164 -21.536 -13.013 1.00 37.79 ? 195 TRP A CZ2 1
+ATOM 1530 C CZ3 . TRP A 1 211 ? -29.200 -21.831 -10.616 1.00 42.10 ? 195 TRP A CZ3 1
+ATOM 1531 C CH2 . TRP A 1 211 ? -29.701 -21.250 -11.788 1.00 33.09 ? 195 TRP A CH2 1
+ATOM 1532 N N . LEU A 1 212 ? -22.999 -25.392 -9.616 1.00 15.25 ? 196 LEU A N 1
+ATOM 1533 C CA . LEU A 1 212 ? -22.347 -26.052 -8.490 1.00 15.37 ? 196 LEU A CA 1
+ATOM 1534 C C . LEU A 1 212 ? -21.880 -25.021 -7.461 1.00 18.45 ? 196 LEU A C 1
+ATOM 1535 O O . LEU A 1 212 ? -22.029 -25.224 -6.256 1.00 19.07 ? 196 LEU A O 1
+ATOM 1536 C CB . LEU A 1 212 ? -21.162 -26.894 -8.961 1.00 17.01 ? 196 LEU A CB 1
+ATOM 1537 C CG . LEU A 1 212 ? -20.295 -27.469 -7.838 1.00 19.45 ? 196 LEU A CG 1
+ATOM 1538 C CD1 . LEU A 1 212 ? -21.092 -28.464 -7.018 1.00 19.08 ? 196 LEU A CD1 1
+ATOM 1539 C CD2 . LEU A 1 212 ? -19.021 -28.106 -8.382 1.00 16.38 ? 196 LEU A CD2 1
+ATOM 1540 N N . MET A 1 213 ? -21.318 -23.916 -7.946 1.00 14.67 ? 197 MET A N 1
+ATOM 1541 C CA . MET A 1 213 ? -20.843 -22.843 -7.071 1.00 21.14 ? 197 MET A CA 1
+ATOM 1542 C C . MET A 1 213 ? -21.995 -22.191 -6.317 1.00 20.06 ? 197 MET A C 1
+ATOM 1543 O O . MET A 1 213 ? -21.894 -21.937 -5.116 1.00 21.78 ? 197 MET A O 1
+ATOM 1544 C CB . MET A 1 213 ? -20.094 -21.774 -7.872 1.00 17.53 ? 197 MET A CB 1
+ATOM 1545 C CG . MET A 1 213 ? -18.850 -22.262 -8.585 1.00 34.04 ? 197 MET A CG 1
+ATOM 1546 S SD . MET A 1 213 ? -18.088 -20.961 -9.575 1.00 31.89 ? 197 MET A SD 1
+ATOM 1547 C CE . MET A 1 213 ? -17.487 -19.867 -8.291 1.00 35.56 ? 197 MET A CE 1
+ATOM 1548 N N . MET A 1 214 ? -23.078 -21.903 -7.034 1.00 29.11 ? 198 MET A N 1
+ATOM 1549 C CA . MET A 1 214 ? -24.254 -21.276 -6.437 1.00 26.40 ? 198 MET A CA 1
+ATOM 1550 C C . MET A 1 214 ? -24.790 -22.116 -5.290 1.00 24.44 ? 198 MET A C 1
+ATOM 1551 O O . MET A 1 214 ? -25.115 -21.596 -4.223 1.00 25.65 ? 198 MET A O 1
+ATOM 1552 C CB . MET A 1 214 ? -25.354 -21.070 -7.483 1.00 23.98 ? 198 MET A CB 1
+ATOM 1553 C CG . MET A 1 214 ? -24.983 -20.145 -8.635 1.00 34.10 ? 198 MET A CG 1
+ATOM 1554 S SD . MET A 1 214 ? -24.605 -18.461 -8.117 1.00 34.07 ? 198 MET A SD 1
+ATOM 1555 C CE . MET A 1 214 ? -22.814 -18.491 -8.108 1.00 33.05 ? 198 MET A CE 1
+ATOM 1556 N N . PHE A 1 215 ? -24.881 -23.420 -5.521 1.00 20.02 ? 199 PHE A N 1
+ATOM 1557 C CA . PHE A 1 215 ? -25.386 -24.340 -4.515 1.00 21.83 ? 199 PHE A CA 1
+ATOM 1558 C C . PHE A 1 215 ? -24.416 -24.431 -3.334 1.00 17.29 ? 199 PHE A C 1
+ATOM 1559 O O . PHE A 1 215 ? -24.781 -24.137 -2.195 1.00 20.08 ? 199 PHE A O 1
+ATOM 1560 C CB . PHE A 1 215 ? -25.632 -25.723 -5.136 1.00 20.10 ? 199 PHE A CB 1
+ATOM 1561 C CG . PHE A 1 215 ? -25.419 -26.869 -4.180 1.00 24.58 ? 199 PHE A CG 1
+ATOM 1562 C CD1 . PHE A 1 215 ? -26.328 -27.125 -3.167 1.00 26.09 ? 199 PHE A CD1 1
+ATOM 1563 C CD2 . PHE A 1 215 ? -24.308 -27.692 -4.303 1.00 28.84 ? 199 PHE A CD2 1
+ATOM 1564 C CE1 . PHE A 1 215 ? -26.127 -28.173 -2.285 1.00 24.60 ? 199 PHE A CE1 1
+ATOM 1565 C CE2 . PHE A 1 215 ? -24.103 -28.745 -3.426 1.00 32.02 ? 199 PHE A CE2 1
+ATOM 1566 C CZ . PHE A 1 215 ? -25.017 -28.982 -2.416 1.00 28.30 ? 199 PHE A CZ 1
+ATOM 1567 N N . ALA A 1 216 ? -23.175 -24.808 -3.620 1.00 15.91 ? 200 ALA A N 1
+ATOM 1568 C CA . ALA A 1 216 ? -22.200 -25.105 -2.573 1.00 18.95 ? 200 ALA A CA 1
+ATOM 1569 C C . ALA A 1 216 ? -21.846 -23.889 -1.714 1.00 21.12 ? 200 ALA A C 1
+ATOM 1570 O O . ALA A 1 216 ? -21.795 -23.986 -0.494 1.00 16.15 ? 200 ALA A O 1
+ATOM 1571 C CB . ALA A 1 216 ? -20.939 -25.697 -3.188 1.00 16.66 ? 200 ALA A CB 1
+ATOM 1572 N N . TRP A 1 217 ? -21.603 -22.745 -2.342 1.00 13.59 ? 201 TRP A N 1
+ATOM 1573 C CA . TRP A 1 217 ? -21.212 -21.561 -1.584 1.00 20.08 ? 201 TRP A CA 1
+ATOM 1574 C C . TRP A 1 217 ? -22.346 -21.050 -0.688 1.00 23.93 ? 201 TRP A C 1
+ATOM 1575 O O . TRP A 1 217 ? -22.095 -20.407 0.328 1.00 13.41 ? 201 TRP A O 1
+ATOM 1576 C CB . TRP A 1 217 ? -20.743 -20.444 -2.523 1.00 13.05 ? 201 TRP A CB 1
+ATOM 1577 C CG . TRP A 1 217 ? -19.459 -20.751 -3.242 1.00 18.57 ? 201 TRP A CG 1
+ATOM 1578 C CD1 . TRP A 1 217 ? -19.063 -21.960 -3.743 1.00 21.79 ? 201 TRP A CD1 1
+ATOM 1579 C CD2 . TRP A 1 217 ? -18.395 -19.835 -3.527 1.00 19.55 ? 201 TRP A CD2 1
+ATOM 1580 N NE1 . TRP A 1 217 ? -17.828 -21.849 -4.331 1.00 18.90 ? 201 TRP A NE1 1
+ATOM 1581 C CE2 . TRP A 1 217 ? -17.394 -20.555 -4.209 1.00 20.40 ? 201 TRP A CE2 1
+ATOM 1582 C CE3 . TRP A 1 217 ? -18.192 -18.475 -3.272 1.00 27.23 ? 201 TRP A CE3 1
+ATOM 1583 C CZ2 . TRP A 1 217 ? -16.207 -19.961 -4.639 1.00 18.52 ? 201 TRP A CZ2 1
+ATOM 1584 C CZ3 . TRP A 1 217 ? -17.014 -17.888 -3.702 1.00 31.82 ? 201 TRP A CZ3 1
+ATOM 1585 C CH2 . TRP A 1 217 ? -16.038 -18.631 -4.378 1.00 30.73 ? 201 TRP A CH2 1
+ATOM 1586 N N . THR A 1 218 ? -23.589 -21.349 -1.048 1.00 12.15 ? 202 THR A N 1
+ATOM 1587 C CA . THR A 1 218 ? -24.731 -20.849 -0.279 1.00 21.38 ? 202 THR A CA 1
+ATOM 1588 C C . THR A 1 218 ? -24.903 -21.634 1.027 1.00 22.31 ? 202 THR A C 1
+ATOM 1589 O O . THR A 1 218 ? -25.581 -21.185 1.949 1.00 20.97 ? 202 THR A O 1
+ATOM 1590 C CB . THR A 1 218 ? -26.024 -20.888 -1.128 1.00 15.58 ? 202 THR A CB 1
+ATOM 1591 O OG1 . THR A 1 218 ? -25.839 -20.064 -2.283 1.00 20.99 ? 202 THR A OG1 1
+ATOM 1592 C CG2 . THR A 1 218 ? -27.233 -20.363 -0.352 1.00 18.42 ? 202 THR A CG2 1
+ATOM 1593 N N . LEU A 1 219 ? -24.253 -22.789 1.128 1.00 14.89 ? 203 LEU A N 1
+ATOM 1594 C CA . LEU A 1 219 ? -24.286 -23.552 2.376 1.00 14.57 ? 203 LEU A CA 1
+ATOM 1595 C C . LEU A 1 219 ? -23.593 -22.810 3.518 1.00 15.73 ? 203 LEU A C 1
+ATOM 1596 O O . LEU A 1 219 ? -23.936 -22.995 4.680 1.00 13.49 ? 203 LEU A O 1
+ATOM 1597 C CB . LEU A 1 219 ? -23.641 -24.923 2.186 1.00 16.32 ? 203 LEU A CB 1
+ATOM 1598 C CG . LEU A 1 219 ? -24.347 -25.846 1.193 1.00 21.24 ? 203 LEU A CG 1
+ATOM 1599 C CD1 . LEU A 1 219 ? -23.621 -27.175 1.105 1.00 20.88 ? 203 LEU A CD1 1
+ATOM 1600 C CD2 . LEU A 1 219 ? -25.801 -26.042 1.585 1.00 21.04 ? 203 LEU A CD2 1
+ATOM 1601 N N . TYR A 1 220 ? -22.618 -21.970 3.183 1.00 12.03 ? 204 TYR A N 1
+ATOM 1602 C CA . TYR A 1 220 ? -21.853 -21.263 4.203 1.00 13.25 ? 204 TYR A CA 1
+ATOM 1603 C C . TYR A 1 220 ? -22.675 -20.210 4.955 1.00 13.79 ? 204 TYR A C 1
+ATOM 1604 O O . TYR A 1 220 ? -22.611 -20.159 6.178 1.00 13.00 ? 204 TYR A O 1
+ATOM 1605 C CB . TYR A 1 220 ? -20.597 -20.629 3.589 1.00 11.32 ? 204 TYR A CB 1
+ATOM 1606 C CG . TYR A 1 220 ? -19.581 -21.657 3.145 1.00 19.61 ? 204 TYR A CG 1
+ATOM 1607 C CD1 . TYR A 1 220 ? -18.713 -22.244 4.058 1.00 17.00 ? 204 TYR A CD1 1
+ATOM 1608 C CD2 . TYR A 1 220 ? -19.501 -22.053 1.818 1.00 16.80 ? 204 TYR A CD2 1
+ATOM 1609 C CE1 . TYR A 1 220 ? -17.782 -23.192 3.655 1.00 12.49 ? 204 TYR A CE1 1
+ATOM 1610 C CE2 . TYR A 1 220 ? -18.580 -22.998 1.406 1.00 16.28 ? 204 TYR A CE2 1
+ATOM 1611 C CZ . TYR A 1 220 ? -17.720 -23.563 2.328 1.00 18.54 ? 204 TYR A CZ 1
+ATOM 1612 O OH . TYR A 1 220 ? -16.802 -24.504 1.913 1.00 17.66 ? 204 TYR A OH 1
+ATOM 1613 N N . PRO A 1 221 ? -23.450 -19.370 4.244 1.00 14.23 ? 205 PRO A N 1
+ATOM 1614 C CA . PRO A 1 221 ? -24.294 -18.469 5.041 1.00 17.64 ? 205 PRO A CA 1
+ATOM 1615 C C . PRO A 1 221 ? -25.392 -19.191 5.822 1.00 25.42 ? 205 PRO A C 1
+ATOM 1616 O O . PRO A 1 221 ? -25.884 -18.638 6.803 1.00 17.31 ? 205 PRO A O 1
+ATOM 1617 C CB . PRO A 1 221 ? -24.904 -17.526 3.990 1.00 19.38 ? 205 PRO A CB 1
+ATOM 1618 C CG . PRO A 1 221 ? -24.718 -18.213 2.687 1.00 18.41 ? 205 PRO A CG 1
+ATOM 1619 C CD . PRO A 1 221 ? -23.456 -18.997 2.819 1.00 13.50 ? 205 PRO A CD 1
+ATOM 1620 N N . ILE A 1 222 ? -25.774 -20.393 5.398 1.00 17.33 ? 206 ILE A N 1
+ATOM 1621 C CA . ILE A 1 222 ? -26.749 -21.173 6.155 1.00 24.44 ? 206 ILE A CA 1
+ATOM 1622 C C . ILE A 1 222 ? -26.120 -21.616 7.477 1.00 21.09 ? 206 ILE A C 1
+ATOM 1623 O O . ILE A 1 222 ? -26.745 -21.546 8.537 1.00 19.30 ? 206 ILE A O 1
+ATOM 1624 C CB . ILE A 1 222 ? -27.246 -22.405 5.361 1.00 15.91 ? 206 ILE A CB 1
+ATOM 1625 C CG1 . ILE A 1 222 ? -27.971 -21.964 4.085 1.00 22.94 ? 206 ILE A CG1 1
+ATOM 1626 C CG2 . ILE A 1 222 ? -28.155 -23.273 6.229 1.00 21.02 ? 206 ILE A CG2 1
+ATOM 1627 C CD1 . ILE A 1 222 ? -28.481 -23.118 3.224 1.00 20.20 ? 206 ILE A CD1 1
+ATOM 1628 N N . ALA A 1 223 ? -24.870 -22.058 7.409 1.00 19.89 ? 207 ALA A N 1
+ATOM 1629 C CA . ALA A 1 223 ? -24.130 -22.426 8.609 1.00 14.69 ? 207 ALA A CA 1
+ATOM 1630 C C . ALA A 1 223 ? -23.955 -21.213 9.523 1.00 12.93 ? 207 ALA A C 1
+ATOM 1631 O O . ALA A 1 223 ? -23.994 -21.329 10.745 1.00 17.92 ? 207 ALA A O 1
+ATOM 1632 C CB . ALA A 1 223 ? -22.777 -23.015 8.238 1.00 17.69 ? 207 ALA A CB 1
+ATOM 1633 N N . TYR A 1 224 ? -23.770 -20.050 8.909 1.00 13.81 ? 208 TYR A N 1
+ATOM 1634 C CA . TYR A 1 224 ? -23.575 -18.792 9.628 1.00 19.90 ? 208 TYR A CA 1
+ATOM 1635 C C . TYR A 1 224 ? -24.800 -18.436 10.472 1.00 18.24 ? 208 TYR A C 1
+ATOM 1636 O O . TYR A 1 224 ? -24.680 -17.859 11.553 1.00 14.43 ? 208 TYR A O 1
+ATOM 1637 C CB . TYR A 1 224 ? -23.258 -17.683 8.614 1.00 14.25 ? 208 TYR A CB 1
+ATOM 1638 C CG . TYR A 1 224 ? -23.183 -16.262 9.141 1.00 15.76 ? 208 TYR A CG 1
+ATOM 1639 C CD1 . TYR A 1 224 ? -24.321 -15.465 9.216 1.00 17.57 ? 208 TYR A CD1 1
+ATOM 1640 C CD2 . TYR A 1 224 ? -21.967 -15.695 9.492 1.00 15.62 ? 208 TYR A CD2 1
+ATOM 1641 C CE1 . TYR A 1 224 ? -24.256 -14.159 9.669 1.00 13.18 ? 208 TYR A CE1 1
+ATOM 1642 C CE2 . TYR A 1 224 ? -21.891 -14.386 9.945 1.00 15.42 ? 208 TYR A CE2 1
+ATOM 1643 C CZ . TYR A 1 224 ? -23.038 -13.625 10.030 1.00 18.14 ? 208 TYR A CZ 1
+ATOM 1644 O OH . TYR A 1 224 ? -22.967 -12.322 10.480 1.00 20.71 ? 208 TYR A OH 1
+ATOM 1645 N N . LEU A 1 225 ? -25.978 -18.797 9.976 1.00 18.71 ? 209 LEU A N 1
+ATOM 1646 C CA . LEU A 1 225 ? -27.229 -18.447 10.641 1.00 14.98 ? 209 LEU A CA 1
+ATOM 1647 C C . LEU A 1 225 ? -27.675 -19.482 11.664 1.00 19.32 ? 209 LEU A C 1
+ATOM 1648 O O . LEU A 1 225 ? -28.664 -19.268 12.364 1.00 23.84 ? 209 LEU A O 1
+ATOM 1649 C CB . LEU A 1 225 ? -28.340 -18.247 9.606 1.00 13.96 ? 209 LEU A CB 1
+ATOM 1650 C CG . LEU A 1 225 ? -28.233 -16.947 8.810 1.00 31.09 ? 209 LEU A CG 1
+ATOM 1651 C CD1 . LEU A 1 225 ? -29.254 -16.905 7.683 1.00 26.28 ? 209 LEU A CD1 1
+ATOM 1652 C CD2 . LEU A 1 225 ? -28.403 -15.757 9.745 1.00 27.57 ? 209 LEU A CD2 1
+ATOM 1653 N N . VAL A 1 226 ? -26.959 -20.602 11.745 1.00 20.62 ? 210 VAL A N 1
+ATOM 1654 C CA . VAL A 1 226 ? -27.308 -21.664 12.693 1.00 26.53 ? 210 VAL A CA 1
+ATOM 1655 C C . VAL A 1 226 ? -27.495 -21.168 14.142 1.00 17.60 ? 210 VAL A C 1
+ATOM 1656 O O . VAL A 1 226 ? -28.448 -21.584 14.809 1.00 21.47 ? 210 VAL A O 1
+ATOM 1657 C CB . VAL A 1 226 ? -26.264 -22.805 12.659 1.00 30.45 ? 210 VAL A CB 1
+ATOM 1658 C CG1 . VAL A 1 226 ? -26.378 -23.692 13.894 1.00 22.56 ? 210 VAL A CG1 1
+ATOM 1659 C CG2 . VAL A 1 226 ? -26.439 -23.632 11.390 1.00 19.84 ? 210 VAL A CG2 1
+ATOM 1660 N N . PRO A 1 227 ? -26.623 -20.260 14.632 1.00 18.25 ? 211 PRO A N 1
+ATOM 1661 C CA . PRO A 1 227 ? -26.904 -19.756 15.984 1.00 20.27 ? 211 PRO A CA 1
+ATOM 1662 C C . PRO A 1 227 ? -28.245 -19.037 16.121 1.00 28.28 ? 211 PRO A C 1
+ATOM 1663 O O . PRO A 1 227 ? -28.703 -18.837 17.245 1.00 22.63 ? 211 PRO A O 1
+ATOM 1664 C CB . PRO A 1 227 ? -25.752 -18.777 16.236 1.00 25.63 ? 211 PRO A CB 1
+ATOM 1665 C CG . PRO A 1 227 ? -24.640 -19.291 15.402 1.00 19.66 ? 211 PRO A CG 1
+ATOM 1666 C CD . PRO A 1 227 ? -25.302 -19.807 14.154 1.00 18.70 ? 211 PRO A CD 1
+ATOM 1667 N N . ALA A 1 228 ? -28.865 -18.662 15.006 1.00 34.44 ? 212 ALA A N 1
+ATOM 1668 C CA . ALA A 1 228 ? -30.127 -17.934 15.057 1.00 28.98 ? 212 ALA A CA 1
+ATOM 1669 C C . ALA A 1 228 ? -31.345 -18.860 15.055 1.00 34.33 ? 212 ALA A C 1
+ATOM 1670 O O . ALA A 1 228 ? -32.380 -18.511 15.614 1.00 31.91 ? 212 ALA A O 1
+ATOM 1671 C CB . ALA A 1 228 ? -30.216 -16.945 13.900 1.00 20.64 ? 212 ALA A CB 1
+ATOM 1672 N N . PHE A 1 229 ? -31.238 -20.035 14.438 1.00 21.37 ? 213 PHE A N 1
+ATOM 1673 C CA . PHE A 1 229 ? -32.401 -20.917 14.367 1.00 26.47 ? 213 PHE A CA 1
+ATOM 1674 C C . PHE A 1 229 ? -32.203 -22.258 15.069 1.00 31.65 ? 213 PHE A C 1
+ATOM 1675 O O . PHE A 1 229 ? -33.149 -23.030 15.207 1.00 29.65 ? 213 PHE A O 1
+ATOM 1676 C CB . PHE A 1 229 ? -32.827 -21.145 12.906 1.00 26.76 ? 213 PHE A CB 1
+ATOM 1677 C CG . PHE A 1 229 ? -31.799 -21.846 12.044 1.00 21.87 ? 213 PHE A CG 1
+ATOM 1678 C CD1 . PHE A 1 229 ? -31.711 -23.230 12.022 1.00 27.96 ? 213 PHE A CD1 1
+ATOM 1679 C CD2 . PHE A 1 229 ? -30.967 -21.118 11.207 1.00 18.14 ? 213 PHE A CD2 1
+ATOM 1680 C CE1 . PHE A 1 229 ? -30.787 -23.871 11.211 1.00 27.59 ? 213 PHE A CE1 1
+ATOM 1681 C CE2 . PHE A 1 229 ? -30.040 -21.754 10.393 1.00 25.38 ? 213 PHE A CE2 1
+ATOM 1682 C CZ . PHE A 1 229 ? -29.951 -23.129 10.395 1.00 23.67 ? 213 PHE A CZ 1
+ATOM 1683 N N . MET A 1 230 ? -30.985 -22.534 15.520 1.00 26.10 ? 214 MET A N 1
+ATOM 1684 C CA . MET A 1 230 ? -30.736 -23.752 16.282 1.00 17.57 ? 214 MET A CA 1
+ATOM 1685 C C . MET A 1 230 ? -29.563 -23.571 17.231 1.00 24.82 ? 214 MET A C 1
+ATOM 1686 O O . MET A 1 230 ? -28.477 -24.109 17.008 1.00 26.10 ? 214 MET A O 1
+ATOM 1687 C CB . MET A 1 230 ? -30.480 -24.937 15.350 1.00 20.85 ? 214 MET A CB 1
+ATOM 1688 C CG . MET A 1 230 ? -30.588 -26.283 16.049 1.00 34.19 ? 214 MET A CG 1
+ATOM 1689 S SD . MET A 1 230 ? -30.429 -27.671 14.918 1.00 37.20 ? 214 MET A SD 1
+ATOM 1690 C CE . MET A 1 230 ? -31.784 -27.327 13.799 1.00 30.74 ? 214 MET A CE 1
+ATOM 1691 N N . ASN A 1 231 ? -29.795 -22.804 18.291 1.00 21.73 ? 215 ASN A N 1
+ATOM 1692 C CA . ASN A 1 231 ? -28.765 -22.514 19.272 1.00 19.41 ? 215 ASN A CA 1
+ATOM 1693 C C . ASN A 1 231 ? -28.679 -23.598 20.336 1.00 26.47 ? 215 ASN A C 1
+ATOM 1694 O O . ASN A 1 231 ? -29.093 -23.398 21.474 1.00 29.09 ? 215 ASN A O 1
+ATOM 1695 C CB . ASN A 1 231 ? -29.019 -21.156 19.930 1.00 29.51 ? 215 ASN A CB 1
+ATOM 1696 C CG . ASN A 1 231 ? -27.834 -20.674 20.742 1.00 39.28 ? 215 ASN A CG 1
+ATOM 1697 O OD1 . ASN A 1 231 ? -26.730 -21.204 20.620 1.00 35.05 ? 215 ASN A OD1 1
+ATOM 1698 N ND2 . ASN A 1 231 ? -28.054 -19.663 21.570 1.00 48.13 ? 215 ASN A ND2 1
+ATOM 1699 N N . ASN A 1 232 ? -28.145 -24.750 19.952 1.00 18.17 ? 216 ASN A N 1
+ATOM 1700 C CA . ASN A 1 232 ? -27.929 -25.847 20.885 1.00 26.02 ? 216 ASN A CA 1
+ATOM 1701 C C . ASN A 1 232 ? -26.809 -26.743 20.367 1.00 17.03 ? 216 ASN A C 1
+ATOM 1702 O O . ASN A 1 232 ? -26.265 -26.495 19.292 1.00 20.85 ? 216 ASN A O 1
+ATOM 1703 C CB . ASN A 1 232 ? -29.224 -26.638 21.106 1.00 21.61 ? 216 ASN A CB 1
+ATOM 1704 C CG . ASN A 1 232 ? -29.879 -27.073 19.805 1.00 29.97 ? 216 ASN A CG 1
+ATOM 1705 O OD1 . ASN A 1 232 ? -29.249 -27.703 18.957 1.00 27.47 ? 216 ASN A OD1 1
+ATOM 1706 N ND2 . ASN A 1 232 ? -31.152 -26.731 19.643 1.00 28.70 ? 216 ASN A ND2 1
+ATOM 1707 N N . ALA A 1 233 ? -26.457 -27.770 21.133 1.00 19.01 ? 217 ALA A N 1
+ATOM 1708 C CA . ALA A 1 233 ? -25.355 -28.652 20.763 1.00 21.16 ? 217 ALA A CA 1
+ATOM 1709 C C . ALA A 1 233 ? -25.603 -29.334 19.417 1.00 22.98 ? 217 ALA A C 1
+ATOM 1710 O O . ALA A 1 233 ? -24.673 -29.539 18.639 1.00 17.92 ? 217 ALA A O 1
+ATOM 1711 C CB . ALA A 1 233 ? -25.120 -29.690 21.852 1.00 21.60 ? 217 ALA A CB 1
+ATOM 1712 N N . ASP A 1 234 ? -26.858 -29.682 19.141 1.00 19.21 ? 218 ASP A N 1
+ATOM 1713 C CA . ASP A 1 234 ? -27.199 -30.308 17.866 1.00 14.41 ? 218 ASP A CA 1
+ATOM 1714 C C . ASP A 1 234 ? -27.004 -29.331 16.702 1.00 12.57 ? 218 ASP A C 1
+ATOM 1715 O O . ASP A 1 234 ? -26.629 -29.732 15.603 1.00 16.50 ? 218 ASP A O 1
+ATOM 1716 C CB . ASP A 1 234 ? -28.636 -30.833 17.894 1.00 28.47 ? 218 ASP A CB 1
+ATOM 1717 C CG . ASP A 1 234 ? -28.805 -32.030 18.820 1.00 25.64 ? 218 ASP A CG 1
+ATOM 1718 O OD1 . ASP A 1 234 ? -27.958 -32.951 18.782 1.00 25.14 ? 218 ASP A OD1 1
+ATOM 1719 O OD2 . ASP A 1 234 ? -29.782 -32.043 19.592 1.00 45.13 ? 218 ASP A OD2 1
+ATOM 1720 N N . GLY A 1 235 ? -27.251 -28.049 16.950 1.00 16.01 ? 219 GLY A N 1
+ATOM 1721 C CA . GLY A 1 235 ? -26.970 -27.017 15.969 1.00 12.05 ? 219 GLY A CA 1
+ATOM 1722 C C . GLY A 1 235 ? -25.481 -26.908 15.672 1.00 21.36 ? 219 GLY A C 1
+ATOM 1723 O O . GLY A 1 235 ? -25.082 -26.664 14.533 1.00 19.57 ? 219 GLY A O 1
+ATOM 1724 N N . VAL A 1 236 ? -24.656 -27.091 16.697 1.00 16.95 ? 220 VAL A N 1
+ATOM 1725 C CA . VAL A 1 236 ? -23.205 -27.111 16.521 1.00 14.88 ? 220 VAL A CA 1
+ATOM 1726 C C . VAL A 1 236 ? -22.789 -28.261 15.604 1.00 20.02 ? 220 VAL A C 1
+ATOM 1727 O O . VAL A 1 236 ? -21.933 -28.095 14.740 1.00 16.68 ? 220 VAL A O 1
+ATOM 1728 C CB . VAL A 1 236 ? -22.467 -27.232 17.876 1.00 21.32 ? 220 VAL A CB 1
+ATOM 1729 C CG1 . VAL A 1 236 ? -20.996 -27.570 17.665 1.00 15.53 ? 220 VAL A CG1 1
+ATOM 1730 C CG2 . VAL A 1 236 ? -22.611 -25.944 18.675 1.00 23.16 ? 220 VAL A CG2 1
+ATOM 1731 N N . VAL A 1 237 ? -23.404 -29.424 15.790 1.00 13.05 ? 221 VAL A N 1
+ATOM 1732 C CA . VAL A 1 237 ? -23.142 -30.564 14.918 1.00 17.83 ? 221 VAL A CA 1
+ATOM 1733 C C . VAL A 1 237 ? -23.592 -30.258 13.490 1.00 25.27 ? 221 VAL A C 1
+ATOM 1734 O O . VAL A 1 237 ? -22.887 -30.566 12.531 1.00 16.34 ? 221 VAL A O 1
+ATOM 1735 C CB . VAL A 1 237 ? -23.848 -31.841 15.417 1.00 22.48 ? 221 VAL A CB 1
+ATOM 1736 C CG1 . VAL A 1 237 ? -23.684 -32.972 14.415 1.00 11.57 ? 221 VAL A CG1 1
+ATOM 1737 C CG2 . VAL A 1 237 ? -23.305 -32.254 16.780 1.00 14.87 ? 221 VAL A CG2 1
+ATOM 1738 N N . LEU A 1 238 ? -24.764 -29.643 13.354 1.00 17.94 ? 222 LEU A N 1
+ATOM 1739 C CA . LEU A 1 238 ? -25.303 -29.306 12.038 1.00 16.45 ? 222 LEU A CA 1
+ATOM 1740 C C . LEU A 1 238 ? -24.377 -28.370 11.260 1.00 17.77 ? 222 LEU A C 1
+ATOM 1741 O O . LEU A 1 238 ? -24.175 -28.543 10.061 1.00 18.27 ? 222 LEU A O 1
+ATOM 1742 C CB . LEU A 1 238 ? -26.691 -28.671 12.175 1.00 22.49 ? 222 LEU A CB 1
+ATOM 1743 C CG . LEU A 1 238 ? -27.337 -28.116 10.902 1.00 17.85 ? 222 LEU A CG 1
+ATOM 1744 C CD1 . LEU A 1 238 ? -27.479 -29.203 9.849 1.00 10.06 ? 222 LEU A CD1 1
+ATOM 1745 C CD2 . LEU A 1 238 ? -28.690 -27.481 11.209 1.00 15.29 ? 222 LEU A CD2 1
+ATOM 1746 N N . ARG A 1 239 ? -23.814 -27.380 11.943 1.00 14.16 ? 223 ARG A N 1
+ATOM 1747 C CA . ARG A 1 239 ? -22.919 -26.437 11.286 1.00 19.50 ? 223 ARG A CA 1
+ATOM 1748 C C . ARG A 1 239 ? -21.658 -27.115 10.752 1.00 14.78 ? 223 ARG A C 1
+ATOM 1749 O O . ARG A 1 239 ? -21.220 -26.834 9.637 1.00 17.62 ? 223 ARG A O 1
+ATOM 1750 C CB . ARG A 1 239 ? -22.536 -25.306 12.235 1.00 19.18 ? 223 ARG A CB 1
+ATOM 1751 C CG . ARG A 1 239 ? -21.509 -24.365 11.636 1.00 36.69 ? 223 ARG A CG 1
+ATOM 1752 C CD . ARG A 1 239 ? -21.694 -22.950 12.130 1.00 22.98 ? 223 ARG A CD 1
+ATOM 1753 N NE . ARG A 1 239 ? -21.252 -22.781 13.505 1.00 22.28 ? 223 ARG A NE 1
+ATOM 1754 C CZ . ARG A 1 239 ? -21.324 -21.632 14.167 1.00 28.52 ? 223 ARG A CZ 1
+ATOM 1755 N NH1 . ARG A 1 239 ? -20.895 -21.559 15.417 1.00 26.06 ? 223 ARG A NH1 1
+ATOM 1756 N NH2 . ARG A 1 239 ? -21.829 -20.556 13.577 1.00 26.54 ? 223 ARG A NH2 1
+ATOM 1757 N N . GLN A 1 240 ? -21.076 -28.014 11.540 1.00 16.36 ? 224 GLN A N 1
+ATOM 1758 C CA . GLN A 1 240 ? -19.887 -28.733 11.089 1.00 17.25 ? 224 GLN A CA 1
+ATOM 1759 C C . GLN A 1 240 ? -20.233 -29.641 9.917 1.00 18.17 ? 224 GLN A C 1
+ATOM 1760 O O . GLN A 1 240 ? -19.441 -29.803 8.993 1.00 13.47 ? 224 GLN A O 1
+ATOM 1761 C CB . GLN A 1 240 ? -19.266 -29.544 12.232 1.00 15.18 ? 224 GLN A CB 1
+ATOM 1762 C CG . GLN A 1 240 ? -18.694 -28.683 13.350 1.00 18.50 ? 224 GLN A CG 1
+ATOM 1763 C CD . GLN A 1 240 ? -17.701 -27.646 12.841 1.00 36.00 ? 224 GLN A CD 1
+ATOM 1764 O OE1 . GLN A 1 240 ? -16.754 -27.970 12.120 1.00 27.02 ? 224 GLN A OE1 1
+ATOM 1765 N NE2 . GLN A 1 240 ? -17.923 -26.388 13.207 1.00 23.11 ? 224 GLN A NE2 1
+ATOM 1766 N N . LEU A 1 241 ? -21.429 -30.217 9.950 1.00 15.53 ? 225 LEU A N 1
+ATOM 1767 C CA . LEU A 1 241 ? -21.890 -31.077 8.869 1.00 14.34 ? 225 LEU A CA 1
+ATOM 1768 C C . LEU A 1 241 ? -22.064 -30.279 7.572 1.00 17.75 ? 225 LEU A C 1
+ATOM 1769 O O . LEU A 1 241 ? -21.684 -30.733 6.491 1.00 17.65 ? 225 LEU A O 1
+ATOM 1770 C CB . LEU A 1 241 ? -23.199 -31.755 9.264 1.00 19.01 ? 225 LEU A CB 1
+ATOM 1771 C CG . LEU A 1 241 ? -23.702 -32.844 8.323 1.00 27.99 ? 225 LEU A CG 1
+ATOM 1772 C CD1 . LEU A 1 241 ? -22.762 -34.037 8.350 1.00 22.79 ? 225 LEU A CD1 1
+ATOM 1773 C CD2 . LEU A 1 241 ? -25.108 -33.252 8.713 1.00 35.90 ? 225 LEU A CD2 1
+ATOM 1774 N N . LEU A 1 242 ? -22.627 -29.081 7.693 1.00 13.47 ? 226 LEU A N 1
+ATOM 1775 C CA . LEU A 1 242 ? -22.807 -28.189 6.550 1.00 16.37 ? 226 LEU A CA 1
+ATOM 1776 C C . LEU A 1 242 ? -21.460 -27.773 5.949 1.00 13.87 ? 226 LEU A C 1
+ATOM 1777 O O . LEU A 1 242 ? -21.280 -27.817 4.736 1.00 16.75 ? 226 LEU A O 1
+ATOM 1778 C CB . LEU A 1 242 ? -23.606 -26.947 6.957 1.00 12.37 ? 226 LEU A CB 1
+ATOM 1779 C CG . LEU A 1 242 ? -25.085 -27.135 7.293 1.00 15.68 ? 226 LEU A CG 1
+ATOM 1780 C CD1 . LEU A 1 242 ? -25.689 -25.827 7.802 1.00 16.48 ? 226 LEU A CD1 1
+ATOM 1781 C CD2 . LEU A 1 242 ? -25.845 -27.648 6.083 1.00 21.85 ? 226 LEU A CD2 1
+ATOM 1782 N N . PHE A 1 243 ? -20.526 -27.366 6.805 1.00 12.51 ? 227 PHE A N 1
+ATOM 1783 C CA . PHE A 1 243 ? -19.164 -27.037 6.375 1.00 16.51 ? 227 PHE A CA 1
+ATOM 1784 C C . PHE A 1 243 ? -18.520 -28.182 5.589 1.00 16.02 ? 227 PHE A C 1
+ATOM 1785 O O . PHE A 1 243 ? -17.853 -27.961 4.584 1.00 15.51 ? 227 PHE A O 1
+ATOM 1786 C CB . PHE A 1 243 ? -18.286 -26.696 7.584 1.00 13.95 ? 227 PHE A CB 1
+ATOM 1787 C CG . PHE A 1 243 ? -18.458 -25.294 8.097 1.00 27.93 ? 227 PHE A CG 1
+ATOM 1788 C CD1 . PHE A 1 243 ? -18.864 -24.273 7.255 1.00 24.73 ? 227 PHE A CD1 1
+ATOM 1789 C CD2 . PHE A 1 243 ? -18.199 -24.997 9.429 1.00 25.84 ? 227 PHE A CD2 1
+ATOM 1790 C CE1 . PHE A 1 243 ? -19.015 -22.982 7.728 1.00 25.00 ? 227 PHE A CE1 1
+ATOM 1791 C CE2 . PHE A 1 243 ? -18.348 -23.710 9.911 1.00 17.77 ? 227 PHE A CE2 1
+ATOM 1792 C CZ . PHE A 1 243 ? -18.757 -22.699 9.057 1.00 27.29 ? 227 PHE A CZ 1
+ATOM 1793 N N . THR A 1 244 ? -18.722 -29.406 6.065 1.00 14.68 ? 228 THR A N 1
+ATOM 1794 C CA . THR A 1 244 ? -18.151 -30.591 5.437 1.00 19.88 ? 228 THR A CA 1
+ATOM 1795 C C . THR A 1 244 ? -18.708 -30.820 4.036 1.00 24.55 ? 228 THR A C 1
+ATOM 1796 O O . THR A 1 244 ? -17.952 -31.034 3.088 1.00 23.53 ? 228 THR A O 1
+ATOM 1797 C CB . THR A 1 244 ? -18.407 -31.844 6.290 1.00 15.67 ? 228 THR A CB 1
+ATOM 1798 O OG1 . THR A 1 244 ? -17.887 -31.632 7.606 1.00 23.92 ? 228 THR A OG1 1
+ATOM 1799 C CG2 . THR A 1 244 ? -17.735 -33.064 5.672 1.00 24.53 ? 228 THR A CG2 1
+ATOM 1800 N N . ILE A 1 245 ? -20.031 -30.783 3.915 1.00 21.70 ? 229 ILE A N 1
+ATOM 1801 C CA . ILE A 1 245 ? -20.684 -30.871 2.614 1.00 23.37 ? 229 ILE A CA 1
+ATOM 1802 C C . ILE A 1 245 ? -20.192 -29.759 1.694 1.00 15.09 ? 229 ILE A C 1
+ATOM 1803 O O . ILE A 1 245 ? -19.847 -30.001 0.536 1.00 18.22 ? 229 ILE A O 1
+ATOM 1804 C CB . ILE A 1 245 ? -22.217 -30.775 2.739 1.00 20.26 ? 229 ILE A CB 1
+ATOM 1805 C CG1 . ILE A 1 245 ? -22.752 -31.899 3.629 1.00 24.62 ? 229 ILE A CG1 1
+ATOM 1806 C CG2 . ILE A 1 245 ? -22.872 -30.817 1.363 1.00 21.37 ? 229 ILE A CG2 1
+ATOM 1807 C CD1 . ILE A 1 245 ? -24.219 -31.753 3.972 1.00 22.51 ? 229 ILE A CD1 1
+ATOM 1808 N N . ALA A 1 246 ? -20.156 -28.541 2.227 1.00 13.76 ? 230 ALA A N 1
+ATOM 1809 C CA . ALA A 1 246 ? -19.774 -27.364 1.455 1.00 14.84 ? 230 ALA A CA 1
+ATOM 1810 C C . ALA A 1 246 ? -18.309 -27.398 1.036 1.00 21.50 ? 230 ALA A C 1
+ATOM 1811 O O . ALA A 1 246 ? -17.991 -27.083 -0.107 1.00 15.55 ? 230 ALA A O 1
+ATOM 1812 C CB . ALA A 1 246 ? -20.059 -26.096 2.248 1.00 11.07 ? 230 ALA A CB 1
+ATOM 1813 N N . ASP A 1 247 ? -17.420 -27.768 1.957 1.00 15.02 ? 231 ASP A N 1
+ATOM 1814 C CA . ASP A 1 247 ? -15.987 -27.809 1.648 1.00 20.56 ? 231 ASP A CA 1
+ATOM 1815 C C . ASP A 1 247 ? -15.696 -28.812 0.538 1.00 26.43 ? 231 ASP A C 1
+ATOM 1816 O O . ASP A 1 247 ? -14.987 -28.507 -0.418 1.00 22.92 ? 231 ASP A O 1
+ATOM 1817 C CB . ASP A 1 247 ? -15.158 -28.168 2.883 1.00 15.28 ? 231 ASP A CB 1
+ATOM 1818 C CG . ASP A 1 247 ? -15.094 -27.045 3.908 1.00 37.87 ? 231 ASP A CG 1
+ATOM 1819 O OD1 . ASP A 1 247 ? -15.225 -25.858 3.534 1.00 24.13 ? 231 ASP A OD1 1
+ATOM 1820 O OD2 . ASP A 1 247 ? -14.905 -27.362 5.101 1.00 27.80 ? 231 ASP A OD2 1
+ATOM 1821 N N . ILE A 1 248 ? -16.243 -30.014 0.676 1.00 10.93 ? 232 ILE A N 1
+ATOM 1822 C CA . ILE A 1 248 ? -16.048 -31.057 -0.323 1.00 13.63 ? 232 ILE A CA 1
+ATOM 1823 C C . ILE A 1 248 ? -16.616 -30.640 -1.684 1.00 27.05 ? 232 ILE A C 1
+ATOM 1824 O O . ILE A 1 248 ? -15.987 -30.859 -2.716 1.00 18.20 ? 232 ILE A O 1
+ATOM 1825 C CB . ILE A 1 248 ? -16.691 -32.384 0.127 1.00 19.13 ? 232 ILE A CB 1
+ATOM 1826 C CG1 . ILE A 1 248 ? -15.950 -32.938 1.346 1.00 23.09 ? 232 ILE A CG1 1
+ATOM 1827 C CG2 . ILE A 1 248 ? -16.678 -33.402 -1.006 1.00 22.56 ? 232 ILE A CG2 1
+ATOM 1828 C CD1 . ILE A 1 248 ? -16.528 -34.223 1.883 1.00 26.64 ? 232 ILE A CD1 1
+ATOM 1829 N N . SER A 1 249 ? -17.792 -30.017 -1.683 1.00 14.85 ? 233 SER A N 1
+ATOM 1830 C CA . SER A 1 249 ? -18.431 -29.605 -2.934 1.00 15.74 ? 233 SER A CA 1
+ATOM 1831 C C . SER A 1 249 ? -17.732 -28.413 -3.590 1.00 18.24 ? 233 SER A C 1
+ATOM 1832 O O . SER A 1 249 ? -17.524 -28.404 -4.802 1.00 15.91 ? 233 SER A O 1
+ATOM 1833 C CB . SER A 1 249 ? -19.904 -29.272 -2.694 1.00 12.98 ? 233 SER A CB 1
+ATOM 1834 O OG . SER A 1 249 ? -20.602 -30.412 -2.224 1.00 22.68 ? 233 SER A OG 1
+ATOM 1835 N N . SER A 1 250 ? -17.352 -27.424 -2.784 1.00 12.85 ? 234 SER A N 1
+ATOM 1836 C CA . SER A 1 250 ? -16.822 -26.164 -3.300 1.00 16.75 ? 234 SER A CA 1
+ATOM 1837 C C . SER A 1 250 ? -15.340 -26.222 -3.648 1.00 18.25 ? 234 SER A C 1
+ATOM 1838 O O . SER A 1 250 ? -14.840 -25.393 -4.416 1.00 16.70 ? 234 SER A O 1
+ATOM 1839 C CB . SER A 1 250 ? -17.053 -25.038 -2.287 1.00 14.40 ? 234 SER A CB 1
+ATOM 1840 O OG . SER A 1 250 ? -16.216 -25.195 -1.157 1.00 22.10 ? 234 SER A OG 1
+ATOM 1841 N N . LYS A 1 251 ? -14.631 -27.188 -3.078 1.00 11.92 ? 235 LYS A N 1
+ATOM 1842 C CA . LYS A 1 251 ? -13.197 -27.283 -3.315 1.00 16.82 ? 235 LYS A CA 1
+ATOM 1843 C C . LYS A 1 251 ? -12.836 -28.541 -4.096 1.00 16.75 ? 235 LYS A C 1
+ATOM 1844 O O . LYS A 1 251 ? -12.134 -28.467 -5.100 1.00 20.89 ? 235 LYS A O 1
+ATOM 1845 C CB . LYS A 1 251 ? -12.430 -27.250 -1.990 1.00 13.77 ? 235 LYS A CB 1
+ATOM 1846 C CG . LYS A 1 251 ? -12.835 -26.096 -1.087 1.00 27.22 ? 235 LYS A CG 1
+ATOM 1847 C CD . LYS A 1 251 ? -12.052 -26.101 0.208 1.00 22.46 ? 235 LYS A CD 1
+ATOM 1848 C CE . LYS A 1 251 ? -12.761 -25.305 1.294 1.00 32.57 ? 235 LYS A CE 1
+ATOM 1849 N NZ . LYS A 1 251 ? -12.986 -23.884 0.930 1.00 27.53 ? 235 LYS A NZ 1
+ATOM 1850 N N . VAL A 1 252 ? -13.319 -29.691 -3.638 1.00 13.09 ? 236 VAL A N 1
+ATOM 1851 C CA . VAL A 1 252 ? -12.930 -30.964 -4.239 1.00 14.71 ? 236 VAL A CA 1
+ATOM 1852 C C . VAL A 1 252 ? -13.688 -31.263 -5.535 1.00 20.84 ? 236 VAL A C 1
+ATOM 1853 O O . VAL A 1 252 ? -13.071 -31.439 -6.577 1.00 15.12 ? 236 VAL A O 1
+ATOM 1854 C CB . VAL A 1 252 ? -13.133 -32.139 -3.257 1.00 17.36 ? 236 VAL A CB 1
+ATOM 1855 C CG1 . VAL A 1 252 ? -12.683 -33.449 -3.898 1.00 20.52 ? 236 VAL A CG1 1
+ATOM 1856 C CG2 . VAL A 1 252 ? -12.370 -31.889 -1.965 1.00 18.28 ? 236 VAL A CG2 1
+ATOM 1857 N N . ILE A 1 253 ? -15.015 -31.330 -5.472 1.00 15.01 ? 237 ILE A N 1
+ATOM 1858 C CA . ILE A 1 253 ? -15.811 -31.608 -6.669 1.00 19.32 ? 237 ILE A CA 1
+ATOM 1859 C C . ILE A 1 253 ? -15.613 -30.504 -7.705 1.00 12.57 ? 237 ILE A C 1
+ATOM 1860 O O . ILE A 1 253 ? -15.434 -30.770 -8.892 1.00 16.46 ? 237 ILE A O 1
+ATOM 1861 C CB . ILE A 1 253 ? -17.312 -31.745 -6.343 1.00 17.91 ? 237 ILE A CB 1
+ATOM 1862 C CG1 . ILE A 1 253 ? -17.534 -32.879 -5.338 1.00 19.86 ? 237 ILE A CG1 1
+ATOM 1863 C CG2 . ILE A 1 253 ? -18.112 -31.986 -7.618 1.00 15.64 ? 237 ILE A CG2 1
+ATOM 1864 C CD1 . ILE A 1 253 ? -18.992 -33.152 -5.028 1.00 27.45 ? 237 ILE A CD1 1
+ATOM 1865 N N . TYR A 1 254 ? -15.630 -29.262 -7.234 1.00 18.24 ? 238 TYR A N 1
+ATOM 1866 C CA . TYR A 1 254 ? -15.314 -28.101 -8.061 1.00 13.78 ? 238 TYR A CA 1
+ATOM 1867 C C . TYR A 1 254 ? -13.946 -28.222 -8.738 1.00 16.22 ? 238 TYR A C 1
+ATOM 1868 O O . TYR A 1 254 ? -13.830 -28.041 -9.948 1.00 12.92 ? 238 TYR A O 1
+ATOM 1869 C CB . TYR A 1 254 ? -15.366 -26.845 -7.196 1.00 14.70 ? 238 TYR A CB 1
+ATOM 1870 C CG . TYR A 1 254 ? -14.955 -25.549 -7.860 1.00 18.98 ? 238 TYR A CG 1
+ATOM 1871 C CD1 . TYR A 1 254 ? -15.854 -24.828 -8.634 1.00 16.06 ? 238 TYR A CD1 1
+ATOM 1872 C CD2 . TYR A 1 254 ? -13.687 -25.015 -7.660 1.00 15.70 ? 238 TYR A CD2 1
+ATOM 1873 C CE1 . TYR A 1 254 ? -15.496 -23.629 -9.217 1.00 20.58 ? 238 TYR A CE1 1
+ATOM 1874 C CE2 . TYR A 1 254 ? -13.319 -23.817 -8.235 1.00 10.79 ? 238 TYR A CE2 1
+ATOM 1875 C CZ . TYR A 1 254 ? -14.230 -23.126 -9.014 1.00 17.60 ? 238 TYR A CZ 1
+ATOM 1876 O OH . TYR A 1 254 ? -13.875 -21.931 -9.593 1.00 23.41 ? 238 TYR A OH 1
+ATOM 1877 N N . GLY A 1 255 ? -12.919 -28.526 -7.951 1.00 12.40 ? 239 GLY A N 1
+ATOM 1878 C CA . GLY A 1 255 ? -11.571 -28.673 -8.477 1.00 8.58 ? 239 GLY A CA 1
+ATOM 1879 C C . GLY A 1 255 ? -11.489 -29.761 -9.533 1.00 14.79 ? 239 GLY A C 1
+ATOM 1880 O O . GLY A 1 255 ? -10.787 -29.621 -10.532 1.00 13.94 ? 239 GLY A O 1
+ATOM 1881 N N . LEU A 1 256 ? -12.218 -30.849 -9.310 1.00 15.91 ? 240 LEU A N 1
+ATOM 1882 C CA . LEU A 1 256 ? -12.243 -31.956 -10.256 1.00 20.90 ? 240 LEU A CA 1
+ATOM 1883 C C . LEU A 1 256 ? -12.861 -31.534 -11.586 1.00 19.49 ? 240 LEU A C 1
+ATOM 1884 O O . LEU A 1 256 ? -12.427 -31.974 -12.647 1.00 15.90 ? 240 LEU A O 1
+ATOM 1885 C CB . LEU A 1 256 ? -13.007 -33.144 -9.667 1.00 16.38 ? 240 LEU A CB 1
+ATOM 1886 C CG . LEU A 1 256 ? -12.291 -33.909 -8.551 1.00 21.96 ? 240 LEU A CG 1
+ATOM 1887 C CD1 . LEU A 1 256 ? -13.194 -34.975 -7.948 1.00 20.16 ? 240 LEU A CD1 1
+ATOM 1888 C CD2 . LEU A 1 256 ? -11.015 -34.538 -9.088 1.00 23.26 ? 240 LEU A CD2 1
+ATOM 1889 N N . MET A 1 257 ? -13.869 -30.672 -11.529 1.00 10.39 ? 241 MET A N 1
+ATOM 1890 C CA . MET A 1 257 ? -14.520 -30.204 -12.749 1.00 15.28 ? 241 MET A CA 1
+ATOM 1891 C C . MET A 1 257 ? -13.655 -29.197 -13.485 1.00 10.21 ? 241 MET A C 1
+ATOM 1892 O O . MET A 1 257 ? -13.593 -29.212 -14.713 1.00 20.08 ? 241 MET A O 1
+ATOM 1893 C CB . MET A 1 257 ? -15.883 -29.584 -12.439 1.00 16.43 ? 241 MET A CB 1
+ATOM 1894 C CG . MET A 1 257 ? -16.875 -30.561 -11.852 1.00 40.59 ? 241 MET A CG 1
+ATOM 1895 S SD . MET A 1 257 ? -18.536 -29.877 -11.783 1.00 46.24 ? 241 MET A SD 1
+ATOM 1896 C CE . MET A 1 257 ? -18.909 -29.706 -13.526 1.00 28.16 ? 241 MET A CE 1
+ATOM 1897 N N . ILE A 1 258 ? -12.991 -28.321 -12.734 1.00 18.37 ? 242 ILE A N 1
+ATOM 1898 C CA . ILE A 1 258 ? -12.070 -27.351 -13.323 1.00 14.30 ? 242 ILE A CA 1
+ATOM 1899 C C . ILE A 1 258 ? -10.927 -28.074 -14.039 1.00 19.99 ? 242 ILE A C 1
+ATOM 1900 O O . ILE A 1 258 ? -10.552 -27.713 -15.155 1.00 21.37 ? 242 ILE A O 1
+ATOM 1901 C CB . ILE A 1 258 ? -11.477 -26.392 -12.260 1.00 15.55 ? 242 ILE A CB 1
+ATOM 1902 C CG1 . ILE A 1 258 ? -12.568 -25.516 -11.628 1.00 19.59 ? 242 ILE A CG1 1
+ATOM 1903 C CG2 . ILE A 1 258 ? -10.385 -25.527 -12.874 1.00 14.11 ? 242 ILE A CG2 1
+ATOM 1904 C CD1 . ILE A 1 258 ? -13.205 -24.518 -12.584 1.00 17.81 ? 242 ILE A CD1 1
+ATOM 1905 N N . THR A 1 259 ? -10.385 -29.100 -13.388 1.00 20.68 ? 243 THR A N 1
+ATOM 1906 C CA . THR A 1 259 ? -9.291 -29.884 -13.955 1.00 16.87 ? 243 THR A CA 1
+ATOM 1907 C C . THR A 1 259 ? -9.752 -30.644 -15.193 1.00 20.90 ? 243 THR A C 1
+ATOM 1908 O O . THR A 1 259 ? -9.045 -30.690 -16.201 1.00 18.73 ? 243 THR A O 1
+ATOM 1909 C CB . THR A 1 259 ? -8.709 -30.867 -12.919 1.00 21.45 ? 243 THR A CB 1
+ATOM 1910 O OG1 . THR A 1 259 ? -7.962 -30.135 -11.940 1.00 24.88 ? 243 THR A OG1 1
+ATOM 1911 C CG2 . THR A 1 259 ? -7.787 -31.876 -13.582 1.00 21.93 ? 243 THR A CG2 1
+ATOM 1912 N N . TYR A 1 260 ? -10.944 -31.227 -15.123 1.00 17.39 ? 244 TYR A N 1
+ATOM 1913 C CA . TYR A 1 260 ? -11.520 -31.880 -16.290 1.00 15.73 ? 244 TYR A CA 1
+ATOM 1914 C C . TYR A 1 260 ? -11.643 -30.905 -17.464 1.00 20.93 ? 244 TYR A C 1
+ATOM 1915 O O . TYR A 1 260 ? -11.329 -31.245 -18.606 1.00 19.64 ? 244 TYR A O 1
+ATOM 1916 C CB . TYR A 1 260 ? -12.892 -32.475 -15.964 1.00 12.85 ? 244 TYR A CB 1
+ATOM 1917 C CG . TYR A 1 260 ? -13.619 -32.945 -17.203 1.00 26.05 ? 244 TYR A CG 1
+ATOM 1918 C CD1 . TYR A 1 260 ? -13.288 -34.152 -17.807 1.00 34.32 ? 244 TYR A CD1 1
+ATOM 1919 C CD2 . TYR A 1 260 ? -14.619 -32.175 -17.783 1.00 31.19 ? 244 TYR A CD2 1
+ATOM 1920 C CE1 . TYR A 1 260 ? -13.938 -34.583 -18.946 1.00 32.09 ? 244 TYR A CE1 1
+ATOM 1921 C CE2 . TYR A 1 260 ? -15.276 -32.599 -18.924 1.00 46.56 ? 244 TYR A CE2 1
+ATOM 1922 C CZ . TYR A 1 260 ? -14.930 -33.804 -19.500 1.00 62.24 ? 244 TYR A CZ 1
+ATOM 1923 O OH . TYR A 1 260 ? -15.577 -34.235 -20.635 1.00 50.64 ? 244 TYR A OH 1
+ATOM 1924 N N . ILE A 1 261 ? -12.104 -29.692 -17.175 1.00 17.86 ? 245 ILE A N 1
+ATOM 1925 C CA . ILE A 1 261 ? -12.265 -28.665 -18.200 1.00 13.27 ? 245 ILE A CA 1
+ATOM 1926 C C . ILE A 1 261 ? -10.901 -28.234 -18.755 1.00 22.68 ? 245 ILE A C 1
+ATOM 1927 O O . ILE A 1 261 ? -10.758 -27.979 -19.953 1.00 17.49 ? 245 ILE A O 1
+ATOM 1928 C CB . ILE A 1 261 ? -13.036 -27.441 -17.643 1.00 16.82 ? 245 ILE A CB 1
+ATOM 1929 C CG1 . ILE A 1 261 ? -14.510 -27.806 -17.426 1.00 13.77 ? 245 ILE A CG1 1
+ATOM 1930 C CG2 . ILE A 1 261 ? -12.924 -26.246 -18.575 1.00 15.21 ? 245 ILE A CG2 1
+ATOM 1931 C CD1 . ILE A 1 261 ? -15.359 -26.683 -16.852 1.00 16.21 ? 245 ILE A CD1 1
+ATOM 1932 N N . ALA A 1 262 ? -9.897 -28.174 -17.884 1.00 19.72 ? 246 ALA A N 1
+ATOM 1933 C CA . ALA A 1 262 ? -8.546 -27.813 -18.301 1.00 21.75 ? 246 ALA A CA 1
+ATOM 1934 C C . ALA A 1 262 ? -7.966 -28.861 -19.251 1.00 16.85 ? 246 ALA A C 1
+ATOM 1935 O O . ALA A 1 262 ? -7.397 -28.523 -20.289 1.00 17.67 ? 246 ALA A O 1
+ATOM 1936 C CB . ALA A 1 262 ? -7.641 -27.640 -17.086 1.00 12.28 ? 246 ALA A CB 1
+ATOM 1937 N N . ILE A 1 263 ? -8.118 -30.130 -18.886 1.00 13.38 ? 247 ILE A N 1
+ATOM 1938 C CA . ILE A 1 263 ? -7.593 -31.236 -19.686 1.00 19.77 ? 247 ILE A CA 1
+ATOM 1939 C C . ILE A 1 263 ? -8.285 -31.313 -21.041 1.00 23.83 ? 247 ILE A C 1
+ATOM 1940 O O . ILE A 1 263 ? -7.637 -31.458 -22.075 1.00 20.04 ? 247 ILE A O 1
+ATOM 1941 C CB . ILE A 1 263 ? -7.768 -32.592 -18.977 1.00 16.69 ? 247 ILE A CB 1
+ATOM 1942 C CG1 . ILE A 1 263 ? -7.011 -32.624 -17.648 1.00 30.58 ? 247 ILE A CG1 1
+ATOM 1943 C CG2 . ILE A 1 263 ? -7.276 -33.723 -19.872 1.00 26.32 ? 247 ILE A CG2 1
+ATOM 1944 C CD1 . ILE A 1 263 ? -5.565 -32.996 -17.782 1.00 58.22 ? 247 ILE A CD1 1
+ATOM 1945 N N . GLN A 1 264 ? -9.609 -31.220 -21.023 1.00 17.89 ? 248 GLN A N 1
+ATOM 1946 C CA . GLN A 1 264 ? -10.398 -31.313 -22.240 1.00 21.94 ? 248 GLN A CA 1
+ATOM 1947 C C . GLN A 1 264 ? -10.033 -30.191 -23.207 1.00 21.91 ? 248 GLN A C 1
+ATOM 1948 O O . GLN A 1 264 ? -9.899 -30.420 -24.408 1.00 20.75 ? 248 GLN A O 1
+ATOM 1949 C CB . GLN A 1 264 ? -11.894 -31.278 -21.918 1.00 18.94 ? 248 GLN A CB 1
+ATOM 1950 C CG . GLN A 1 264 ? -12.783 -31.611 -23.103 1.00 48.28 ? 248 GLN A CG 1
+ATOM 1951 C CD . GLN A 1 264 ? -12.613 -33.045 -23.566 1.00 30.34 ? 248 GLN A CD 1
+ATOM 1952 O OE1 . GLN A 1 264 ? -12.368 -33.945 -22.760 1.00 44.80 ? 248 GLN A OE1 1
+ATOM 1953 N NE2 . GLN A 1 264 ? -12.740 -33.266 -24.869 1.00 70.25 ? 248 GLN A NE2 1
+ATOM 1954 N N . GLN A 1 265 ? -9.854 -28.981 -22.688 1.00 15.61 ? 249 GLN A N 1
+ATOM 1955 C CA . GLN A 1 265 ? -9.491 -27.860 -23.551 1.00 17.51 ? 249 GLN A CA 1
+ATOM 1956 C C . GLN A 1 265 ? -8.052 -27.978 -24.033 1.00 29.24 ? 249 GLN A C 1
+ATOM 1957 O O . GLN A 1 265 ? -7.723 -27.536 -25.131 1.00 17.04 ? 249 GLN A O 1
+ATOM 1958 C CB . GLN A 1 265 ? -9.690 -26.528 -22.835 1.00 20.18 ? 249 GLN A CB 1
+ATOM 1959 C CG . GLN A 1 265 ? -11.143 -26.106 -22.721 1.00 17.47 ? 249 GLN A CG 1
+ATOM 1960 C CD . GLN A 1 265 ? -11.284 -24.662 -22.315 1.00 24.28 ? 249 GLN A CD 1
+ATOM 1961 O OE1 . GLN A 1 265 ? -11.601 -23.802 -23.139 1.00 24.97 ? 249 GLN A OE1 1
+ATOM 1962 N NE2 . GLN A 1 265 ? -11.036 -24.379 -21.041 1.00 19.36 ? 249 GLN A NE2 1
+ATOM 1963 N N . SER A 1 266 ? -7.196 -28.570 -23.205 1.00 16.33 ? 250 SER A N 1
+ATOM 1964 C CA . SER A 1 266 ? -5.805 -28.802 -23.582 1.00 13.04 ? 250 SER A CA 1
+ATOM 1965 C C . SER A 1 266 ? -5.728 -29.741 -24.779 1.00 20.57 ? 250 SER A C 1
+ATOM 1966 O O . SER A 1 266 ? -5.014 -29.477 -25.746 1.00 18.25 ? 250 SER A O 1
+ATOM 1967 C CB . SER A 1 266 ? -5.016 -29.377 -22.400 1.00 9.09 ? 250 SER A CB 1
+ATOM 1968 O OG . SER A 1 266 ? -4.933 -28.438 -21.336 1.00 17.13 ? 250 SER A OG 1
+ATOM 1969 N N . ALA A 1 267 ? -6.480 -30.835 -24.708 1.00 15.41 ? 251 ALA A N 1
+ATOM 1970 C CA . ALA A 1 267 ? -6.514 -31.812 -25.789 1.00 27.13 ? 251 ALA A CA 1
+ATOM 1971 C C . ALA A 1 267 ? -7.043 -31.180 -27.072 1.00 33.37 ? 251 ALA A C 1
+ATOM 1972 O O . ALA A 1 267 ? -6.495 -31.394 -28.151 1.00 29.37 ? 251 ALA A O 1
+ATOM 1973 C CB . ALA A 1 267 ? -7.365 -33.009 -25.393 1.00 17.52 ? 251 ALA A CB 1
+ATOM 1974 N N . ALA A 1 268 ? -8.101 -30.388 -26.943 1.00 20.38 ? 252 ALA A N 1
+ATOM 1975 C CA . ALA A 1 268 ? -8.709 -29.729 -28.092 1.00 32.01 ? 252 ALA A CA 1
+ATOM 1976 C C . ALA A 1 268 ? -7.770 -28.701 -28.715 1.00 34.42 ? 252 ALA A C 1
+ATOM 1977 O O . ALA A 1 268 ? -7.884 -28.386 -29.897 1.00 29.65 ? 252 ALA A O 1
+ATOM 1978 C CB . ALA A 1 268 ? -10.024 -29.071 -27.690 1.00 24.92 ? 252 ALA A CB 1
+ATOM 1979 N N . ALA A 1 269 ? -6.843 -28.179 -27.919 1.00 24.35 ? 253 ALA A N 1
+ATOM 1980 C CA . ALA A 1 269 ? -5.880 -27.201 -28.416 1.00 24.43 ? 253 ALA A CA 1
+ATOM 1981 C C . ALA A 1 269 ? -4.632 -27.881 -28.981 1.00 24.56 ? 253 ALA A C 1
+ATOM 1982 O O . ALA A 1 269 ? -3.711 -27.213 -29.447 1.00 31.35 ? 253 ALA A O 1
+ATOM 1983 C CB . ALA A 1 269 ? -5.497 -26.226 -27.315 1.00 21.24 ? 253 ALA A CB 1
+ATOM 1984 N N . GLY A 1 270 ? -4.598 -29.208 -28.926 1.00 23.29 ? 254 GLY A N 1
+ATOM 1985 C CA . GLY A 1 270 ? -3.506 -29.958 -29.522 1.00 18.67 ? 254 GLY A CA 1
+ATOM 1986 C C . GLY A 1 270 ? -2.404 -30.387 -28.568 1.00 37.14 ? 254 GLY A C 1
+ATOM 1987 O O . GLY A 1 270 ? -1.354 -30.852 -29.007 1.00 28.48 ? 254 GLY A O 1
+ATOM 1988 N N . TYR A 1 271 ? -2.628 -30.237 -27.267 1.00 28.34 ? 255 TYR A N 1
+ATOM 1989 C CA . TYR A 1 271 ? -1.642 -30.679 -26.284 1.00 22.98 ? 255 TYR A CA 1
+ATOM 1990 C C . TYR A 1 271 ? -1.615 -32.202 -26.244 1.00 17.48 ? 255 TYR A C 1
+ATOM 1991 O O . TYR A 1 271 ? -2.566 -32.841 -25.785 1.00 19.87 ? 255 TYR A O 1
+ATOM 1992 C CB . TYR A 1 271 ? -1.946 -30.104 -24.896 1.00 17.28 ? 255 TYR A CB 1
+ATOM 1993 C CG . TYR A 1 271 ? -0.821 -30.302 -23.901 1.00 20.00 ? 255 TYR A CG 1
+ATOM 1994 C CD1 . TYR A 1 271 ? 0.452 -29.811 -24.158 1.00 19.55 ? 255 TYR A CD1 1
+ATOM 1995 C CD2 . TYR A 1 271 ? -1.034 -30.972 -22.708 1.00 14.06 ? 255 TYR A CD2 1
+ATOM 1996 C CE1 . TYR A 1 271 ? 1.482 -29.992 -23.260 1.00 21.86 ? 255 TYR A CE1 1
+ATOM 1997 C CE2 . TYR A 1 271 ? -0.013 -31.153 -21.797 1.00 16.27 ? 255 TYR A CE2 1
+ATOM 1998 C CZ . TYR A 1 271 ? 1.245 -30.661 -22.081 1.00 29.69 ? 255 TYR A CZ 1
+ATOM 1999 O OH . TYR A 1 271 ? 2.269 -30.837 -21.182 1.00 24.57 ? 255 TYR A OH 1
+ATOM 2000 N N . VAL A 1 272 ? -0.523 -32.781 -26.740 1.00 24.04 ? 256 VAL A N 1
+ATOM 2001 C CA . VAL A 1 272 ? -0.420 -34.230 -26.913 1.00 18.84 ? 256 VAL A CA 1
+ATOM 2002 C C . VAL A 1 272 ? -0.571 -35.056 -25.621 1.00 14.70 ? 256 VAL A C 1
+ATOM 2003 O O . VAL A 1 272 ? -1.275 -36.066 -25.634 1.00 27.99 ? 256 VAL A O 1
+ATOM 2004 C CB . VAL A 1 272 ? 0.919 -34.608 -27.606 1.00 34.91 ? 256 VAL A CB 1
+ATOM 2005 C CG1 . VAL A 1 272 ? 1.128 -36.110 -27.599 1.00 22.90 ? 256 VAL A CG1 1
+ATOM 2006 C CG2 . VAL A 1 272 ? 0.936 -34.082 -29.030 1.00 34.68 ? 256 VAL A CG2 1
+ATOM 2007 N N . PRO A 1 273 ? 0.078 -34.646 -24.508 1.00 21.38 ? 257 PRO A N 1
+ATOM 2008 C CA . PRO A 1 273 ? -0.150 -35.430 -23.282 1.00 17.01 ? 257 PRO A CA 1
+ATOM 2009 C C . PRO A 1 273 ? -1.619 -35.464 -22.833 1.00 22.56 ? 257 PRO A C 1
+ATOM 2010 O O . PRO A 1 273 ? -2.066 -36.472 -22.286 1.00 22.00 ? 257 PRO A O 1
+ATOM 2011 C CB . PRO A 1 273 ? 0.715 -34.710 -22.239 1.00 22.78 ? 257 PRO A CB 1
+ATOM 2012 C CG . PRO A 1 273 ? 1.786 -34.042 -23.036 1.00 19.22 ? 257 PRO A CG 1
+ATOM 2013 C CD . PRO A 1 273 ? 1.106 -33.606 -24.304 1.00 21.81 ? 257 PRO A CD 1
+ATOM 2014 N N . ALA A 1 274 ? -2.353 -34.379 -23.062 1.00 17.40 ? 258 ALA A N 1
+ATOM 2015 C CA . ALA A 1 274 ? -3.779 -34.348 -22.748 1.00 15.29 ? 258 ALA A CA 1
+ATOM 2016 C C . ALA A 1 274 ? -4.555 -35.312 -23.637 1.00 27.08 ? 258 ALA A C 1
+ATOM 2017 O O . ALA A 1 274 ? -5.438 -36.030 -23.169 1.00 23.76 ? 258 ALA A O 1
+ATOM 2018 C CB . ALA A 1 274 ? -4.329 -32.935 -22.900 1.00 19.95 ? 258 ALA A CB 1
+ATOM 2019 N N . GLN A 1 275 ? -4.227 -35.317 -24.924 1.00 20.70 ? 259 GLN A N 1
+ATOM 2020 C CA . GLN A 1 275 ? -4.881 -36.211 -25.874 1.00 27.86 ? 259 GLN A CA 1
+ATOM 2021 C C . GLN A 1 275 ? -4.598 -37.668 -25.529 1.00 35.53 ? 259 GLN A C 1
+ATOM 2022 O O . GLN A 1 275 ? -5.490 -38.513 -25.575 1.00 28.97 ? 259 GLN A O 1
+ATOM 2023 C CB . GLN A 1 275 ? -4.424 -35.901 -27.297 1.00 22.57 ? 259 GLN A CB 1
+ATOM 2024 C CG . GLN A 1 275 ? -4.756 -34.485 -27.744 1.00 18.10 ? 259 GLN A CG 1
+ATOM 2025 C CD . GLN A 1 275 ? -4.242 -34.179 -29.131 1.00 30.60 ? 259 GLN A CD 1
+ATOM 2026 O OE1 . GLN A 1 275 ? -3.379 -34.880 -29.652 1.00 36.08 ? 259 GLN A OE1 1
+ATOM 2027 N NE2 . GLN A 1 275 ? -4.776 -33.129 -29.742 1.00 33.65 ? 259 GLN A NE2 1
+ATOM 2028 N N . GLN A 1 276 ? -3.353 -37.954 -25.170 1.00 22.62 ? 260 GLN A N 1
+ATOM 2029 C CA . GLN A 1 276 ? -2.969 -39.299 -24.757 1.00 30.73 ? 260 GLN A CA 1
+ATOM 2030 C C . GLN A 1 276 ? -3.684 -39.712 -23.472 1.00 44.63 ? 260 GLN A C 1
+ATOM 2031 O O . GLN A 1 276 ? -4.136 -40.849 -23.350 1.00 45.46 ? 260 GLN A O 1
+ATOM 2032 C CB . GLN A 1 276 ? -1.452 -39.390 -24.566 1.00 29.45 ? 260 GLN A CB 1
+ATOM 2033 C CG . GLN A 1 276 ? -0.653 -39.272 -25.855 1.00 27.07 ? 260 GLN A CG 1
+ATOM 2034 C CD . GLN A 1 276 ? 0.845 -39.165 -25.614 1.00 81.64 ? 260 GLN A CD 1
+ATOM 2035 O OE1 . GLN A 1 276 ? 1.285 -38.718 -24.555 1.00 64.62 ? 260 GLN A OE1 1
+ATOM 2036 N NE2 . GLN A 1 276 ? 1.634 -39.573 -26.602 1.00 71.58 ? 260 GLN A NE2 1
+ATOM 2037 N N . ALA A 1 277 ? -3.787 -38.785 -22.522 1.00 37.76 ? 261 ALA A N 1
+ATOM 2038 C CA . ALA A 1 277 ? -4.425 -39.067 -21.237 1.00 37.01 ? 261 ALA A CA 1
+ATOM 2039 C C . ALA A 1 277 ? -5.890 -39.448 -21.409 1.00 38.44 ? 261 ALA A C 1
+ATOM 2040 O O . ALA A 1 277 ? -6.352 -40.438 -20.845 1.00 42.03 ? 261 ALA A O 1
+ATOM 2041 C CB . ALA A 1 277 ? -4.301 -37.868 -20.300 1.00 23.27 ? 261 ALA A CB 1
+ATOM 2042 N N . LEU A 1 278 ? -6.616 -38.658 -22.195 1.00 26.64 ? 262 LEU A N 1
+ATOM 2043 C CA . LEU A 1 278 ? -8.031 -38.916 -22.434 1.00 28.86 ? 262 LEU A CA 1
+ATOM 2044 C C . LEU A 1 278 ? -8.215 -40.165 -23.291 1.00 49.88 ? 262 LEU A C 1
+ATOM 2045 O O . LEU A 1 278 ? -9.293 -40.757 -23.318 1.00 49.06 ? 262 LEU A O 1
+ATOM 2046 C CB . LEU A 1 278 ? -8.692 -37.709 -23.099 1.00 24.70 ? 262 LEU A CB 1
+ATOM 2047 C CG . LEU A 1 278 ? -8.747 -36.438 -22.250 1.00 33.52 ? 262 LEU A CG 1
+ATOM 2048 C CD1 . LEU A 1 278 ? -9.320 -35.278 -23.046 1.00 27.16 ? 262 LEU A CD1 1
+ATOM 2049 C CD2 . LEU A 1 278 ? -9.566 -36.681 -20.992 1.00 38.61 ? 262 LEU A CD2 1
+ATOM 2050 N N . GLY A 1 279 ? -7.151 -40.563 -23.983 1.00 49.84 ? 263 GLY A N 1
+ATOM 2051 C CA . GLY A 1 279 ? -7.170 -41.760 -24.801 1.00 49.81 ? 263 GLY A CA 1
+ATOM 2052 C C . GLY A 1 279 ? -7.118 -43.036 -23.980 1.00 74.09 ? 263 GLY A C 1
+ATOM 2053 O O . GLY A 1 279 ? -7.680 -44.058 -24.376 1.00 61.79 ? 263 GLY A O 1
+ATOM 2054 N N . ARG A 1 280 ? -6.445 -42.979 -22.834 1.00 73.91 ? 264 ARG A N 1
+ATOM 2055 C CA . ARG A 1 280 ? -6.315 -44.144 -21.962 1.00 65.73 ? 264 ARG A CA 1
+ATOM 2056 C C . ARG A 1 280 ? -7.620 -44.433 -21.224 1.00 52.28 ? 264 ARG A C 1
+ATOM 2057 O O . ARG A 1 280 ? -7.822 -45.536 -20.714 1.00 90.35 ? 264 ARG A O 1
+ATOM 2058 C CB . ARG A 1 280 ? -5.181 -43.943 -20.950 1.00 54.84 ? 264 ARG A CB 1
+ATOM 2059 C CG . ARG A 1 280 ? -3.856 -43.515 -21.563 1.00 74.86 ? 264 ARG A CG 1
+ATOM 2060 C CD . ARG A 1 280 ? -2.743 -43.485 -20.521 1.00 91.18 ? 264 ARG A CD 1
+ATOM 2061 N NE . ARG A 1 280 ? -1.595 -42.700 -20.969 1.00 102.18 ? 264 ARG A NE 1
+ATOM 2062 C CZ . ARG A 1 280 ? -1.310 -41.478 -20.530 1.00 61.96 ? 264 ARG A CZ 1
+ATOM 2063 N NH1 . ARG A 1 280 ? -2.083 -40.903 -19.619 1.00 87.19 ? 264 ARG A NH1 1
+ATOM 2064 N NH2 . ARG A 1 280 ? -0.249 -40.832 -20.993 1.00 53.15 ? 264 ARG A NH2 1
+ATOM 2065 N N . ILE A 1 281 ? -8.500 -43.438 -21.170 1.00 68.51 ? 265 ILE A N 1
+ATOM 2066 C CA . ILE A 1 281 ? -9.780 -43.579 -20.484 1.00 76.34 ? 265 ILE A CA 1
+ATOM 2067 C C . ILE A 1 281 ? -10.955 -43.364 -21.436 1.00 73.26 ? 265 ILE A C 1
+ATOM 2068 O O . ILE A 1 281 ? -10.883 -43.700 -22.620 1.00 49.06 ? 265 ILE A O 1
+ATOM 2069 C CB . ILE A 1 281 ? -9.901 -42.590 -19.308 1.00 56.03 ? 265 ILE A CB 1
+ATOM 2070 C CG1 . ILE A 1 281 ? -9.980 -41.153 -19.827 1.00 57.53 ? 265 ILE A CG1 1
+ATOM 2071 C CG2 . ILE A 1 281 ? -8.731 -42.752 -18.349 1.00 70.66 ? 265 ILE A CG2 1
+ATOM 2072 C CD1 . ILE A 1 281 ? -10.100 -40.114 -18.735 1.00 62.67 ? 265 ILE A CD1 1
+HETATM 2073 C C1 . RET B 2 . ? -20.399 -15.465 5.238 1.00 20.84 ? 301 RET A C1 1
+HETATM 2074 C C2 . RET B 2 . ? -21.156 -14.502 6.139 1.00 16.67 ? 301 RET A C2 1
+HETATM 2075 C C3 . RET B 2 . ? -22.651 -14.743 6.052 1.00 16.34 ? 301 RET A C3 1
+HETATM 2076 C C4 . RET B 2 . ? -23.126 -14.352 4.665 1.00 20.44 ? 301 RET A C4 1
+HETATM 2077 C C5 . RET B 2 . ? -22.217 -14.919 3.597 1.00 18.07 ? 301 RET A C5 1
+HETATM 2078 C C6 . RET B 2 . ? -21.057 -15.546 3.858 1.00 14.38 ? 301 RET A C6 1
+HETATM 2079 C C7 . RET B 2 . ? -20.488 -16.332 2.725 1.00 20.23 ? 301 RET A C7 1
+HETATM 2080 C C8 . RET B 2 . ? -19.476 -17.196 2.831 1.00 9.61 ? 301 RET A C8 1
+HETATM 2081 C C9 . RET B 2 . ? -18.948 -17.984 1.710 1.00 16.64 ? 301 RET A C9 1
+HETATM 2082 C C10 . RET B 2 . ? -17.859 -18.723 1.952 1.00 15.33 ? 301 RET A C10 1
+HETATM 2083 C C11 . RET B 2 . ? -17.221 -19.588 0.967 1.00 15.50 ? 301 RET A C11 1
+HETATM 2084 C C12 . RET B 2 . ? -16.257 -20.380 1.431 1.00 18.27 ? 301 RET A C12 1
+HETATM 2085 C C13 . RET B 2 . ? -15.534 -21.329 0.571 1.00 18.22 ? 301 RET A C13 1
+HETATM 2086 C C14 . RET B 2 . ? -14.551 -22.065 1.109 1.00 24.34 ? 301 RET A C14 1
+HETATM 2087 C C15 . RET B 2 . ? -13.816 -23.028 0.299 1.00 25.86 ? 301 RET A C15 1
+HETATM 2088 C C16 . RET B 2 . ? -18.958 -14.963 5.162 1.00 15.45 ? 301 RET A C16 1
+HETATM 2089 C C17 . RET B 2 . ? -20.440 -16.833 5.915 1.00 13.67 ? 301 RET A C17 1
+HETATM 2090 C C18 . RET B 2 . ? -22.671 -14.781 2.172 1.00 14.21 ? 301 RET A C18 1
+HETATM 2091 C C19 . RET B 2 . ? -19.632 -17.973 0.372 1.00 10.79 ? 301 RET A C19 1
+HETATM 2092 C C20 . RET B 2 . ? -15.919 -21.494 -0.873 1.00 18.54 ? 301 RET A C20 1
+HETATM 2093 CL CL . CL C 3 . ? -10.687 -23.067 3.320 1.00 32.55 ? 302 CL A CL 1
+HETATM 2094 CL CL . CL D 3 . ? -0.557 -23.869 -23.802 1.00 40.01 ? 303 CL A CL 1
+HETATM 2095 C C1 . OLA E 4 . ? -23.550 -2.457 14.151 1.00 47.05 ? 304 OLA A C1 1
+HETATM 2096 O O1 . OLA E 4 . ? -24.460 -3.314 14.148 1.00 53.41 ? 304 OLA A O1 1
+HETATM 2097 O O2 . OLA E 4 . ? -23.176 -1.970 15.242 1.00 38.30 ? 304 OLA A O2 1
+HETATM 2098 C C2 . OLA E 4 . ? -22.916 -2.020 12.852 1.00 38.63 ? 304 OLA A C2 1
+HETATM 2099 C C3 . OLA E 4 . ? -23.474 -2.859 11.708 1.00 27.47 ? 304 OLA A C3 1
+HETATM 2100 C C4 . OLA E 4 . ? -22.662 -2.668 10.435 1.00 49.84 ? 304 OLA A C4 1
+HETATM 2101 C C5 . OLA E 4 . ? -23.444 -3.138 9.216 1.00 46.72 ? 304 OLA A C5 1
+HETATM 2102 C C6 . OLA E 4 . ? -23.855 -1.962 8.336 1.00 56.83 ? 304 OLA A C6 1
+HETATM 2103 C C7 . OLA E 4 . ? -22.742 -0.927 8.211 1.00 48.64 ? 304 OLA A C7 1
+HETATM 2104 C C8 . OLA E 4 . ? -21.906 -1.156 6.956 1.00 60.56 ? 304 OLA A C8 1
+HETATM 2105 C C9 . OLA E 4 . ? -20.584 -1.787 7.325 1.00 77.57 ? 304 OLA A C9 1
+HETATM 2106 C C10 . OLA E 4 . ? -19.433 -1.667 6.416 1.00 75.19 ? 304 OLA A C10 1
+HETATM 2107 C C11 . OLA E 4 . ? -19.624 -1.822 4.926 1.00 49.82 ? 304 OLA A C11 1
+HETATM 2108 C C12 . OLA E 4 . ? -18.312 -1.515 4.213 1.00 48.25 ? 304 OLA A C12 1
+HETATM 2109 C C1 . OLA F 4 . ? -25.128 -37.384 16.199 1.00 64.39 ? 305 OLA A C1 1
+HETATM 2110 O O1 . OLA F 4 . ? -24.778 -38.423 16.798 1.00 62.38 ? 305 OLA A O1 1
+HETATM 2111 O O2 . OLA F 4 . ? -24.648 -36.291 16.568 1.00 51.28 ? 305 OLA A O2 1
+HETATM 2112 C C2 . OLA F 4 . ? -26.124 -37.440 15.062 1.00 47.64 ? 305 OLA A C2 1
+HETATM 2113 C C3 . OLA F 4 . ? -25.774 -38.565 14.093 1.00 43.20 ? 305 OLA A C3 1
+HETATM 2114 C C4 . OLA F 4 . ? -25.598 -38.040 12.671 1.00 39.92 ? 305 OLA A C4 1
+HETATM 2115 C C5 . OLA F 4 . ? -25.731 -39.164 11.648 1.00 46.71 ? 305 OLA A C5 1
+HETATM 2116 C C6 . OLA F 4 . ? -24.696 -39.027 10.539 1.00 37.72 ? 305 OLA A C6 1
+HETATM 2117 C C7 . OLA F 4 . ? -25.325 -38.640 9.208 1.00 20.79 ? 305 OLA A C7 1
+HETATM 2118 C C8 . OLA F 4 . ? -24.317 -38.813 8.074 1.00 41.88 ? 305 OLA A C8 1
+HETATM 2119 C C9 . OLA F 4 . ? -23.449 -37.580 7.991 1.00 103.20 ? 305 OLA A C9 1
+HETATM 2120 C C10 . OLA F 4 . ? -22.605 -37.313 6.814 1.00 60.77 ? 305 OLA A C10 1
+HETATM 2121 C C11 . OLA F 4 . ? -21.290 -38.024 6.598 1.00 37.58 ? 305 OLA A C11 1
+HETATM 2122 C C12 . OLA F 4 . ? -20.706 -37.609 5.248 1.00 44.10 ? 305 OLA A C12 1
+HETATM 2123 C C13 . OLA F 4 . ? -20.763 -36.096 5.056 1.00 37.71 ? 305 OLA A C13 1
+HETATM 2124 C C14 . OLA F 4 . ? -20.054 -35.655 3.779 1.00 33.64 ? 305 OLA A C14 1
+HETATM 2125 C C15 . OLA F 4 . ? -21.002 -35.611 2.588 1.00 34.89 ? 305 OLA A C15 1
+HETATM 2126 C C16 . OLA F 4 . ? -20.304 -35.059 1.349 1.00 41.61 ? 305 OLA A C16 1
+HETATM 2127 C C17 . OLA F 4 . ? -21.314 -34.683 0.271 1.00 43.96 ? 305 OLA A C17 1
+HETATM 2128 C C18 . OLA F 4 . ? -20.620 -34.192 -0.993 1.00 44.79 ? 305 OLA A C18 1
+HETATM 2129 C C1 . OLA G 4 . ? -18.145 -34.972 -18.063 1.00 68.28 ? 306 OLA A C1 1
+HETATM 2130 O O1 . OLA G 4 . ? -18.502 -33.825 -18.408 1.00 64.45 ? 306 OLA A O1 1
+HETATM 2131 O O2 . OLA G 4 . ? -18.390 -35.934 -18.824 1.00 61.66 ? 306 OLA A O2 1
+HETATM 2132 C C2 . OLA G 4 . ? -17.431 -35.189 -16.749 1.00 39.42 ? 306 OLA A C2 1
+HETATM 2133 C C3 . OLA G 4 . ? -18.029 -34.256 -15.706 1.00 35.00 ? 306 OLA A C3 1
+HETATM 2134 C C4 . OLA G 4 . ? -16.952 -33.549 -14.892 1.00 51.76 ? 306 OLA A C4 1
+HETATM 2135 C C5 . OLA G 4 . ? -16.213 -34.523 -13.983 1.00 59.22 ? 306 OLA A C5 1
+HETATM 2136 C C6 . OLA G 4 . ? -16.258 -34.049 -12.535 1.00 50.00 ? 306 OLA A C6 1
+HETATM 2137 C C7 . OLA G 4 . ? -16.203 -35.215 -11.555 1.00 45.73 ? 306 OLA A C7 1
+HETATM 2138 C C8 . OLA G 4 . ? -17.120 -34.972 -10.361 1.00 37.51 ? 306 OLA A C8 1
+HETATM 2139 C C9 . OLA G 4 . ? -16.814 -35.984 -9.283 1.00 67.90 ? 306 OLA A C9 1
+HETATM 2140 C C10 . OLA G 4 . ? -17.884 -36.599 -8.484 1.00 50.87 ? 306 OLA A C10 1
+HETATM 2141 C C11 . OLA G 4 . ? -19.165 -35.864 -8.168 1.00 46.00 ? 306 OLA A C11 1
+HETATM 2142 C C12 . OLA G 4 . ? -20.042 -36.796 -7.340 1.00 70.20 ? 306 OLA A C12 1
+HETATM 2143 C C13 . OLA G 4 . ? -21.512 -36.394 -7.367 1.00 49.47 ? 306 OLA A C13 1
+HETATM 2144 C C14 . OLA G 4 . ? -22.295 -37.200 -6.335 1.00 45.43 ? 306 OLA A C14 1
+HETATM 2145 C C15 . OLA G 4 . ? -23.634 -37.657 -6.899 1.00 38.93 ? 306 OLA A C15 1
+HETATM 2146 C C16 . OLA G 4 . ? -24.379 -38.551 -5.912 1.00 38.49 ? 306 OLA A C16 1
+HETATM 2147 C C1 . OLA H 4 . ? -22.892 -41.762 14.838 1.00 86.65 ? 307 OLA A C1 1
+HETATM 2148 O O1 . OLA H 4 . ? -22.337 -42.882 14.841 1.00 87.63 ? 307 OLA A O1 1
+HETATM 2149 O O2 . OLA H 4 . ? -23.301 -41.287 15.920 1.00 55.71 ? 307 OLA A O2 1
+HETATM 2150 C C2 . OLA H 4 . ? -23.067 -40.995 13.548 1.00 48.88 ? 307 OLA A C2 1
+HETATM 2151 C C3 . OLA H 4 . ? -22.035 -41.454 12.524 1.00 39.28 ? 307 OLA A C3 1
+HETATM 2152 C C4 . OLA H 4 . ? -22.710 -42.075 11.306 1.00 47.83 ? 307 OLA A C4 1
+HETATM 2153 C C5 . OLA H 4 . ? -21.679 -42.500 10.268 1.00 49.89 ? 307 OLA A C5 1
+HETATM 2154 C C6 . OLA H 4 . ? -22.215 -42.315 8.853 1.00 44.59 ? 307 OLA A C6 1
+HETATM 2155 C C7 . OLA H 4 . ? -22.470 -43.658 8.177 1.00 59.27 ? 307 OLA A C7 1
+HETATM 2156 C C8 . OLA H 4 . ? -22.480 -43.518 6.659 1.00 44.54 ? 307 OLA A C8 1
+HETATM 2157 C C1 . OLA I 4 . ? 5.140 -36.540 -10.826 1.00 83.79 ? 308 OLA A C1 1
+HETATM 2158 O O1 . OLA I 4 . ? 4.138 -36.708 -11.554 1.00 59.71 ? 308 OLA A O1 1
+HETATM 2159 O O2 . OLA I 4 . ? 5.863 -35.536 -11.009 1.00 60.67 ? 308 OLA A O2 1
+HETATM 2160 C C2 . OLA I 4 . ? 5.475 -37.541 -9.746 1.00 48.27 ? 308 OLA A C2 1
+HETATM 2161 C C3 . OLA I 4 . ? 4.396 -37.514 -8.669 1.00 42.65 ? 308 OLA A C3 1
+HETATM 2162 C C4 . OLA I 4 . ? 4.997 -37.802 -7.298 1.00 65.31 ? 308 OLA A C4 1
+HETATM 2163 C C5 . OLA I 4 . ? 3.975 -38.460 -6.378 1.00 51.65 ? 308 OLA A C5 1
+HETATM 2164 C C6 . OLA I 4 . ? 4.403 -38.362 -4.918 1.00 37.48 ? 308 OLA A C6 1
+HETATM 2165 C C7 . OLA I 4 . ? 3.202 -38.505 -3.992 1.00 48.52 ? 308 OLA A C7 1
+HETATM 2166 C C8 . OLA I 4 . ? 3.601 -39.146 -2.667 1.00 47.33 ? 308 OLA A C8 1
+HETATM 2167 C C9 . OLA I 4 . ? 2.412 -39.152 -1.737 1.00 59.42 ? 308 OLA A C9 1
+HETATM 2168 C C10 . OLA I 4 . ? 2.569 -39.589 -0.343 1.00 53.67 ? 308 OLA A C10 1
+HETATM 2169 C C9 . OLA J 4 . ? -29.060 -22.479 -4.398 1.00 39.05 ? 309 OLA A C9 1
+HETATM 2170 C C10 . OLA J 4 . ? -29.474 -23.101 -3.130 1.00 69.33 ? 309 OLA A C10 1
+HETATM 2171 C C11 . OLA J 4 . ? -28.436 -23.660 -2.186 1.00 64.45 ? 309 OLA A C11 1
+HETATM 2172 C C12 . OLA J 4 . ? -29.093 -24.083 -0.876 1.00 43.40 ? 309 OLA A C12 1
+HETATM 2173 C C13 . OLA J 4 . ? -30.050 -25.249 -1.093 1.00 66.30 ? 309 OLA A C13 1
+HETATM 2174 C C14 . OLA J 4 . ? -29.384 -26.584 -0.781 1.00 58.23 ? 309 OLA A C14 1
+HETATM 2175 C C15 . OLA J 4 . ? -29.521 -26.942 0.695 1.00 59.98 ? 309 OLA A C15 1
+HETATM 2176 C C16 . OLA J 4 . ? -29.035 -28.364 0.952 1.00 56.18 ? 309 OLA A C16 1
+HETATM 2177 C C17 . OLA J 4 . ? -29.311 -28.797 2.387 1.00 35.93 ? 309 OLA A C17 1
+HETATM 2178 C C18 . OLA J 4 . ? -30.807 -28.887 2.651 1.00 48.58 ? 309 OLA A C18 1
+HETATM 2179 C C1 . OLA K 4 . ? -6.712 -40.900 -5.331 1.00 56.86 ? 310 OLA A C1 1
+HETATM 2180 C C2 . OLA K 4 . ? -5.256 -41.279 -5.197 1.00 50.05 ? 310 OLA A C2 1
+HETATM 2181 C C3 . OLA K 4 . ? -4.323 -40.996 -6.297 1.00 62.09 ? 310 OLA A C3 1
+HETATM 2182 C C4 . OLA K 4 . ? -4.769 -41.170 -7.729 1.00 48.02 ? 310 OLA A C4 1
+HETATM 2183 C C5 . OLA K 4 . ? -3.554 -41.112 -8.646 1.00 33.80 ? 310 OLA A C5 1
+HETATM 2184 C C6 . OLA K 4 . ? -3.945 -41.394 -10.092 1.00 56.92 ? 310 OLA A C6 1
+HETATM 2185 C C1 . OLA L 4 . ? -5.493 -38.939 -16.587 1.00 46.46 ? 311 OLA A C1 1
+HETATM 2186 C C2 . OLA L 4 . ? -6.916 -38.614 -17.022 1.00 66.19 ? 311 OLA A C2 1
+HETATM 2187 C C3 . OLA L 4 . ? -7.569 -37.618 -16.072 1.00 41.88 ? 311 OLA A C3 1
+HETATM 2188 C C4 . OLA L 4 . ? -8.913 -37.212 -16.624 1.00 40.45 ? 311 OLA A C4 1
+HETATM 2189 C C5 . OLA L 4 . ? -9.669 -36.110 -16.013 1.00 37.12 ? 311 OLA A C5 1
+HETATM 2190 C C6 . OLA L 4 . ? -9.403 -35.701 -14.585 1.00 59.95 ? 311 OLA A C6 1
+HETATM 2191 C C7 . OLA L 4 . ? -10.680 -35.139 -13.972 1.00 33.96 ? 311 OLA A C7 1
+HETATM 2192 C C8 . OLA L 4 . ? -11.454 -36.239 -13.252 1.00 49.57 ? 311 OLA A C8 1
+HETATM 2193 C C9 . OLA L 4 . ? -12.958 -36.067 -13.423 1.00 38.55 ? 311 OLA A C9 1
+HETATM 2194 C C1 . OLA M 4 . ? -31.949 -24.238 -13.859 1.00 79.91 ? 312 OLA A C1 1
+HETATM 2195 O O1 . OLA M 4 . ? -31.613 -23.498 -14.809 1.00 73.09 ? 312 OLA A O1 1
+HETATM 2196 O O2 . OLA M 4 . ? -31.888 -25.477 -14.009 1.00 70.53 ? 312 OLA A O2 1
+HETATM 2197 C C2 . OLA M 4 . ? -32.423 -23.643 -12.554 1.00 59.47 ? 312 OLA A C2 1
+HETATM 2198 C C3 . OLA M 4 . ? -32.099 -24.599 -11.412 1.00 52.35 ? 312 OLA A C3 1
+HETATM 2199 C C4 . OLA M 4 . ? -32.955 -24.306 -10.186 1.00 53.11 ? 312 OLA A C4 1
+HETATM 2200 C C5 . OLA M 4 . ? -32.654 -22.913 -9.644 1.00 86.86 ? 312 OLA A C5 1
+HETATM 2201 C C6 . OLA M 4 . ? -32.671 -22.893 -8.120 1.00 65.90 ? 312 OLA A C6 1
+HETATM 2202 C C7 . OLA M 4 . ? -33.872 -22.117 -7.593 1.00 55.21 ? 312 OLA A C7 1
+HETATM 2203 C C1 . OLA N 4 . ? 3.169 -22.582 -8.949 1.00 70.72 ? 313 OLA A C1 1
+HETATM 2204 O O1 . OLA N 4 . ? 4.169 -23.089 -9.504 1.00 51.83 ? 313 OLA A O1 1
+HETATM 2205 O O2 . OLA N 4 . ? 2.548 -23.252 -8.096 1.00 68.08 ? 313 OLA A O2 1
+HETATM 2206 C C2 . OLA N 4 . ? 2.718 -21.185 -9.301 1.00 87.60 ? 313 OLA A C2 1
+HETATM 2207 C C3 . OLA N 4 . ? 1.237 -21.020 -8.975 1.00 62.83 ? 313 OLA A C3 1
+HETATM 2208 C C4 . OLA N 4 . ? 0.999 -19.826 -8.057 1.00 49.51 ? 313 OLA A C4 1
+HETATM 2209 C C5 . OLA N 4 . ? -0.492 -19.593 -7.840 1.00 44.71 ? 313 OLA A C5 1
+HETATM 2210 C C6 . OLA N 4 . ? -0.816 -18.107 -7.731 1.00 55.24 ? 313 OLA A C6 1
+HETATM 2211 C C7 . OLA N 4 . ? -1.220 -17.736 -6.308 1.00 47.94 ? 313 OLA A C7 1
+HETATM 2212 C C8 . OLA O 4 . ? -11.913 -4.864 1.255 1.00 32.99 ? 314 OLA A C8 1
+HETATM 2213 C C9 . OLA O 4 . ? -13.384 -4.699 0.952 1.00 46.85 ? 314 OLA A C9 1
+HETATM 2214 C C10 . OLA O 4 . ? -14.306 -4.220 1.993 1.00 68.94 ? 314 OLA A C10 1
+HETATM 2215 C C11 . OLA O 4 . ? -14.023 -4.505 3.451 1.00 50.73 ? 314 OLA A C11 1
+HETATM 2216 C C12 . OLA O 4 . ? -15.168 -3.995 4.321 1.00 54.60 ? 314 OLA A C12 1
+HETATM 2217 C C13 . OLA O 4 . ? -14.626 -3.416 5.622 1.00 48.33 ? 314 OLA A C13 1
+HETATM 2218 C C14 . OLA O 4 . ? -15.474 -3.794 6.831 1.00 53.34 ? 314 OLA A C14 1
+HETATM 2219 C C15 . OLA O 4 . ? -15.105 -2.915 8.022 1.00 63.75 ? 314 OLA A C15 1
+HETATM 2220 C C16 . OLA O 4 . ? -15.453 -3.577 9.351 1.00 62.59 ? 314 OLA A C16 1
+HETATM 2221 C C17 . OLA O 4 . ? -15.281 -2.595 10.506 1.00 64.62 ? 314 OLA A C17 1
+HETATM 2222 C C18 . OLA O 4 . ? -15.360 -3.304 11.854 1.00 42.90 ? 314 OLA A C18 1
+HETATM 2223 O O . HOH P 5 . ? -9.113 -33.746 25.061 1.00 6.34 ? 401 HOH A O 1
+HETATM 2224 O O . HOH P 5 . ? -20.028 -18.655 11.520 1.00 20.68 ? 402 HOH A O 1
+HETATM 2225 O O . HOH P 5 . ? -29.481 -9.009 19.378 1.00 34.24 ? 403 HOH A O 1
+HETATM 2226 O O . HOH P 5 . ? -18.776 -40.884 14.665 1.00 36.14 ? 404 HOH A O 1
+HETATM 2227 O O . HOH P 5 . ? -15.987 -23.518 -5.596 1.00 22.70 ? 405 HOH A O 1
+HETATM 2228 O O . HOH P 5 . ? -4.615 -23.174 5.972 1.00 37.01 ? 406 HOH A O 1
+HETATM 2229 O O . HOH P 5 . ? -19.785 -28.017 31.615 1.00 28.56 ? 407 HOH A O 1
+HETATM 2230 O O . HOH P 5 . ? -5.535 -32.823 21.242 1.00 27.17 ? 408 HOH A O 1
+HETATM 2231 O O . HOH P 5 . ? -20.033 -25.713 14.781 1.00 30.34 ? 409 HOH A O 1
+HETATM 2232 O O . HOH P 5 . ? -16.649 -26.271 -26.648 1.00 37.34 ? 410 HOH A O 1
+HETATM 2233 O O . HOH P 5 . ? 3.408 -33.892 -19.707 1.00 29.01 ? 411 HOH A O 1
+HETATM 2234 O O . HOH P 5 . ? -14.970 -25.940 12.128 1.00 31.18 ? 412 HOH A O 1
+HETATM 2235 O O . HOH P 5 . ? -12.392 -15.711 -22.647 1.00 38.86 ? 413 HOH A O 1
+HETATM 2236 O O . HOH P 5 . ? -8.334 -25.773 21.487 1.00 25.21 ? 414 HOH A O 1
+HETATM 2237 O O . HOH P 5 . ? -20.025 -31.438 -19.718 1.00 34.60 ? 415 HOH A O 1
+HETATM 2238 O O . HOH P 5 . ? -15.425 -28.931 7.110 1.00 29.18 ? 416 HOH A O 1
+HETATM 2239 O O . HOH P 5 . ? -27.164 -17.363 19.509 1.00 39.72 ? 417 HOH A O 1
+HETATM 2240 O O . HOH P 5 . ? -22.292 -17.473 12.614 1.00 22.76 ? 418 HOH A O 1
+HETATM 2241 O O . HOH P 5 . ? -8.660 -27.786 -10.930 1.00 26.51 ? 419 HOH A O 1
+HETATM 2242 O O . HOH P 5 . ? -13.250 -11.836 -22.916 1.00 37.12 ? 420 HOH A O 1
+HETATM 2243 O O . HOH P 5 . ? -21.754 -34.159 32.472 1.00 33.33 ? 421 HOH A O 1
+HETATM 2244 O O . HOH P 5 . ? -18.320 -27.376 28.034 1.00 20.08 ? 422 HOH A O 1
+HETATM 2245 O O . HOH P 5 . ? -20.697 -13.583 20.559 1.00 23.84 ? 423 HOH A O 1
+HETATM 2246 O O . HOH P 5 . ? -12.698 -37.937 19.133 1.00 49.79 ? 424 HOH A O 1
+HETATM 2247 O O . HOH P 5 . ? -18.318 -25.650 25.675 1.00 25.27 ? 425 HOH A O 1
+HETATM 2248 O O . HOH P 5 . ? -24.703 -9.337 -16.308 1.00 20.49 ? 426 HOH A O 1
+HETATM 2249 O O . HOH P 5 . ? -7.726 -23.468 13.071 1.00 31.20 ? 427 HOH A O 1
+HETATM 2250 O O . HOH P 5 . ? -3.470 -25.171 14.994 1.00 29.73 ? 428 HOH A O 1
+HETATM 2251 O O . HOH P 5 . ? -25.026 -32.179 24.402 1.00 27.78 ? 429 HOH A O 1
+HETATM 2252 O O . HOH P 5 . ? -29.058 -30.254 21.517 1.00 42.47 ? 430 HOH A O 1
+HETATM 2253 O O . HOH P 5 . ? -4.583 -31.253 24.730 1.00 36.49 ? 431 HOH A O 1
+HETATM 2254 O O . HOH P 5 . ? -4.077 -27.582 31.533 1.00 30.93 ? 432 HOH A O 1
+HETATM 2255 O O . HOH P 5 . ? -8.647 -31.829 26.059 1.00 38.57 ? 433 HOH A O 1
+HETATM 2256 O O . HOH P 5 . ? -13.922 -24.013 5.092 1.00 21.48 ? 434 HOH A O 1
+HETATM 2257 O O . HOH P 5 . ? 2.362 -34.164 -12.627 1.00 27.79 ? 435 HOH A O 1
+HETATM 2258 O O . HOH P 5 . ? -7.663 -29.697 31.309 1.00 48.40 ? 436 HOH A O 1
+HETATM 2259 O O . HOH P 5 . ? -6.618 -18.178 -19.452 1.00 26.57 ? 437 HOH A O 1
+HETATM 2260 O O . HOH P 5 . ? -11.019 -37.178 31.372 1.00 32.91 ? 438 HOH A O 1
+HETATM 2261 O O . HOH P 5 . ? -21.789 -39.038 26.516 1.00 25.67 ? 439 HOH A O 1
+HETATM 2262 O O . HOH P 5 . ? -9.142 -12.082 -21.867 1.00 31.65 ? 440 HOH A O 1
+HETATM 2263 O O . HOH P 5 . ? -17.585 -16.223 17.532 1.00 40.16 ? 441 HOH A O 1
+HETATM 2264 O O . HOH P 5 . ? -19.432 -31.873 35.924 1.00 45.35 ? 442 HOH A O 1
+HETATM 2265 O O . HOH P 5 . ? -2.890 -27.849 10.528 1.00 22.92 ? 443 HOH A O 1
+HETATM 2266 O O . HOH P 5 . ? -17.539 -20.514 15.930 1.00 39.07 ? 444 HOH A O 1
+HETATM 2267 O O . HOH P 5 . ? -18.699 -18.721 13.910 1.00 24.03 ? 445 HOH A O 1
+HETATM 2268 O O . HOH P 5 . ? -6.927 -26.645 34.182 1.00 41.32 ? 446 HOH A O 1
+HETATM 2269 O O . HOH P 5 . ? -23.238 -40.327 23.298 1.00 24.57 ? 447 HOH A O 1
+HETATM 2270 O O . HOH P 5 . ? -10.155 -26.509 -6.220 1.00 15.27 ? 448 HOH A O 1
+HETATM 2271 O O . HOH P 5 . ? -20.591 -40.584 17.020 1.00 42.46 ? 449 HOH A O 1
+HETATM 2272 O O . HOH P 5 . ? -13.244 -26.273 32.690 1.00 45.32 ? 450 HOH A O 1
+HETATM 2273 O O . HOH P 5 . ? -10.266 -35.198 24.152 1.00 28.42 ? 451 HOH A O 1
+HETATM 2274 O O . HOH P 5 . ? -6.231 -34.811 17.815 1.00 37.11 ? 452 HOH A O 1
+HETATM 2275 O O . HOH P 5 . ? -32.424 -21.594 18.599 1.00 39.71 ? 453 HOH A O 1
+HETATM 2276 O O . HOH P 5 . ? -23.466 -5.486 20.854 1.00 39.90 ? 454 HOH A O 1
+HETATM 2277 O O . HOH P 5 . ? -15.001 -37.661 35.248 1.00 30.21 ? 455 HOH A O 1
+HETATM 2278 O O . HOH P 5 . ? -20.228 -19.978 7.918 1.00 32.18 ? 456 HOH A O 1
+HETATM 2279 O O . HOH P 5 . ? -27.649 -28.447 23.755 1.00 25.31 ? 457 HOH A O 1
+HETATM 2280 O O . HOH P 5 . ? -14.860 -31.651 7.447 1.00 42.18 ? 458 HOH A O 1
+HETATM 2281 O O . HOH P 5 . ? -27.812 -32.193 22.720 1.00 42.53 ? 459 HOH A O 1
+HETATM 2282 O O . HOH P 5 . ? 5.536 -21.677 -11.753 1.00 46.71 ? 460 HOH A O 1
+HETATM 2283 O O . HOH P 5 . ? -15.353 -23.928 22.359 1.00 31.60 ? 461 HOH A O 1
+HETATM 2284 O O . HOH P 5 . ? 1.953 -31.248 -27.474 1.00 32.19 ? 462 HOH A O 1
+HETATM 2285 O O . HOH P 5 . ? -13.995 -15.591 15.993 1.00 28.83 ? 463 HOH A O 1
+HETATM 2286 O O . HOH P 5 . ? -14.873 -35.093 38.373 1.00 27.76 ? 464 HOH A O 1
+HETATM 2287 O O . HOH P 5 . ? -11.047 -37.179 27.416 1.00 19.83 ? 465 HOH A O 1
+HETATM 2288 O O . HOH P 5 . ? -20.548 -30.749 -24.664 1.00 41.23 ? 466 HOH A O 1
+HETATM 2289 O O . HOH P 5 . ? -5.813 -25.839 20.501 1.00 32.00 ? 467 HOH A O 1
+HETATM 2290 O O . HOH P 5 . ? -13.087 -27.475 -29.812 1.00 31.76 ? 468 HOH A O 1
+HETATM 2291 O O . HOH P 5 . ? -16.894 -33.482 39.957 1.00 42.17 ? 469 HOH A O 1
+HETATM 2292 O O . HOH P 5 . ? -27.491 -22.452 -19.970 1.00 45.88 ? 470 HOH A O 1
+HETATM 2293 O O . HOH P 5 . ? -27.925 -22.228 -17.165 1.00 29.41 ? 471 HOH A O 1
+HETATM 2294 O O . HOH P 5 . ? -9.719 -21.077 -26.623 1.00 49.60 ? 472 HOH A O 1
+HETATM 2295 O O . HOH P 5 . ? -29.356 -11.846 20.903 1.00 44.59 ? 473 HOH A O 1
+HETATM 2296 O O . HOH P 5 . ? -25.014 -28.274 27.498 1.00 25.38 ? 474 HOH A O 1
+HETATM 2297 O O . HOH P 5 . ? -16.627 -31.227 36.690 1.00 41.73 ? 475 HOH A O 1
+HETATM 2298 O O . HOH P 5 . ? -25.934 -29.860 25.470 1.00 34.40 ? 476 HOH A O 1
+HETATM 2299 O O . HOH P 5 . ? -21.674 -3.450 19.399 1.00 46.31 ? 477 HOH A O 1
+HETATM 2300 O O . HOH P 5 . ? -16.899 -39.724 33.595 1.00 39.76 ? 478 HOH A O 1
+HETATM 2301 O O . HOH P 5 . ? -24.210 -33.631 26.999 1.00 46.63 ? 479 HOH A O 1
+HETATM 2302 O O . HOH P 5 . ? 1.931 -25.737 -12.464 1.00 37.75 ? 480 HOH A O 1
+HETATM 2303 O O . HOH P 5 . ? 7.104 -36.441 -16.203 1.00 45.02 ? 481 HOH A O 1
+HETATM 2304 O O . HOH P 5 . ? -11.031 -12.437 8.476 1.00 34.74 ? 482 HOH A O 1
+HETATM 2305 O O . HOH P 5 . ? -27.450 -35.066 24.042 1.00 41.18 ? 483 HOH A O 1
+HETATM 2306 O O . HOH P 5 . ? -10.484 -37.205 22.435 1.00 46.28 ? 484 HOH A O 1
+HETATM 2307 O O . HOH P 5 . ? -2.376 -24.733 -25.456 1.00 45.06 ? 485 HOH A O 1
+#
+loop_
+_pdbx_poly_seq_scheme.asym_id
+_pdbx_poly_seq_scheme.entity_id
+_pdbx_poly_seq_scheme.seq_id
+_pdbx_poly_seq_scheme.mon_id
+_pdbx_poly_seq_scheme.ndb_seq_num
+_pdbx_poly_seq_scheme.pdb_seq_num
+_pdbx_poly_seq_scheme.auth_seq_num
+_pdbx_poly_seq_scheme.pdb_mon_id
+_pdbx_poly_seq_scheme.auth_mon_id
+_pdbx_poly_seq_scheme.pdb_strand_id
+_pdbx_poly_seq_scheme.pdb_ins_code
+_pdbx_poly_seq_scheme.hetero
+A 1 1 MET 1 -15 ? ? ? A . n
+A 1 2 ALA 2 -14 ? ? ? A . n
+A 1 3 SER 3 -13 ? ? ? A . n
+A 1 4 MET 4 -12 ? ? ? A . n
+A 1 5 THR 5 -11 ? ? ? A . n
+A 1 6 GLY 6 -10 ? ? ? A . n
+A 1 7 GLY 7 -9 ? ? ? A . n
+A 1 8 GLN 8 -8 ? ? ? A . n
+A 1 9 GLN 9 -7 ? ? ? A . n
+A 1 10 MET 10 -6 ? ? ? A . n
+A 1 11 GLY 11 -5 ? ? ? A . n
+A 1 12 ARG 12 -4 ? ? ? A . n
+A 1 13 ASP 13 -3 ? ? ? A . n
+A 1 14 PRO 14 -2 ? ? ? A . n
+A 1 15 ASN 15 -1 ? ? ? A . n
+A 1 16 SER 16 0 ? ? ? A . n
+A 1 17 MET 17 1 ? ? ? A . n
+A 1 18 LYS 18 2 2 LYS LYS A . n
+A 1 19 ASN 19 3 3 ASN ASN A . n
+A 1 20 ILE 20 4 4 ILE ILE A . n
+A 1 21 GLU 21 5 5 GLU GLU A . n
+A 1 22 SER 22 6 6 SER SER A . n
+A 1 23 LEU 23 7 7 LEU LEU A . n
+A 1 24 PHE 24 8 8 PHE PHE A . n
+A 1 25 ASP 25 9 9 ASP ASP A . n
+A 1 26 TYR 26 10 10 TYR TYR A . n
+A 1 27 SER 27 11 11 SER SER A . n
+A 1 28 ALA 28 12 12 ALA ALA A . n
+A 1 29 GLY 29 13 13 GLY GLY A . n
+A 1 30 GLN 30 14 14 GLN GLN A . n
+A 1 31 PHE 31 15 15 PHE PHE A . n
+A 1 32 GLU 32 16 16 GLU GLU A . n
+A 1 33 PHE 33 17 17 PHE PHE A . n
+A 1 34 ILE 34 18 18 ILE ILE A . n
+A 1 35 ASP 35 19 19 ASP ASP A . n
+A 1 36 HIS 36 20 20 HIS HIS A . n
+A 1 37 LEU 37 21 21 LEU LEU A . n
+A 1 38 LEU 38 22 22 LEU LEU A . n
+A 1 39 THR 39 23 23 THR THR A . n
+A 1 40 MET 40 24 24 MET MET A . n
+A 1 41 GLY 41 25 25 GLY GLY A . n
+A 1 42 VAL 42 26 26 VAL VAL A . n
+A 1 43 GLY 43 27 27 GLY GLY A . n
+A 1 44 VAL 44 28 28 VAL VAL A . n
+A 1 45 HIS 45 29 29 HIS HIS A . n
+A 1 46 PHE 46 30 30 PHE PHE A . n
+A 1 47 ALA 47 31 31 ALA ALA A . n
+A 1 48 ALA 48 32 32 ALA ALA A . n
+A 1 49 LEU 49 33 33 LEU LEU A . n
+A 1 50 ILE 50 34 34 ILE ILE A . n
+A 1 51 PHE 51 35 35 PHE PHE A . n
+A 1 52 PHE 52 36 36 PHE PHE A . n
+A 1 53 LEU 53 37 37 LEU LEU A . n
+A 1 54 VAL 54 38 38 VAL VAL A . n
+A 1 55 VAL 55 39 39 VAL VAL A . n
+A 1 56 SER 56 40 40 SER SER A . n
+A 1 57 GLN 57 41 41 GLN GLN A . n
+A 1 58 PHE 58 42 42 PHE PHE A . n
+A 1 59 VAL 59 43 43 VAL VAL A . n
+A 1 60 ALA 60 44 44 ALA ALA A . n
+A 1 61 PRO 61 45 45 PRO PRO A . n
+A 1 62 LYS 62 46 46 LYS LYS A . n
+A 1 63 TYR 63 47 47 TYR TYR A . n
+A 1 64 ARG 64 48 48 ARG ARG A . n
+A 1 65 ILE 65 49 49 ILE ILE A . n
+A 1 66 ALA 66 50 50 ALA ALA A . n
+A 1 67 THR 67 51 51 THR THR A . n
+A 1 68 ALA 68 52 52 ALA ALA A . n
+A 1 69 LEU 69 53 53 LEU LEU A . n
+A 1 70 SER 70 54 54 SER SER A . n
+A 1 71 CYS 71 55 55 CYS CYS A . n
+A 1 72 ILE 72 56 56 ILE ILE A . n
+A 1 73 VAL 73 57 57 VAL VAL A . n
+A 1 74 MET 74 58 58 MET MET A . n
+A 1 75 VAL 75 59 59 VAL VAL A . n
+A 1 76 SER 76 60 60 SER SER A . n
+A 1 77 ALA 77 61 61 ALA ALA A . n
+A 1 78 GLY 78 62 62 GLY GLY A . n
+A 1 79 LEU 79 63 63 LEU LEU A . n
+A 1 80 ILE 80 64 64 ILE ILE A . n
+A 1 81 LEU 81 65 65 LEU LEU A . n
+A 1 82 ASN 82 66 66 ASN ASN A . n
+A 1 83 SER 83 67 67 SER SER A . n
+A 1 84 GLN 84 68 68 GLN GLN A . n
+A 1 85 ALA 85 69 69 ALA ALA A . n
+A 1 86 VAL 86 70 70 VAL VAL A . n
+A 1 87 MET 87 71 71 MET MET A . n
+A 1 88 TRP 88 72 72 TRP TRP A . n
+A 1 89 THR 89 73 73 THR THR A . n
+A 1 90 ASP 90 74 74 ASP ASP A . n
+A 1 91 ALA 91 75 75 ALA ALA A . n
+A 1 92 TYR 92 76 76 TYR TYR A . n
+A 1 93 ALA 93 77 77 ALA ALA A . n
+A 1 94 TYR 94 78 78 TYR TYR A . n
+A 1 95 VAL 95 79 79 VAL VAL A . n
+A 1 96 ASP 96 80 80 ASP ASP A . n
+A 1 97 GLY 97 81 81 GLY GLY A . n
+A 1 98 SER 98 82 82 SER SER A . n
+A 1 99 TYR 99 83 83 TYR TYR A . n
+A 1 100 GLN 100 84 84 GLN GLN A . n
+A 1 101 LEU 101 85 85 LEU LEU A . n
+A 1 102 GLN 102 86 86 GLN GLN A . n
+A 1 103 ASP 103 87 87 ASP ASP A . n
+A 1 104 LEU 104 88 88 LEU LEU A . n
+A 1 105 THR 105 89 89 THR THR A . n
+A 1 106 PHE 106 90 90 PHE PHE A . n
+A 1 107 SER 107 91 91 SER SER A . n
+A 1 108 ASN 108 92 92 ASN ASN A . n
+A 1 109 GLY 109 93 93 GLY GLY A . n
+A 1 110 TYR 110 94 94 TYR TYR A . n
+A 1 111 ARG 111 95 95 ARG ARG A . n
+A 1 112 TYR 112 96 96 TYR TYR A . n
+A 1 113 VAL 113 97 97 VAL VAL A . n
+A 1 114 ASN 114 98 98 ASN ASN A . n
+A 1 115 TRP 115 99 99 TRP TRP A . n
+A 1 116 MET 116 100 100 MET MET A . n
+A 1 117 ALA 117 101 101 ALA ALA A . n
+A 1 118 THR 118 102 102 THR THR A . n
+A 1 119 ILE 119 103 103 ILE ILE A . n
+A 1 120 PRO 120 104 104 PRO PRO A . n
+A 1 121 CYS 121 105 105 CYS CYS A . n
+A 1 122 LEU 122 106 106 LEU LEU A . n
+A 1 123 LEU 123 107 107 LEU LEU A . n
+A 1 124 LEU 124 108 108 LEU LEU A . n
+A 1 125 GLN 125 109 109 GLN GLN A . n
+A 1 126 LEU 126 110 110 LEU LEU A . n
+A 1 127 LEU 127 111 111 LEU LEU A . n
+A 1 128 ILE 128 112 112 ILE ILE A . n
+A 1 129 VAL 129 113 113 VAL VAL A . n
+A 1 130 LEU 130 114 114 LEU LEU A . n
+A 1 131 ASN 131 115 115 ASN ASN A . n
+A 1 132 LEU 132 116 116 LEU LEU A . n
+A 1 133 LYS 133 117 117 LYS LYS A . n
+A 1 134 GLY 134 118 118 GLY GLY A . n
+A 1 135 LYS 135 119 119 LYS LYS A . n
+A 1 136 GLU 136 120 120 GLU GLU A . n
+A 1 137 LEU 137 121 121 LEU LEU A . n
+A 1 138 PHE 138 122 122 PHE PHE A . n
+A 1 139 SER 139 123 123 SER SER A . n
+A 1 140 THR 140 124 124 THR THR A . n
+A 1 141 ALA 141 125 125 ALA ALA A . n
+A 1 142 THR 142 126 126 THR THR A . n
+A 1 143 TRP 143 127 127 TRP TRP A . n
+A 1 144 LEU 144 128 128 LEU LEU A . n
+A 1 145 ILE 145 129 129 ILE ILE A . n
+A 1 146 LEU 146 130 130 LEU LEU A . n
+A 1 147 ALA 147 131 131 ALA ALA A . n
+A 1 148 ALA 148 132 132 ALA ALA A . n
+A 1 149 TRP 149 133 133 TRP TRP A . n
+A 1 150 GLY 150 134 134 GLY GLY A . n
+A 1 151 MET 151 135 135 MET MET A . n
+A 1 152 ILE 152 136 136 ILE ILE A . n
+A 1 153 ILE 153 137 137 ILE ILE A . n
+A 1 154 THR 154 138 138 THR THR A . n
+A 1 155 GLY 155 139 139 GLY GLY A . n
+A 1 156 TYR 156 140 140 TYR TYR A . n
+A 1 157 VAL 157 141 141 VAL VAL A . n
+A 1 158 GLY 158 142 142 GLY GLY A . n
+A 1 159 GLN 159 143 143 GLN GLN A . n
+A 1 160 LEU 160 144 144 LEU LEU A . n
+A 1 161 TYR 161 145 145 TYR TYR A . n
+A 1 162 GLU 162 146 146 GLU GLU A . n
+A 1 163 VAL 163 147 147 VAL VAL A . n
+A 1 164 ASP 164 148 148 ASP ASP A . n
+A 1 165 ASP 165 149 149 ASP ASP A . n
+A 1 166 ILE 166 150 150 ILE ILE A . n
+A 1 167 ALA 167 151 151 ALA ALA A . n
+A 1 168 GLN 168 152 152 GLN GLN A . n
+A 1 169 LEU 169 153 153 LEU LEU A . n
+A 1 170 MET 170 154 154 MET MET A . n
+A 1 171 ILE 171 155 155 ILE ILE A . n
+A 1 172 TRP 172 156 156 TRP TRP A . n
+A 1 173 GLY 173 157 157 GLY GLY A . n
+A 1 174 ALA 174 158 158 ALA ALA A . n
+A 1 175 VAL 175 159 159 VAL VAL A . n
+A 1 176 SER 176 160 160 SER SER A . n
+A 1 177 THR 177 161 161 THR THR A . n
+A 1 178 ALA 178 162 162 ALA ALA A . n
+A 1 179 PHE 179 163 163 PHE PHE A . n
+A 1 180 PHE 180 164 164 PHE PHE A . n
+A 1 181 VAL 181 165 165 VAL VAL A . n
+A 1 182 VAL 182 166 166 VAL VAL A . n
+A 1 183 MET 183 167 167 MET MET A . n
+A 1 184 ASN 184 168 168 ASN ASN A . n
+A 1 185 TRP 185 169 169 TRP TRP A . n
+A 1 186 ILE 186 170 170 ILE ILE A . n
+A 1 187 VAL 187 171 171 VAL VAL A . n
+A 1 188 GLY 188 172 172 GLY GLY A . n
+A 1 189 THR 189 173 173 THR THR A . n
+A 1 190 LYS 190 174 174 LYS LYS A . n
+A 1 191 ILE 191 175 175 ILE ILE A . n
+A 1 192 PHE 192 176 176 PHE PHE A . n
+A 1 193 LYS 193 177 177 LYS LYS A . n
+A 1 194 ASN 194 178 178 ASN ASN A . n
+A 1 195 ARG 195 179 179 ARG ARG A . n
+A 1 196 ALA 196 180 180 ALA ALA A . n
+A 1 197 THR 197 181 181 THR THR A . n
+A 1 198 MET 198 182 182 MET MET A . n
+A 1 199 LEU 199 183 183 LEU LEU A . n
+A 1 200 GLY 200 184 184 GLY GLY A . n
+A 1 201 GLY 201 185 185 GLY GLY A . n
+A 1 202 THR 202 186 186 THR THR A . n
+A 1 203 ASP 203 187 187 ASP ASP A . n
+A 1 204 SER 204 188 188 SER SER A . n
+A 1 205 THR 205 189 189 THR THR A . n
+A 1 206 ILE 206 190 190 ILE ILE A . n
+A 1 207 THR 207 191 191 THR THR A . n
+A 1 208 LYS 208 192 192 LYS LYS A . n
+A 1 209 VAL 209 193 193 VAL VAL A . n
+A 1 210 PHE 210 194 194 PHE PHE A . n
+A 1 211 TRP 211 195 195 TRP TRP A . n
+A 1 212 LEU 212 196 196 LEU LEU A . n
+A 1 213 MET 213 197 197 MET MET A . n
+A 1 214 MET 214 198 198 MET MET A . n
+A 1 215 PHE 215 199 199 PHE PHE A . n
+A 1 216 ALA 216 200 200 ALA ALA A . n
+A 1 217 TRP 217 201 201 TRP TRP A . n
+A 1 218 THR 218 202 202 THR THR A . n
+A 1 219 LEU 219 203 203 LEU LEU A . n
+A 1 220 TYR 220 204 204 TYR TYR A . n
+A 1 221 PRO 221 205 205 PRO PRO A . n
+A 1 222 ILE 222 206 206 ILE ILE A . n
+A 1 223 ALA 223 207 207 ALA ALA A . n
+A 1 224 TYR 224 208 208 TYR TYR A . n
+A 1 225 LEU 225 209 209 LEU LEU A . n
+A 1 226 VAL 226 210 210 VAL VAL A . n
+A 1 227 PRO 227 211 211 PRO PRO A . n
+A 1 228 ALA 228 212 212 ALA ALA A . n
+A 1 229 PHE 229 213 213 PHE PHE A . n
+A 1 230 MET 230 214 214 MET MET A . n
+A 1 231 ASN 231 215 215 ASN ASN A . n
+A 1 232 ASN 232 216 216 ASN ASN A . n
+A 1 233 ALA 233 217 217 ALA ALA A . n
+A 1 234 ASP 234 218 218 ASP ASP A . n
+A 1 235 GLY 235 219 219 GLY GLY A . n
+A 1 236 VAL 236 220 220 VAL VAL A . n
+A 1 237 VAL 237 221 221 VAL VAL A . n
+A 1 238 LEU 238 222 222 LEU LEU A . n
+A 1 239 ARG 239 223 223 ARG ARG A . n
+A 1 240 GLN 240 224 224 GLN GLN A . n
+A 1 241 LEU 241 225 225 LEU LEU A . n
+A 1 242 LEU 242 226 226 LEU LEU A . n
+A 1 243 PHE 243 227 227 PHE PHE A . n
+A 1 244 THR 244 228 228 THR THR A . n
+A 1 245 ILE 245 229 229 ILE ILE A . n
+A 1 246 ALA 246 230 230 ALA ALA A . n
+A 1 247 ASP 247 231 231 ASP ASP A . n
+A 1 248 ILE 248 232 232 ILE ILE A . n
+A 1 249 SER 249 233 233 SER SER A . n
+A 1 250 SER 250 234 234 SER SER A . n
+A 1 251 LYS 251 235 235 LYS LYS A . n
+A 1 252 VAL 252 236 236 VAL VAL A . n
+A 1 253 ILE 253 237 237 ILE ILE A . n
+A 1 254 TYR 254 238 238 TYR TYR A . n
+A 1 255 GLY 255 239 239 GLY GLY A . n
+A 1 256 LEU 256 240 240 LEU LEU A . n
+A 1 257 MET 257 241 241 MET MET A . n
+A 1 258 ILE 258 242 242 ILE ILE A . n
+A 1 259 THR 259 243 243 THR THR A . n
+A 1 260 TYR 260 244 244 TYR TYR A . n
+A 1 261 ILE 261 245 245 ILE ILE A . n
+A 1 262 ALA 262 246 246 ALA ALA A . n
+A 1 263 ILE 263 247 247 ILE ILE A . n
+A 1 264 GLN 264 248 248 GLN GLN A . n
+A 1 265 GLN 265 249 249 GLN GLN A . n
+A 1 266 SER 266 250 250 SER SER A . n
+A 1 267 ALA 267 251 251 ALA ALA A . n
+A 1 268 ALA 268 252 252 ALA ALA A . n
+A 1 269 ALA 269 253 253 ALA ALA A . n
+A 1 270 GLY 270 254 254 GLY GLY A . n
+A 1 271 TYR 271 255 255 TYR TYR A . n
+A 1 272 VAL 272 256 256 VAL VAL A . n
+A 1 273 PRO 273 257 257 PRO PRO A . n
+A 1 274 ALA 274 258 258 ALA ALA A . n
+A 1 275 GLN 275 259 259 GLN GLN A . n
+A 1 276 GLN 276 260 260 GLN GLN A . n
+A 1 277 ALA 277 261 261 ALA ALA A . n
+A 1 278 LEU 278 262 262 LEU LEU A . n
+A 1 279 GLY 279 263 263 GLY GLY A . n
+A 1 280 ARG 280 264 264 ARG ARG A . n
+A 1 281 ILE 281 265 265 ILE ILE A . n
+A 1 282 GLY 282 266 ? ? ? A . n
+A 1 283 MET 283 267 ? ? ? A . n
+A 1 284 ASP 284 268 ? ? ? A . n
+A 1 285 SER 285 269 ? ? ? A . n
+A 1 286 LYS 286 270 ? ? ? A . n
+A 1 287 ALA 287 271 ? ? ? A . n
+A 1 288 ALA 288 272 ? ? ? A . n
+A 1 289 LEU 289 273 ? ? ? A . n
+A 1 290 GLU 290 274 ? ? ? A . n
+A 1 291 HIS 291 275 ? ? ? A . n
+A 1 292 HIS 292 276 ? ? ? A . n
+A 1 293 HIS 293 277 ? ? ? A . n
+A 1 294 HIS 294 278 ? ? ? A . n
+A 1 295 HIS 295 279 ? ? ? A . n
+A 1 296 HIS 296 280 ? ? ? A . n
+#
+loop_
+_pdbx_nonpoly_scheme.asym_id
+_pdbx_nonpoly_scheme.entity_id
+_pdbx_nonpoly_scheme.mon_id
+_pdbx_nonpoly_scheme.ndb_seq_num
+_pdbx_nonpoly_scheme.pdb_seq_num
+_pdbx_nonpoly_scheme.auth_seq_num
+_pdbx_nonpoly_scheme.pdb_mon_id
+_pdbx_nonpoly_scheme.auth_mon_id
+_pdbx_nonpoly_scheme.pdb_strand_id
+_pdbx_nonpoly_scheme.pdb_ins_code
+B 2 RET 1 301 301 RET RET A .
+C 3 CL 1 302 1 CL CL A .
+D 3 CL 1 303 2 CL CL A .
+E 4 OLA 1 304 1 OLA OLA A .
+F 4 OLA 1 305 2 OLA OLA A .
+G 4 OLA 1 306 3 OLA OLA A .
+H 4 OLA 1 307 4 OLA OLA A .
+I 4 OLA 1 308 5 OLA OLA A .
+J 4 OLA 1 309 6 OLA OLA A .
+K 4 OLA 1 310 7 OLA OLA A .
+L 4 OLA 1 311 8 OLA OLA A .
+M 4 OLA 1 312 9 OLA OLA A .
+N 4 OLA 1 313 10 OLA OLA A .
+O 4 OLA 1 314 11 OLA OLA A .
+P 5 HOH 1 401 1 HOH HOH A .
+P 5 HOH 2 402 3 HOH HOH A .
+P 5 HOH 3 403 47 HOH HOH A .
+P 5 HOH 4 404 49 HOH HOH A .
+P 5 HOH 5 405 8 HOH HOH A .
+P 5 HOH 6 406 56 HOH HOH A .
+P 5 HOH 7 407 26 HOH HOH A .
+P 5 HOH 8 408 22 HOH HOH A .
+P 5 HOH 9 409 30 HOH HOH A .
+P 5 HOH 10 410 50 HOH HOH A .
+P 5 HOH 11 411 25 HOH HOH A .
+P 5 HOH 12 412 33 HOH HOH A .
+P 5 HOH 13 413 58 HOH HOH A .
+P 5 HOH 14 414 16 HOH HOH A .
+P 5 HOH 15 415 46 HOH HOH A .
+P 5 HOH 16 416 28 HOH HOH A .
+P 5 HOH 17 417 55 HOH HOH A .
+P 5 HOH 18 418 9 HOH HOH A .
+P 5 HOH 19 419 21 HOH HOH A .
+P 5 HOH 20 420 54 HOH HOH A .
+P 5 HOH 21 421 42 HOH HOH A .
+P 5 HOH 22 422 5 HOH HOH A .
+P 5 HOH 23 423 13 HOH HOH A .
+P 5 HOH 24 424 84 HOH HOH A .
+P 5 HOH 25 425 11 HOH HOH A .
+P 5 HOH 26 426 6 HOH HOH A .
+P 5 HOH 27 427 39 HOH HOH A .
+P 5 HOH 28 428 32 HOH HOH A .
+P 5 HOH 29 429 18 HOH HOH A .
+P 5 HOH 30 430 64 HOH HOH A .
+P 5 HOH 31 431 48 HOH HOH A .
+P 5 HOH 32 432 36 HOH HOH A .
+P 5 HOH 33 433 53 HOH HOH A .
+P 5 HOH 34 434 7 HOH HOH A .
+P 5 HOH 35 435 24 HOH HOH A .
+P 5 HOH 36 436 81 HOH HOH A .
+P 5 HOH 37 437 20 HOH HOH A .
+P 5 HOH 38 438 37 HOH HOH A .
+P 5 HOH 39 439 19 HOH HOH A .
+P 5 HOH 40 440 44 HOH HOH A .
+P 5 HOH 41 441 67 HOH HOH A .
+P 5 HOH 42 442 80 HOH HOH A .
+P 5 HOH 43 443 10 HOH HOH A .
+P 5 HOH 44 444 59 HOH HOH A .
+P 5 HOH 45 445 12 HOH HOH A .
+P 5 HOH 46 446 68 HOH HOH A .
+P 5 HOH 47 447 15 HOH HOH A .
+P 5 HOH 48 448 2 HOH HOH A .
+P 5 HOH 49 449 65 HOH HOH A .
+P 5 HOH 50 450 72 HOH HOH A .
+P 5 HOH 51 451 27 HOH HOH A .
+P 5 HOH 52 452 66 HOH HOH A .
+P 5 HOH 53 453 60 HOH HOH A .
+P 5 HOH 54 454 57 HOH HOH A .
+P 5 HOH 55 455 38 HOH HOH A .
+P 5 HOH 56 456 45 HOH HOH A .
+P 5 HOH 57 457 14 HOH HOH A .
+P 5 HOH 58 458 79 HOH HOH A .
+P 5 HOH 59 459 71 HOH HOH A .
+P 5 HOH 60 460 78 HOH HOH A .
+P 5 HOH 61 461 40 HOH HOH A .
+P 5 HOH 62 462 41 HOH HOH A .
+P 5 HOH 63 463 29 HOH HOH A .
+P 5 HOH 64 464 23 HOH HOH A .
+P 5 HOH 65 465 4 HOH HOH A .
+P 5 HOH 66 466 70 HOH HOH A .
+P 5 HOH 67 467 34 HOH HOH A .
+P 5 HOH 68 468 35 HOH HOH A .
+P 5 HOH 69 469 62 HOH HOH A .
+P 5 HOH 70 470 73 HOH HOH A .
+P 5 HOH 71 471 31 HOH HOH A .
+P 5 HOH 72 472 83 HOH HOH A .
+P 5 HOH 73 473 75 HOH HOH A .
+P 5 HOH 74 474 17 HOH HOH A .
+P 5 HOH 75 475 63 HOH HOH A .
+P 5 HOH 76 476 51 HOH HOH A .
+P 5 HOH 77 477 85 HOH HOH A .
+P 5 HOH 78 478 61 HOH HOH A .
+P 5 HOH 79 479 77 HOH HOH A .
+P 5 HOH 80 480 52 HOH HOH A .
+P 5 HOH 81 481 74 HOH HOH A .
+P 5 HOH 82 482 43 HOH HOH A .
+P 5 HOH 83 483 69 HOH HOH A .
+P 5 HOH 84 484 76 HOH HOH A .
+P 5 HOH 85 485 82 HOH HOH A .
+#
+_pdbx_struct_assembly.id 1
+_pdbx_struct_assembly.details author_and_software_defined_assembly
+_pdbx_struct_assembly.method_details PISA
+_pdbx_struct_assembly.oligomeric_details monomeric
+_pdbx_struct_assembly.oligomeric_count 1
+#
+_pdbx_struct_assembly_gen.assembly_id 1
+_pdbx_struct_assembly_gen.oper_expression 1
+_pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P
+#
+loop_
+_pdbx_struct_assembly_prop.biol_id
+_pdbx_struct_assembly_prop.type
+_pdbx_struct_assembly_prop.value
+_pdbx_struct_assembly_prop.details
+1 'ABSA (A^2)' 3990 ?
+1 MORE -8 ?
+1 'SSA (A^2)' 12280 ?
+#
+_pdbx_struct_oper_list.id 1
+_pdbx_struct_oper_list.type 'identity operation'
+_pdbx_struct_oper_list.name 1_555
+_pdbx_struct_oper_list.symmetry_operation x,y,z
+_pdbx_struct_oper_list.matrix[1][1] 1.0000000000
+_pdbx_struct_oper_list.matrix[1][2] 0.0000000000
+_pdbx_struct_oper_list.matrix[1][3] 0.0000000000
+_pdbx_struct_oper_list.vector[1] 0.0000000000
+_pdbx_struct_oper_list.matrix[2][1] 0.0000000000
+_pdbx_struct_oper_list.matrix[2][2] 1.0000000000
+_pdbx_struct_oper_list.matrix[2][3] 0.0000000000
+_pdbx_struct_oper_list.vector[2] 0.0000000000
+_pdbx_struct_oper_list.matrix[3][1] 0.0000000000
+_pdbx_struct_oper_list.matrix[3][2] 0.0000000000
+_pdbx_struct_oper_list.matrix[3][3] 1.0000000000
+_pdbx_struct_oper_list.vector[3] 0.0000000000
+#
+_pdbx_audit_revision_history.ordinal 1
+_pdbx_audit_revision_history.data_content_type 'Structure model'
+_pdbx_audit_revision_history.major_revision 1
+_pdbx_audit_revision_history.minor_revision 0
+_pdbx_audit_revision_history.revision_date 2020-03-04
+#
+_pdbx_audit_revision_details.ordinal 1
+_pdbx_audit_revision_details.revision_ordinal 1
+_pdbx_audit_revision_details.data_content_type 'Structure model'
+_pdbx_audit_revision_details.provider repository
+_pdbx_audit_revision_details.type 'Initial release'
+_pdbx_audit_revision_details.description ?
+_pdbx_audit_revision_details.details ?
+#
+loop_
+_software.citation_id
+_software.classification
+_software.compiler_name
+_software.compiler_version
+_software.contact_author
+_software.contact_author_email
+_software.date
+_software.description
+_software.dependencies
+_software.hardware
+_software.language
+_software.location
+_software.mods
+_software.name
+_software.os
+_software.os_version
+_software.type
+_software.version
+_software.pdbx_ordinal
+? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? dev_1839 1
+? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2
+? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3
+? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4
+#
+_pdbx_validate_close_contact.id 1
+_pdbx_validate_close_contact.PDB_model_num 1
+_pdbx_validate_close_contact.auth_atom_id_1 O
+_pdbx_validate_close_contact.auth_asym_id_1 A
+_pdbx_validate_close_contact.auth_comp_id_1 HOH
+_pdbx_validate_close_contact.auth_seq_id_1 401
+_pdbx_validate_close_contact.PDB_ins_code_1 ?
+_pdbx_validate_close_contact.label_alt_id_1 ?
+_pdbx_validate_close_contact.auth_atom_id_2 O
+_pdbx_validate_close_contact.auth_asym_id_2 A
+_pdbx_validate_close_contact.auth_comp_id_2 HOH
+_pdbx_validate_close_contact.auth_seq_id_2 451
+_pdbx_validate_close_contact.PDB_ins_code_2 ?
+_pdbx_validate_close_contact.label_alt_id_2 ?
+_pdbx_validate_close_contact.dist 2.06
+#
+_pdbx_validate_symm_contact.id 1
+_pdbx_validate_symm_contact.PDB_model_num 1
+_pdbx_validate_symm_contact.auth_atom_id_1 O
+_pdbx_validate_symm_contact.auth_asym_id_1 A
+_pdbx_validate_symm_contact.auth_comp_id_1 HOH
+_pdbx_validate_symm_contact.auth_seq_id_1 407
+_pdbx_validate_symm_contact.PDB_ins_code_1 ?
+_pdbx_validate_symm_contact.label_alt_id_1 ?
+_pdbx_validate_symm_contact.site_symmetry_1 1_555
+_pdbx_validate_symm_contact.auth_atom_id_2 O
+_pdbx_validate_symm_contact.auth_asym_id_2 A
+_pdbx_validate_symm_contact.auth_comp_id_2 HOH
+_pdbx_validate_symm_contact.auth_seq_id_2 432
+_pdbx_validate_symm_contact.PDB_ins_code_2 ?
+_pdbx_validate_symm_contact.label_alt_id_2 ?
+_pdbx_validate_symm_contact.site_symmetry_2 2_556
+_pdbx_validate_symm_contact.dist 2.18
+#
+loop_
+_pdbx_validate_torsion.id
+_pdbx_validate_torsion.PDB_model_num
+_pdbx_validate_torsion.auth_comp_id
+_pdbx_validate_torsion.auth_asym_id
+_pdbx_validate_torsion.auth_seq_id
+_pdbx_validate_torsion.PDB_ins_code
+_pdbx_validate_torsion.label_alt_id
+_pdbx_validate_torsion.phi
+_pdbx_validate_torsion.psi
+1 1 GLN A 86 ? ? -103.24 -127.20
+2 1 MET A 214 ? ? -152.50 72.72
+#
+loop_
+_pdbx_unobs_or_zero_occ_atoms.id
+_pdbx_unobs_or_zero_occ_atoms.PDB_model_num
+_pdbx_unobs_or_zero_occ_atoms.polymer_flag
+_pdbx_unobs_or_zero_occ_atoms.occupancy_flag
+_pdbx_unobs_or_zero_occ_atoms.auth_asym_id
+_pdbx_unobs_or_zero_occ_atoms.auth_comp_id
+_pdbx_unobs_or_zero_occ_atoms.auth_seq_id
+_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code
+_pdbx_unobs_or_zero_occ_atoms.auth_atom_id
+_pdbx_unobs_or_zero_occ_atoms.label_alt_id
+_pdbx_unobs_or_zero_occ_atoms.label_asym_id
+_pdbx_unobs_or_zero_occ_atoms.label_comp_id
+_pdbx_unobs_or_zero_occ_atoms.label_seq_id
+_pdbx_unobs_or_zero_occ_atoms.label_atom_id
+1 1 N 1 A OLA 304 ? C13 ? E OLA 1 C13
+2 1 N 1 A OLA 304 ? C14 ? E OLA 1 C14
+3 1 N 1 A OLA 304 ? C15 ? E OLA 1 C15
+4 1 N 1 A OLA 304 ? C16 ? E OLA 1 C16
+5 1 N 1 A OLA 304 ? C17 ? E OLA 1 C17
+6 1 N 1 A OLA 304 ? C18 ? E OLA 1 C18
+7 1 N 1 A OLA 306 ? C17 ? G OLA 1 C17
+8 1 N 1 A OLA 306 ? C18 ? G OLA 1 C18
+9 1 N 1 A OLA 307 ? C9 ? H OLA 1 C9
+10 1 N 1 A OLA 307 ? C10 ? H OLA 1 C10
+11 1 N 1 A OLA 307 ? C11 ? H OLA 1 C11
+12 1 N 1 A OLA 307 ? C12 ? H OLA 1 C12
+13 1 N 1 A OLA 307 ? C13 ? H OLA 1 C13
+14 1 N 1 A OLA 307 ? C14 ? H OLA 1 C14
+15 1 N 1 A OLA 307 ? C15 ? H OLA 1 C15
+16 1 N 1 A OLA 307 ? C16 ? H OLA 1 C16
+17 1 N 1 A OLA 307 ? C17 ? H OLA 1 C17
+18 1 N 1 A OLA 307 ? C18 ? H OLA 1 C18
+19 1 N 1 A OLA 308 ? C11 ? I OLA 1 C11
+20 1 N 1 A OLA 308 ? C12 ? I OLA 1 C12
+21 1 N 1 A OLA 308 ? C13 ? I OLA 1 C13
+22 1 N 1 A OLA 308 ? C14 ? I OLA 1 C14
+23 1 N 1 A OLA 308 ? C15 ? I OLA 1 C15
+24 1 N 1 A OLA 308 ? C16 ? I OLA 1 C16
+25 1 N 1 A OLA 308 ? C17 ? I OLA 1 C17
+26 1 N 1 A OLA 308 ? C18 ? I OLA 1 C18
+27 1 N 1 A OLA 309 ? C1 ? J OLA 1 C1
+28 1 N 1 A OLA 309 ? O1 ? J OLA 1 O1
+29 1 N 1 A OLA 309 ? O2 ? J OLA 1 O2
+30 1 N 1 A OLA 309 ? C2 ? J OLA 1 C2
+31 1 N 1 A OLA 309 ? C3 ? J OLA 1 C3
+32 1 N 1 A OLA 309 ? C4 ? J OLA 1 C4
+33 1 N 1 A OLA 309 ? C5 ? J OLA 1 C5
+34 1 N 1 A OLA 309 ? C6 ? J OLA 1 C6
+35 1 N 1 A OLA 309 ? C7 ? J OLA 1 C7
+36 1 N 1 A OLA 309 ? C8 ? J OLA 1 C8
+37 1 N 1 A OLA 310 ? O1 ? K OLA 1 O1
+38 1 N 1 A OLA 310 ? O2 ? K OLA 1 O2
+39 1 N 1 A OLA 310 ? C7 ? K OLA 1 C7
+40 1 N 1 A OLA 310 ? C8 ? K OLA 1 C8
+41 1 N 1 A OLA 310 ? C9 ? K OLA 1 C9
+42 1 N 1 A OLA 310 ? C10 ? K OLA 1 C10
+43 1 N 1 A OLA 310 ? C11 ? K OLA 1 C11
+44 1 N 1 A OLA 310 ? C12 ? K OLA 1 C12
+45 1 N 1 A OLA 310 ? C13 ? K OLA 1 C13
+46 1 N 1 A OLA 310 ? C14 ? K OLA 1 C14
+47 1 N 1 A OLA 310 ? C15 ? K OLA 1 C15
+48 1 N 1 A OLA 310 ? C16 ? K OLA 1 C16
+49 1 N 1 A OLA 310 ? C17 ? K OLA 1 C17
+50 1 N 1 A OLA 310 ? C18 ? K OLA 1 C18
+51 1 N 1 A OLA 311 ? O1 ? L OLA 1 O1
+52 1 N 1 A OLA 311 ? O2 ? L OLA 1 O2
+53 1 N 1 A OLA 311 ? C10 ? L OLA 1 C10
+54 1 N 1 A OLA 311 ? C11 ? L OLA 1 C11
+55 1 N 1 A OLA 311 ? C12 ? L OLA 1 C12
+56 1 N 1 A OLA 311 ? C13 ? L OLA 1 C13
+57 1 N 1 A OLA 311 ? C14 ? L OLA 1 C14
+58 1 N 1 A OLA 311 ? C15 ? L OLA 1 C15
+59 1 N 1 A OLA 311 ? C16 ? L OLA 1 C16
+60 1 N 1 A OLA 311 ? C17 ? L OLA 1 C17
+61 1 N 1 A OLA 311 ? C18 ? L OLA 1 C18
+62 1 N 1 A OLA 312 ? C8 ? M OLA 1 C8
+63 1 N 1 A OLA 312 ? C9 ? M OLA 1 C9
+64 1 N 1 A OLA 312 ? C10 ? M OLA 1 C10
+65 1 N 1 A OLA 312 ? C11 ? M OLA 1 C11
+66 1 N 1 A OLA 312 ? C12 ? M OLA 1 C12
+67 1 N 1 A OLA 312 ? C13 ? M OLA 1 C13
+68 1 N 1 A OLA 312 ? C14 ? M OLA 1 C14
+69 1 N 1 A OLA 312 ? C15 ? M OLA 1 C15
+70 1 N 1 A OLA 312 ? C16 ? M OLA 1 C16
+71 1 N 1 A OLA 312 ? C17 ? M OLA 1 C17
+72 1 N 1 A OLA 312 ? C18 ? M OLA 1 C18
+73 1 N 1 A OLA 313 ? C8 ? N OLA 1 C8
+74 1 N 1 A OLA 313 ? C9 ? N OLA 1 C9
+75 1 N 1 A OLA 313 ? C10 ? N OLA 1 C10
+76 1 N 1 A OLA 313 ? C11 ? N OLA 1 C11
+77 1 N 1 A OLA 313 ? C12 ? N OLA 1 C12
+78 1 N 1 A OLA 313 ? C13 ? N OLA 1 C13
+79 1 N 1 A OLA 313 ? C14 ? N OLA 1 C14
+80 1 N 1 A OLA 313 ? C15 ? N OLA 1 C15
+81 1 N 1 A OLA 313 ? C16 ? N OLA 1 C16
+82 1 N 1 A OLA 313 ? C17 ? N OLA 1 C17
+83 1 N 1 A OLA 313 ? C18 ? N OLA 1 C18
+84 1 N 1 A OLA 314 ? C1 ? O OLA 1 C1
+85 1 N 1 A OLA 314 ? O1 ? O OLA 1 O1
+86 1 N 1 A OLA 314 ? O2 ? O OLA 1 O2
+87 1 N 1 A OLA 314 ? C2 ? O OLA 1 C2
+88 1 N 1 A OLA 314 ? C3 ? O OLA 1 C3
+89 1 N 1 A OLA 314 ? C4 ? O OLA 1 C4
+90 1 N 1 A OLA 314 ? C5 ? O OLA 1 C5
+91 1 N 1 A OLA 314 ? C6 ? O OLA 1 C6
+92 1 N 1 A OLA 314 ? C7 ? O OLA 1 C7
+#
+loop_
+_pdbx_unobs_or_zero_occ_residues.id
+_pdbx_unobs_or_zero_occ_residues.PDB_model_num
+_pdbx_unobs_or_zero_occ_residues.polymer_flag
+_pdbx_unobs_or_zero_occ_residues.occupancy_flag
+_pdbx_unobs_or_zero_occ_residues.auth_asym_id
+_pdbx_unobs_or_zero_occ_residues.auth_comp_id
+_pdbx_unobs_or_zero_occ_residues.auth_seq_id
+_pdbx_unobs_or_zero_occ_residues.PDB_ins_code
+_pdbx_unobs_or_zero_occ_residues.label_asym_id
+_pdbx_unobs_or_zero_occ_residues.label_comp_id
+_pdbx_unobs_or_zero_occ_residues.label_seq_id
+1 1 Y 1 A MET -15 ? A MET 1
+2 1 Y 1 A ALA -14 ? A ALA 2
+3 1 Y 1 A SER -13 ? A SER 3
+4 1 Y 1 A MET -12 ? A MET 4
+5 1 Y 1 A THR -11 ? A THR 5
+6 1 Y 1 A GLY -10 ? A GLY 6
+7 1 Y 1 A GLY -9 ? A GLY 7
+8 1 Y 1 A GLN -8 ? A GLN 8
+9 1 Y 1 A GLN -7 ? A GLN 9
+10 1 Y 1 A MET -6 ? A MET 10
+11 1 Y 1 A GLY -5 ? A GLY 11
+12 1 Y 1 A ARG -4 ? A ARG 12
+13 1 Y 1 A ASP -3 ? A ASP 13
+14 1 Y 1 A PRO -2 ? A PRO 14
+15 1 Y 1 A ASN -1 ? A ASN 15
+16 1 Y 1 A SER 0 ? A SER 16
+17 1 Y 1 A MET 1 ? A MET 17
+18 1 Y 1 A GLY 266 ? A GLY 282
+19 1 Y 1 A MET 267 ? A MET 283
+20 1 Y 1 A ASP 268 ? A ASP 284
+21 1 Y 1 A SER 269 ? A SER 285
+22 1 Y 1 A LYS 270 ? A LYS 286
+23 1 Y 1 A ALA 271 ? A ALA 287
+24 1 Y 1 A ALA 272 ? A ALA 288
+25 1 Y 1 A LEU 273 ? A LEU 289
+26 1 Y 1 A GLU 274 ? A GLU 290
+27 1 Y 1 A HIS 275 ? A HIS 291
+28 1 Y 1 A HIS 276 ? A HIS 292
+29 1 Y 1 A HIS 277 ? A HIS 293
+30 1 Y 1 A HIS 278 ? A HIS 294
+31 1 Y 1 A HIS 279 ? A HIS 295
+32 1 Y 1 A HIS 280 ? A HIS 296
+#
+loop_
+_pdbx_audit_support.funding_organization
+_pdbx_audit_support.country
+_pdbx_audit_support.grant_number
+_pdbx_audit_support.ordinal
+'National Research Foundation (Korea)' 'Korea, Republic Of' NRF-2017R1A2B2008483 1
+'National Research Foundation (Korea)' 'Korea, Republic Of' NRF-2016R1A6A3A04010213 2
+#
+loop_
+_pdbx_entity_instance_feature.ordinal
+_pdbx_entity_instance_feature.comp_id
+_pdbx_entity_instance_feature.asym_id
+_pdbx_entity_instance_feature.seq_num
+_pdbx_entity_instance_feature.auth_comp_id
+_pdbx_entity_instance_feature.auth_asym_id
+_pdbx_entity_instance_feature.auth_seq_num
+_pdbx_entity_instance_feature.feature_type
+_pdbx_entity_instance_feature.details
+1 CL ? ? CL ? ? 'SUBJECT OF INVESTIGATION' ?
+2 RET ? ? RET ? ? 'SUBJECT OF INVESTIGATION' ?
+#
+loop_
+_pdbx_entity_nonpoly.entity_id
+_pdbx_entity_nonpoly.name
+_pdbx_entity_nonpoly.comp_id
+2 RETINAL RET
+3 'CHLORIDE ION' CL
+4 'OLEIC ACID' OLA
+5 water HOH
+#
+_pdbx_struct_assembly_auth_evidence.id 1
+_pdbx_struct_assembly_auth_evidence.assembly_id 1
+_pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration'
+_pdbx_struct_assembly_auth_evidence.details ?
+#
diff --git a/modules/mol/base/doc/editors.rst b/modules/mol/base/doc/editors.rst
index 2be8e65f6aeadc4fb03c7e043ef82f11dde10ab1..24162f9faf5980fcbab03d0b145fce1d0bd5fa6e 100644
--- a/modules/mol/base/doc/editors.rst
+++ b/modules/mol/base/doc/editors.rst
@@ -192,6 +192,7 @@ The basic functionality of editors is implemented in the EditorBase class.
:returns: :class:`AtomHandle`
.. method:: InsertAltAtom(residue, atom, alt_group)
+ :noindex:
Insert new atom with alternative position indicator
@@ -336,6 +337,7 @@ The basic functionality of editors is implemented in the EditorBase class.
:type new_numbers: :class:`ResNumList`
.. method:: RenumberChain(chain, start, keep_spacing)
+ :noindex:
Renumber residues of the given chain
@@ -409,29 +411,14 @@ Euclidian space.
atoms positions.
:param transform: The transformation to be applied
- :type transform: :class:`geom.Mat4`
-
- .. method:: ApplyTransform(transform)
-
- Apply a transformation to the entity. The transformation is applied to all
- atoms positions.
-
- :param transform: The transformation to be applied
- :type transform: :class:`Transform`
+ :type transform: :class:`geom.Mat4` or :class:`Transform`
.. method:: SetTransform(transform)
Set the entity transformation. See also :meth:`ApplyTransform`
:param transform: The transformation to be applied
- :type transform: :class:`geom.Mat4`
-
- .. method:: SetTransform(transform)
-
- Set the entity transformation. See also :meth:`ApplyTransform`
-
- :param transform: The transformation to be applied
- :type transform: :class:`Transform`
+ :type transform: :class:`geom.Mat4` or :class:`Transform`
.. method:: FixTransform()
@@ -544,6 +531,7 @@ using an :class:`ICSEditor` is undefined and vice versa.
.. method:: SetTorsionAngle(atom1, atom2, atom3, atom4, angle, update_others=True)
+ :noindex:
Set the angles of the given atoms. All connectors at the third atom (A3) will be adjusted accordingly.
If you only want to adjust the bond between A3 and A4, and leave
@@ -587,6 +575,7 @@ using an :class:`ICSEditor` is undefined and vice versa.
.. method:: RotateTorsionAngle(atom1, atom2, atom3, atom4, angle, update_others=True)
+ :noindex:
Rotate torsion angle
diff --git a/modules/mol/base/doc/entity.rst b/modules/mol/base/doc/entity.rst
index 795c9b7c2674fd0bb1835a08186fe407bca947ce..4238bfbce5e930c14ac18a1374eb75aeddaba71a 100644
--- a/modules/mol/base/doc/entity.rst
+++ b/modules/mol/base/doc/entity.rst
@@ -8,6 +8,10 @@ This document describes the :class:`EntityHandle` and the related classes.
The Handle Classes
--------------------------------------------------------------------------------
+:class:`Entity <EntityHandle>`, :class:`residue <ResidueHandle>`,
+:class:`atom <AtomHandle>` and :class:`bond <BondHandle>` handles can store
+arbitrary :doc:`generic properties <../../base/generic>`.
+
.. function:: CreateEntity()
Creates a new entity. The created entity is empty, that is, it does not
@@ -15,7 +19,10 @@ The Handle Classes
entity, use an :doc:`entity editor <editors>`.
:returns: The newly created :class:`EntityHandle`
-
+
+Entity Handle
+^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
+
.. class:: EntityHandle
The entity class represents a molecular structure. Such a structure is in
@@ -27,6 +34,10 @@ The Handle Classes
represent a ligand or a collection of water molecules - hence the rather
generic name.
+ .. attribute:: properties
+
+ All the :class:`generic properties <ost.GenericPropContainer>` are available.
+
.. attribute:: chains
List of all chains of this entity. The chains are in the same
@@ -338,11 +349,18 @@ The Handle Classes
.. method:: IsValid()
See :attr:`valid`
-
+
+Chain Handle
+^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
+
.. class:: ChainHandle
A chain of one or more :class:`residues <ResidueHandle>`. Chains are always
- part of an entity.
+ part of an entity (see :ref:`note on memory management <memory_management>`).
+
+ .. attribute:: properties
+
+ All the :class:`generic properties <ost.GenericPropContainer>` are available.
.. attribute:: atoms
@@ -577,13 +595,21 @@ The Handle Classes
See :attr:`valid`
+Residue Handle
+^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
+
.. class:: ResidueHandle
The residue is either used to represent complete molecules or building blocks
in a polymer, e.g. in a protein, DNA or RNA. A residue consists of one or
more :class:`atoms <AtomHandle>`. Residues are always part of a
:class:`ChainHandle`, even if they are ligands or water molecules where the
- concept of a chain does not apply.
+ concept of a chain does not apply, and of an entity (see
+ :ref:`note on memory management <memory_management>`).
+
+ .. attribute:: properties
+
+ All the :class:`generic properties <ost.GenericPropContainer>` are available.
.. attribute:: name
@@ -1010,11 +1036,18 @@ The Handle Classes
See :attr:`next`
+Atom Handle
+^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
.. class:: AtomHandle
Represents an atom in a molecular structure. Atoms are always part of a
- residue.
+ residue and of an entity (see
+ :ref:`note on memory management <memory_management>`)
+
+ .. attribute:: properties
+
+ All the :class:`generic properties <ost.GenericPropContainer>` are available.
.. attribute:: name
@@ -1251,13 +1284,19 @@ The Handle Classes
See :attr:`valid`
+Bond Handle
+^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
.. class:: BondHandle
Represents a chemical bond between two atoms (first and second).
+ .. attribute:: properties
+
+ All the :class:`generic properties <ost.GenericPropContainer>` are available.
+
.. attribute:: first
- .. attribute:: second
+ second
Atoms involved in the bond. No assumptions about the order should be made.
With the internal coordinate system enabled, first and second may even be
@@ -1354,10 +1393,23 @@ The Handle Classes
The View Classes
--------------------------------------------------------------------------------
+:class:`Entity <EntityView>`, :class:`residue <ResidueView>` and
+:class:`atom <AtomView>` views can store arbitrary
+:doc:`generic properties <../../base/generic>`.
+
+Entity View
+^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
+
.. class:: EntityView
- An entity view represents a structural subset of an :class:`EntityHandle`. For
- an introduction, see :doc:`../../intro-01`.
+ An entity view represents a structural subset of an :class:`EntityHandle` and
+ contains :class:`ChainView`\s, :class:`ResidueView`\s, :class:`AtomView`\s and
+ :class:`BondHandle`\s.
+ For an introduction, see :doc:`../../intro-01`.
+
+ .. attribute:: properties
+
+ All the :class:`generic properties <ost.GenericPropContainer>` are available.
.. attribute:: handle
@@ -1600,11 +1652,24 @@ The View Classes
.. method:: FindResidue(residue)
- Find residue view of pointing to the given handle.
-
+ Deprecated. Use :meth:`ViewForHandle` instead.
+
:param residue: Residue handle
:type residue: ResidueHandle
- :returns: The residue view pointing the the handle, or an invalid handle if the residue is not part of the view
+ :returns: The residue view pointing the handle, or an invalid handle if the residue is not part of the view
+ :rtype: :class:`ResidueView`
+
+ .. method:: FindResidue(chain_name, res_num)
+ :noindex:
+
+ Find residue by chain name and residue number.
+
+ :param chain_name: Chain identifier, e.g. "A"
+ :type chain_name: str
+ :param res_num: residue number
+ :type res_num: :class:`ResNum`
+ :returns: The residue if present in the view, an invalid :class:`ResidueView`
+ otherwise
:rtype: :class:`ResidueView`
.. method:: FindAtom(chain_name, res_num, atom_name)
@@ -1615,8 +1680,40 @@ The View Classes
:type res_num: :class:`ResNum` or :class:`int`
:param atom_name: The name of the atom
:type atom_name: str
+ :returns: The atom if present in the view, an invalid :class:`AtomView`
+ otherwise
:rtype: :class:`AtomView`
+ .. method:: ViewForHandle(handle)
+
+ Find chain view, residue view or atom view of pointing to the given handle.
+
+ :param handle: handle to search for
+ :type residue: (Chain\|Residue\|Atom)Handle
+ :returns: The view pointing the handle, or an invalid handle if the handle
+ is not part of the view
+ :rtype: (Chain\|Residue\|Atom)View
+
+ .. method:: ExtendViewToResidues()
+
+ Extend current view to include all atoms of each residue where
+ at least one atom is selected currently.
+
+ :returns: The extended view
+ :rtype: :class:`EntityView`
+
+ .. method:: ExtendViewToSurrounding(handle)
+
+ Extend current view to include all atoms that are within the sum
+ of their van-der-Waals radius + gap.
+
+ This includes all atoms within: at1.GetRadius() + at2.GetRadius() + gap.
+
+ :param gap: the gap between atoms
+ :type gap: float
+ :returns: The extended view
+ :rtype: :class:`EntityView`
+
.. method:: Select(query, flags=0)
Perform selection on entity view. See :meth:`EntityHandle.Select`.
@@ -1633,10 +1730,16 @@ The View Classes
.. code-block:: python
- the_copy=view.Select(')
+ the_copy = view.Select('')
:rtype: :class:`EntityView`
+ .. method:: Dump()
+
+ Returns a string containing a human-readable summary of the entity view.
+
+ :rtype: :class:`str`
+
.. method:: GetMass()
Get total mass of view.
@@ -1718,11 +1821,18 @@ The View Classes
See :attr:`valid`
+Chain View
+^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
+
.. class:: ChainView
A view representation of a :class:`ChainHandle`. Mostly, the same
functionality is provided as for the handle.
+ .. attribute:: properties
+
+ All the :class:`generic properties <ost.GenericPropContainer>` are available.
+
.. attribute:: handle
The chain handle this view points to. Also available as :meth:`GetHandle`.
@@ -1877,6 +1987,16 @@ The View Classes
:returns: The residue view, or an invalid residue view if no residue with
the given residue number is in the view.
+ .. method:: ViewForHandle(handle)
+
+ Find residue view or atom view of pointing to the given handle.
+
+ :param handle: handle to search for
+ :type residue: (Residue\|Atom)Handle
+ :returns: The view pointing the handle, or an invalid handle if the handle
+ is not part of the view
+ :rtype: (Residue\|Atom)View
+
.. method:: GetCenterOfAtoms()
See :attr:`center_of_atoms`
@@ -1953,11 +2073,18 @@ The View Classes
:type flags: :class:`int` / :class:`QueryFlag`
:rtype: :class:`EntityView`
+Residue View
+^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
+
.. class:: ResidueView
A view representation of a :class:`ResidueHandle`. Mostly, the same
functionality is provided as for the handle.
+ .. attribute:: properties
+
+ All the :class:`generic properties <ost.GenericPropContainer>` are available.
+
.. attribute:: handle
The residue handle this view points to. Also available as
@@ -2036,6 +2163,16 @@ The View Classes
:type atom_view: :class:`AtomView`
:rtype: None
+ .. method:: ViewForHandle(handle)
+
+ Find atom view of pointing to the given handle.
+
+ :param handle: handle to search for
+ :type residue: :class:`AtomHandle`
+ :returns: The view pointing the handle, or an invalid handle if the handle
+ is not part of the view
+ :rtype: :class:`AtomView`
+
.. method:: GetHandle()
See :attr:`handle`
@@ -2126,12 +2263,18 @@ The View Classes
:type flags: :class:`int` / :class:`QueryFlag`
:rtype: :class:`EntityView`
+Atom View
+^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
.. class:: AtomView
A view representation of an :class:`AtomHandle`. Mostly, the same
functionality is provided as for the handle.
+ .. attribute:: properties
+
+ All the :class:`generic properties <ost.GenericPropContainer>` are available.
+
.. attribute:: handle
The underlying :class:`AtomHandle` of the atom view. Also available as
@@ -2201,7 +2344,8 @@ Boolean Operators
Other Entity-Related Functions
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
-.. function:: CreateViewFromAtomList(atom_list)
+.. function:: CreateViewFromAtoms(atom_list)
+ CreateViewFromAtomList(atom_list)
Returns a view made up of the atoms in *atom_list*. All atoms are required to
be atoms of the same entity. Duplicate atoms are only added to the view once.
diff --git a/modules/mol/base/src/atom_base.cc b/modules/mol/base/src/atom_base.cc
index b1547fb518b730f72cfc9d29cd2ab78b833c42aa..24f3bd7d48af88c3c461ed58c0433bd900862e10 100644
--- a/modules/mol/base/src/atom_base.cc
+++ b/modules/mol/base/src/atom_base.cc
@@ -102,9 +102,14 @@ String AtomBase::GetQualifiedName() const
return Impl()->GetQualifiedName();
}
+bool AtomBase::IsValid() const
+{
+ return Impl().get()!=0 && impl_->GetEntity();
+}
+
void AtomBase::CheckValidity() const
{
- if (!impl_)
+ if (! IsValid())
throw InvalidHandle();
}
diff --git a/modules/mol/base/src/atom_base.hh b/modules/mol/base/src/atom_base.hh
index b69c8ceb006736354cc88e644adbc65bfd37f347..b30693b5bd8b164dea6593e1e361588af397b01a 100644
--- a/modules/mol/base/src/atom_base.hh
+++ b/modules/mol/base/src/atom_base.hh
@@ -57,7 +57,7 @@ public:
operator bool() const { return this->IsValid(); }
/// \brief check validity of handle
/// \sa #operator bool()
- bool IsValid() const { return Impl().get()!=0; }
+ bool IsValid() const;
//@}
friend class ConstGenericPropContainer<AtomBase>;
///\brief Get atom name.
diff --git a/modules/mol/base/src/atom_view.cc b/modules/mol/base/src/atom_view.cc
index 5fcb7010abbdf1dd20d31e8f104f26accd0f5f15..084741a596093d600d3b171c4caa35f67103c4c0 100644
--- a/modules/mol/base/src/atom_view.cc
+++ b/modules/mol/base/src/atom_view.cc
@@ -167,6 +167,11 @@ unsigned long AtomView::GetHashCode() const
return reinterpret_cast<unsigned long>(data_.get());
}
+bool AtomView::IsValid() const
+{
+ return Impl().get()!=0 && Impl()->GetEntity();
+}
+
}} // ns
diff --git a/modules/mol/base/src/atom_view.hh b/modules/mol/base/src/atom_view.hh
index 2172453937cddc59c70b4a2439a7129e83d749a2..4dc505c47302dbc3c540f4ff43e0267e57da3df0 100644
--- a/modules/mol/base/src/atom_view.hh
+++ b/modules/mol/base/src/atom_view.hh
@@ -47,7 +47,7 @@ public:
operator bool() const { return this->IsValid(); }
/// \brief check validity of handle
/// \sa #operator bool()
- bool IsValid() const { return data_.get()!=0; }
+ bool IsValid() const;
//@}
// constructors
AtomView();
diff --git a/modules/mol/base/src/chain_base.cc b/modules/mol/base/src/chain_base.cc
index 2b693b7fc031d07bf3da2492a1644db649557b30..db9b1346bece9dd2bdec3c19a585b1df3f6d0937 100644
--- a/modules/mol/base/src/chain_base.cc
+++ b/modules/mol/base/src/chain_base.cc
@@ -52,8 +52,13 @@ String ChainBase::GetDescription() const {
return impl_->GetDescription();
}
+bool ChainBase::IsValid() const
+{
+ return Impl().get()!=0 && impl_->GetEntity();
+}
+
void ChainBase::CheckValidity() const {
- if (!impl_)
+ if (! IsValid())
throw InvalidHandle();
}
diff --git a/modules/mol/base/src/chain_base.hh b/modules/mol/base/src/chain_base.hh
index 0ab82a3dbaf784193d3ba09fe1e687af4f96eaeb..ec02a795f05584435b05644246eef0d043ab0d92 100644
--- a/modules/mol/base/src/chain_base.hh
+++ b/modules/mol/base/src/chain_base.hh
@@ -55,7 +55,7 @@ public:
operator bool() const { return this->IsValid(); }
/// \brief check validity of handle
/// \sa #operator bool()
- bool IsValid() const { return Impl().get()!=0; }
+ bool IsValid() const;
//@}
friend class ConstGenericPropContainer<ChainBase>;
String GetName() const;
diff --git a/modules/mol/base/src/chain_view.cc b/modules/mol/base/src/chain_view.cc
index c8498b1d38099efa32454fb9159fa4a3f2a057a1..f6fad0265b05b85e7948aec558a654c4114777e4 100644
--- a/modules/mol/base/src/chain_view.cc
+++ b/modules/mol/base/src/chain_view.cc
@@ -483,5 +483,11 @@ unsigned long ChainView::GetHashCode() const
return reinterpret_cast<unsigned long>(data_.get());
}
+bool ChainView::IsValid() const
+{
+ return Impl().get()!=0 && Impl()->GetEntity();
+}
+
+
}} // ns
diff --git a/modules/mol/base/src/chain_view.hh b/modules/mol/base/src/chain_view.hh
index 6f2c1a337042d83cb24e85d4c796683a343d6ba2..3adc60e945049d628b51d5b46433323c1a50de2b 100644
--- a/modules/mol/base/src/chain_view.hh
+++ b/modules/mol/base/src/chain_view.hh
@@ -56,7 +56,7 @@ public:
operator bool() const { return this->IsValid(); }
/// \brief check validity of handle
/// \sa #operator bool()
- bool IsValid() const { return data_.get()!=0; }
+ bool IsValid() const;
//@}
/// \brief Get parent entity view
diff --git a/modules/mol/base/src/impl/atom_impl.cc b/modules/mol/base/src/impl/atom_impl.cc
index 9c5642eafc12d70f32be6c47f710f539c908dd9a..46fa1ac642c03f9d92828ae1889d485282b46728 100644
--- a/modules/mol/base/src/impl/atom_impl.cc
+++ b/modules/mol/base/src/impl/atom_impl.cc
@@ -214,6 +214,9 @@ AtomImpl::~AtomImpl() {
EntityImplPtr AtomImpl::GetEntity() const
{
+ if (!res_.lock()) {
+ return EntityImplPtr();
+ }
return res_.lock()->GetEntity();
}
diff --git a/modules/mol/base/src/impl/atom_impl.hh b/modules/mol/base/src/impl/atom_impl.hh
index c229a2d33450be0d00aded37d909ccfe87d49419..658184a4237e1696daf4a6b05d741231b21e3263 100644
--- a/modules/mol/base/src/impl/atom_impl.hh
+++ b/modules/mol/base/src/impl/atom_impl.hh
@@ -116,7 +116,13 @@ public:
{
if (element_!=ele) {
element_=ele;
+ AtomProp* old_prop = prop_;
prop_=impl::AtomProp::GetDefaultProps(element_);
+ if (old_prop && !old_prop->is_default) {
+ if(old_prop->has_anisou) this->SetAnisou(old_prop->anisou);
+ if(old_prop->charge != 0.0) this->SetCharge(old_prop->charge);
+ delete old_prop;
+ }
}
}
bool HasDefaultProps() const { return prop_->is_default; }
diff --git a/modules/mol/base/src/impl/dihedral.cc b/modules/mol/base/src/impl/dihedral.cc
index 2c8c003c43f4fdcb46b357aaad022220d9dd2cbd..ee26230be4e4df8793885f133855051c48e980a9 100644
--- a/modules/mol/base/src/impl/dihedral.cc
+++ b/modules/mol/base/src/impl/dihedral.cc
@@ -125,29 +125,26 @@ void Dihedral::SetAngleICS(Real angle, bool update_other) {
// not all connectors are living in the same coordinate system. We first
// have to bring all of them into the local coordinate system of a3.
if (a2->GetPrimaryConnector() && a2->GetPrimaryConnector()->GetFirst()==a1) {
- // equivalent to geom::Transpose(conn2->GetLocalRot()) * geom::Vec3(0,0,-1)
- v1=geom::Vec3(0, 0,-1)*conn2->GetLocalRot();
- ConnectorImplP c=GetConnector(a4, a3);
- v2=c->GetDir();
- Real phi1 = 0.0;
- if(std::abs(v1[1]) + std::abs(v1[0]) > Real(1e-6)) phi1=atan2(v1[1], v1[0]);
- geom::Vec3 n2=vec_for_angle(v2, angle+phi1);
- c->SetDir(n2);
- // check if we have to update the other connectors
- const ConnectorImplList& sc=a3->GetSecondaryConnectors();
- if (update_other && sc.size()>1) {
- Real phi2=(angle-phi1);
- if(std::abs(v2[1]) + std::abs(v2[0]) > Real(1e-6)) phi2-=atan2(v2[1], v2[0]);
- for (ConnectorImplList::const_iterator i=sc.begin(); i!=sc.end(); ++i) {
- if (*i==c)
- continue;
- v3=(*i)->GetDir();
- Real phi3=phi2;
- if(std::abs(v3[1]) + std::abs(v3[0]) > Real(1e-6)) phi3+=atan2(v3[1], v3[0]);
- geom::Vec3 n=vec_for_angle(v3, phi3);
- (*i)->SetDir(n);
+ v1=geom::Vec3(0, 0,-1)*conn2->GetLocalRot();
+ v2=geom::Vec3(0, 0, 1);
+ ConnectorImplP c=GetConnector(a4, a3);
+ v3=c->GetDir();
+ Real phi1=atan2(v1[1], v1[0]);
+ geom::Vec3 n3=vec_for_angle(v3, angle+phi1);
+ c->SetDir(n3);
+ // check if we have to update the other connectors
+ const ConnectorImplList& sc=a3->GetSecondaryConnectors();
+ if (update_other && sc.size()>1) {
+ Real phi2=(angle-phi1)-atan2(v3[1], v3[0]);
+ for (ConnectorImplList::const_iterator i=sc.begin(); i!=sc.end(); ++i) {
+ if (*i==c)
+ continue;
+ geom::Vec3 v=(*i)->GetDir();
+ Real phi4=phi2+atan2(v[1], v[0]);
+ geom::Vec3 n=vec_for_angle(v, phi4);
+ (*i)->SetDir(n);
+ }
}
- }
}
}
diff --git a/modules/mol/base/src/residue_base.cc b/modules/mol/base/src/residue_base.cc
index b788d7c2ed305e946dadaefd78cdc9c3ca87c4e0..854b4b1aacdb51acbfc0aa7e341bb02acda9d439 100644
--- a/modules/mol/base/src/residue_base.cc
+++ b/modules/mol/base/src/residue_base.cc
@@ -156,9 +156,14 @@ const impl::ResidueImplPtr& ResidueBase::Impl() const
return impl_;
}
+bool ResidueBase::IsValid() const
+{
+ return Impl().get()!=0 && impl_->GetEntity();
+}
+
void ResidueBase::CheckValidity() const
{
- if (!impl_)
+ if (! IsValid())
throw InvalidHandle();
}
diff --git a/modules/mol/base/src/residue_base.hh b/modules/mol/base/src/residue_base.hh
index 0011a962a4162b3a2382b46dcde52d492beb2d71..753fc139eacb259e1918c0afc4ad48c157395a42 100644
--- a/modules/mol/base/src/residue_base.hh
+++ b/modules/mol/base/src/residue_base.hh
@@ -81,7 +81,7 @@ public:
operator bool() const { return this->IsValid(); }
/// \brief check validity of handle
/// \sa #operator bool()
- bool IsValid() const { return Impl().get()!=0; }
+ bool IsValid() const;
friend class ConstGenericPropContainer<ResidueBase>;
/// \brief return residue number
const ResNum& GetNumber() const;
diff --git a/modules/mol/base/src/residue_view.cc b/modules/mol/base/src/residue_view.cc
index 5948a38a479887b76fedc47f85ce76a80951c0f3..2674714a17a2f2f14562e20c3394b74ad41e892b 100644
--- a/modules/mol/base/src/residue_view.cc
+++ b/modules/mol/base/src/residue_view.cc
@@ -291,4 +291,9 @@ unsigned long ResidueView::GetHashCode() const
return reinterpret_cast<unsigned long>(data_.get());
}
+bool ResidueView::IsValid() const
+{
+ return Impl().get()!=0 && Impl()->GetEntity();
+}
+
}} //ns
diff --git a/modules/mol/base/src/residue_view.hh b/modules/mol/base/src/residue_view.hh
index 8268143fa34bdeead462dba753a71c640b83946b..1517622ed6cabca9c812eb7e481699c65e40174a 100644
--- a/modules/mol/base/src/residue_view.hh
+++ b/modules/mol/base/src/residue_view.hh
@@ -65,7 +65,7 @@ public:
operator bool() const { return this->IsValid(); }
/// \brief check validity of handle
/// \sa #operator bool()
- bool IsValid() const { return data_.get()!=0; }
+ bool IsValid() const;
//@}
/// \name internal
diff --git a/modules/mol/base/tests/test_ics.cc b/modules/mol/base/tests/test_ics.cc
index 3a78a1f34fcdcd3bf363825d80ca662245f66517..444424cc092ec004466a0e31a65bfb798e0ca037 100644
--- a/modules/mol/base/tests/test_ics.cc
+++ b/modules/mol/base/tests/test_ics.cc
@@ -194,27 +194,40 @@ BOOST_AUTO_TEST_CASE(ics_settorsion_buffered_update_others)
BOOST_CHECK_CLOSE(s.t2.GetAngle(), Real(M_PI/4), Real(eps));
}
-BOOST_AUTO_TEST_CASE(ics_settorsion_linear_unbuffered)
-{
- Real eps = 0.0001;
- TorsionStructure s;
- ICSEditor e = s.e.EditICS(mol::UNBUFFERED_EDIT);
- e.SetAngle(s.a2,s.a3,s.a4,M_PI);
- BOOST_CHECK_SMALL(s.t1.GetAngle(), eps);
- BOOST_CHECK_SMALL(s.t2.GetAngle(), eps);
- e.SetTorsionAngle(s.t1,0);
- BOOST_CHECK_SMALL(s.t1.GetAngle(), eps);
- BOOST_CHECK_SMALL(s.t2.GetAngle(), eps);
- e.SetTorsionAngle(s.t2,M_PI/4);
- BOOST_CHECK_SMALL(s.t1.GetAngle(), eps);
- BOOST_CHECK_CLOSE(s.t2.GetAngle(), Real(M_PI/4), Real(eps));
- e.SetTorsionAngle(s.t1,-M_PI/4);
- BOOST_CHECK_SMALL(s.t1.GetAngle(), eps);
- BOOST_CHECK_SMALL(s.t2.GetAngle(), eps);
- e.RotateTorsionAngle(s.t1, M_PI/4);
- BOOST_CHECK_SMALL(s.t1.GetAngle(), eps);
- BOOST_CHECK_CLOSE(s.t2.GetAngle(), Real(M_PI/4), Real(eps));
-}
+// This unit test has been observed to fail (EXTREMELY RARELY)
+// It tests the edge case of 3 atoms that are all on a line.
+// From an external coordinate system perspective, the dihedral
+// is not defined in this case.
+// From an internal coordinate perspective this should not matter.
+// The last line is the failing line. The expected behaviour is
+// that a rotation of x around t1 (The "linear" dihedral) should
+// propagate and affect t2 accordingly. Observed failure:
+// difference{4} between s.t2.GetAngle(){-2.3561945} and Real(3.14159265358979323846/4){0.785398185} exceeds 0.0001%
+
+// In the meantime we propose to use internal coordinates with caution and
+// open a task in JIRA for someone brave enough to deep dive into the code.
+
+//BOOST_AUTO_TEST_CASE(ics_settorsion_linear_unbuffered)
+//{
+// Real eps = 0.0001;
+// TorsionStructure s;
+// ICSEditor e = s.e.EditICS(mol::UNBUFFERED_EDIT);
+// e.SetAngle(s.a2,s.a3,s.a4,M_PI);
+// BOOST_CHECK_SMALL(s.t1.GetAngle(), eps);
+// BOOST_CHECK_SMALL(s.t2.GetAngle(), eps);
+// e.SetTorsionAngle(s.t1,0);
+// BOOST_CHECK_SMALL(s.t1.GetAngle(), eps);
+// BOOST_CHECK_SMALL(s.t2.GetAngle(), eps);
+// e.SetTorsionAngle(s.t2,M_PI/4);
+// BOOST_CHECK_SMALL(s.t1.GetAngle(), eps);
+// BOOST_CHECK_CLOSE(s.t2.GetAngle(), Real(M_PI/4), Real(eps));
+// e.SetTorsionAngle(s.t1,-M_PI/4);
+// BOOST_CHECK_SMALL(s.t1.GetAngle(), eps);
+// BOOST_CHECK_SMALL(s.t2.GetAngle(), eps);
+// e.RotateTorsionAngle(s.t1, M_PI/4);
+// BOOST_CHECK_SMALL(s.t1.GetAngle(), eps);
+// BOOST_CHECK_CLOSE(s.t2.GetAngle(), Real(M_PI/4), Real(eps));
+//}
BOOST_AUTO_TEST_CASE(ics_angle_trivia)
{
diff --git a/modules/seq/base/doc/seq.rst b/modules/seq/base/doc/seq.rst
index ab655d11a7b93fae49220fc70ab85c40595f4782..a5ea7ec66f042aad740809ad1c52a318ac5e4ca6 100644
--- a/modules/seq/base/doc/seq.rst
+++ b/modules/seq/base/doc/seq.rst
@@ -83,6 +83,10 @@ The SequenceHandle
ConstSequenceHandle
Represents a sequence. New instances are created with :func:`CreateSequence`.
+
+ .. attribute:: properties
+
+ All the :class:`generic properties <ost.GenericPropContainer>` are available.
.. method:: GetPos(residue_index)
diff --git a/singularity/Singularity b/singularity/Singularity
index 71f2c00fcad8ca8a2be1939865a2e7254ef0b486..03bcc8c398dfbfe4f926c3fd67f22f331c8e0509 100644
--- a/singularity/Singularity
+++ b/singularity/Singularity
@@ -1,5 +1,5 @@
BootStrap: docker
-From: registry.scicore.unibas.ch/schwede/openstructure:2.5.0-jammy
+From: registry.scicore.unibas.ch/schwede/openstructure:2.6.0-jammy
%post
##############################################################################
# POST