From adb141f9ce2eafb7f5e164c053ef64c86e8ad479 Mon Sep 17 00:00:00 2001 From: Gabriel Studer <gabriel.studer@unibas.ch> Date: Wed, 12 Jun 2024 18:44:52 +0200 Subject: [PATCH] enable pairwise sequence alignments with parasail Parasail: https://github.com/jeffdaily/parasail It's faster than the pairwise sequence algorithms we have in OpenStructure. However, the main reason to check out another solution is the fact that OpenStructure may return suboptimal alignment results. This is a result of how the dynamic programming table is built. If for a certain cell in the dynamic programming table a match state and insertion state score equally, match is preferred. There is a chance that we would get a better score later on if we would stick with the insertion state (gap open penalties vs. gap extension penalties). Not sure if this will be fixed in the near future. --- CMakeLists.txt | 13 +- cmake_support/FindParasail.cmake | 11 ++ modules/bindings/doc/bindings.rst | 1 + modules/bindings/doc/parasail.rst | 74 ++++++++ modules/bindings/pymod/CMakeLists.txt | 1 + modules/bindings/pymod/export_parasail.cc | 42 +++++ modules/bindings/pymod/wrap_bindings.cc | 2 + modules/bindings/src/CMakeLists.txt | 8 +- modules/bindings/src/wrap_parasail.cc | 195 ++++++++++++++++++++++ modules/bindings/src/wrap_parasail.hh | 49 ++++++ modules/config/CMakeLists.txt | 5 + modules/config/config.hh.in | 1 + modules/doc/install.rst | 12 ++ 13 files changed, 410 insertions(+), 4 deletions(-) create mode 100644 cmake_support/FindParasail.cmake create mode 100644 modules/bindings/doc/parasail.rst create mode 100644 modules/bindings/pymod/export_parasail.cc create mode 100644 modules/bindings/src/wrap_parasail.cc create mode 100644 modules/bindings/src/wrap_parasail.hh diff --git a/CMakeLists.txt b/CMakeLists.txt index 552aae0c8..c5a7f82a8 100644 --- a/CMakeLists.txt +++ b/CMakeLists.txt @@ -46,6 +46,7 @@ option(ENABLE_STATIC "whether static libraries should be compiled" OFF) option(UBUNTU_LAYOUT "whether Debian/Ubuntu's lib and libexec directory layout should be used" OFF) option(HIDDEN_VISIBILITY "on gcc, use -fvisibility=hidden" OFF) option(ENABLE_MM "whether openmm support is added" OFF) +option(ENABLE_PARASAIL, "whether parasail alignment library should be included" OFF) if (CXX) set(CMAKE_CXX_COMPILER ${CXX}) @@ -130,6 +131,11 @@ if(ENABLE_MM) else() set(_OPENMM OFF) endif() +if(ENABLE_PARASAIL) + set(_PARASAIL ON) +else() + set(_PARASAIL OFF) +endif() if (UBUNTU_LAYOUT) @@ -228,6 +234,10 @@ else(ENABLE_MM) set(_OPENMM_PLUGINS "NONE") endif(ENABLE_MM) +if(ENABLE_PARASAIL) + find_package(Parasail REQUIRED) +endif(ENABLE_PARASAIL) + if (ENABLE_STATIC) set(Boost_LIBRARIES) set(Boost_USE_STATIC_LIBS ON) @@ -290,7 +300,7 @@ include_directories(${Boost_INCLUDE_DIRS} ${PNG_INCLUDE_DIRS} ${OPEN_MM_INCLUDE_DIRS} ${SQLITE3_INCLUDE_DIRS} - ) + ${PARASAIL_INCLUDE_DIR}) if (UNIX) SET(CMAKE_SKIP_BUILD_RPATH FALSE) @@ -342,6 +352,7 @@ message(STATUS " SpaceNav Device support (-DENABLE_SPNAV) : ${_SPNAV}\n" " OpenMM support (-DENABLE_MM) : ${_OPENMM}\n" " OpenMM plugins (-DOPEN_MM_PLUGIN_DIR) : ${_OPENMM_PLUGINS}\n" + " Parasail alignment library (-DENABLE_PARASAIL) : ${_PARASAIL}\n" " Optimize (-DOPTIMIZE) : ${_OPT}\n" " Profiling support (-DPROFILE) : ${_PROFILE}\n" " Double Precision (-DUSE_DOUBLE_PRECISION) : ${_DOUBLE_PREC}\n" diff --git a/cmake_support/FindParasail.cmake b/cmake_support/FindParasail.cmake new file mode 100644 index 000000000..40db27a15 --- /dev/null +++ b/cmake_support/FindParasail.cmake @@ -0,0 +1,11 @@ +# Try to find Parasail +# +# Find the native Parasail include and library. Sets: +# +# PARASAIL_INCLUDE_DIR - Parasail include dir. +# PARASAIL_LIBRARY - Parasail library. + +find_path(PARASAIL_INCLUDE_DIR parasail.h HINTS PARASAIL_INCLUDE_DIR REQUIRED) +find_library(PARASAIL_LIBRARY NAMES parasail HINTS PARASAIL_LIBRARY REQUIRED) + +mark_as_advanced (PARASAIL_LIBRARY PARASAIL_INCLUDE_DIR) diff --git a/modules/bindings/doc/bindings.rst b/modules/bindings/doc/bindings.rst index 06df24a30..9b2106fc6 100644 --- a/modules/bindings/doc/bindings.rst +++ b/modules/bindings/doc/bindings.rst @@ -25,3 +25,4 @@ So far, the binding module includes: lga cadscore dockq + parasail diff --git a/modules/bindings/doc/parasail.rst b/modules/bindings/doc/parasail.rst new file mode 100644 index 000000000..1750163aa --- /dev/null +++ b/modules/bindings/doc/parasail.rst @@ -0,0 +1,74 @@ +Parasail - Pairwise sequence alignments +================================================================================ + +Basic access to pairwise sequence alignment functionality in +`parasail <https://github.com/jeffdaily/parasail/>`_ from +within OpenStructure. + +Citation: + + Jeff Daily. Parasail: SIMD C library for global, semi-global, + and local pairwise sequence alignments. (2016) BMC Bioinformatics + +Parasail support must be enabled at compile time - see installation +instructions. Parasail allows to choose from various strategies but +for the sake of simplicity, this Python binding always calls +``parasail_<mode>_trace_scan_sat`` which seems reasonably fast +across the global, semi-global and local modes. +See parasail documentation for more information. Example usage: + +.. code-block:: python + + from ost import bindings + + print("parasail available?", bindings.ParasailAvailable()) + + s1 = seq.CreateSequence("A", "HEAGAWGHEE") + s2 = seq.CreateSequence("B", "PAWHEA") + + aln = bindings.ParaGlobalAlign(s1, s2, gap_open_penalty=11, + gap_extension_penalty=1, + matrix="blosum62") + + print(aln.ToString()) + + +.. method:: ParasailAvailable() + + returns if OpenStructure has been compiled with parasail support + +.. method:: ParaGlobalAlign(s1, s2, gap_open_penalty=11, \ + gap_extension_penalty=1, matrix="blosum62") + + Calls parasail_nw_trace_scan_sat to perform a Needleman-Wunsch global + alignment. + + :param s1: First sequence + :type s1: :class:`ost.seq.SequenceHandle` + :param s2: Second sequence + :type s2: :class:`ost.seq.SequenceHandle` + :param gap_open_penalty: Gap opening penalty for dynamic programming table + :type gap_open_penalty: :class:`int` + :param gap_extension_penalty: Gap extension penalty for dynamic programming + table + :type gap_extension_penalty: :class:`int` + :param matrix: Substution matrix - Anything that can be resolved by parasail. + E.g. pretty much the full BLOSUM/PAM families of matrices + ("blosum62", "pam100",...) for protein sequences, or + "nuc44"/"dnafull" for nucleotides. + :returns: :class:`ost.seq.AlignmentHandle` + + +.. method:: ParaSemiGlobalAlign(s1, s2, gap_open_penalty=11, \ + gap_extension_penalty=1, matrix="blosum62") + + Same as :meth:`ParaGlobalAlign` but calling parasail_sg_trace_scan_sat to + perform a semi-global alignment. + + +.. method:: ParaLocalAlign(s1, s2, gap_open_penalty=11, \ + gap_extension_penalty=1, matrix="blosum62") + + Same as :meth:`ParaGlobalAlign` but calling parasail_sw_trace_scan_sat to + perform a Smith-Waterman local alignment. The sequences in the returned + alignment might be subsequences of *s1*/*s2* but have offsets set. diff --git a/modules/bindings/pymod/CMakeLists.txt b/modules/bindings/pymod/CMakeLists.txt index 5e3f670ad..afe90d392 100644 --- a/modules/bindings/pymod/CMakeLists.txt +++ b/modules/bindings/pymod/CMakeLists.txt @@ -21,6 +21,7 @@ dockq.py set(OST_BINDINGS_PYMOD_SOURCES export_tmalign.cc + export_parasail.cc wrap_bindings.cc ) diff --git a/modules/bindings/pymod/export_parasail.cc b/modules/bindings/pymod/export_parasail.cc new file mode 100644 index 000000000..ea8a987c2 --- /dev/null +++ b/modules/bindings/pymod/export_parasail.cc @@ -0,0 +1,42 @@ +//------------------------------------------------------------------------------ +// This file is part of the OpenStructure project <www.openstructure.org> +// +// Copyright (C) 2008-2020 by the OpenStructure authors +// +// This library is free software; you can redistribute it and/or modify it under +// the terms of the GNU Lesser General Public License as published by the Free +// Software Foundation; either version 3.0 of the License, or (at your option) +// any later version. +// This library is distributed in the hope that it will be useful, but WITHOUT +// ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS +// FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more +// details. +// +// You should have received a copy of the GNU Lesser General Public License +// along with this library; if not, write to the Free Software Foundation, Inc., +// 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA +//------------------------------------------------------------------------------ + +#include <boost/python.hpp> +#include <ost/bindings/wrap_parasail.hh> +using namespace boost::python; + +void export_parasail() { + + def("ParaLocalAlign", &ost::bindings::ParaLocalAlign, (arg("s1"), arg("s2"), + arg("gap_open_penalty")=11, + arg("gap_extension_penalty")=1, + arg("matrix")="blosum62")); + + def("ParaGlobalAlign", &ost::bindings::ParaGlobalAlign, (arg("s1"), arg("s2"), + arg("gap_open_penalty")=11, + arg("gap_extension_penalty")=1, + arg("matrix")="blosum62")); + + def("ParaSemiGlobalAlign", &ost::bindings::ParaSemiGlobalAlign, (arg("s1"), arg("s2"), + arg("gap_open_penalty")=11, + arg("gap_extension_penalty")=1, + arg("matrix")="blosum62")); + + def("ParasailAvailable", &ost::bindings::ParasailAvailable); +} diff --git a/modules/bindings/pymod/wrap_bindings.cc b/modules/bindings/pymod/wrap_bindings.cc index c60893f21..c41157fc7 100644 --- a/modules/bindings/pymod/wrap_bindings.cc +++ b/modules/bindings/pymod/wrap_bindings.cc @@ -24,8 +24,10 @@ using namespace boost::python; void export_TMAlign(); +void export_parasail(); BOOST_PYTHON_MODULE(_ost_bindings) { export_TMAlign(); + export_parasail(); } diff --git a/modules/bindings/src/CMakeLists.txt b/modules/bindings/src/CMakeLists.txt index 2ae1b882d..fa8e8d396 100644 --- a/modules/bindings/src/CMakeLists.txt +++ b/modules/bindings/src/CMakeLists.txt @@ -5,11 +5,13 @@ if (COMPILE_TMTOOLS) endif() set(OST_BINDINGS_SOURCES -wrap_tmalign.cc) +wrap_tmalign.cc +wrap_parasail.cc) set(OST_BINDINGS_HEADERS -wrap_tmalign.hh) +wrap_tmalign.hh +wrap_parasail.hh) module(NAME bindings SOURCES ${OST_BINDINGS_SOURCES} HEADERS ${OST_BINDINGS_HEADERS} HEADER_OUTPUT_DIR ost/bindings - DEPENDS_ON ost_geom ost_mol ost_seq) + DEPENDS_ON ost_geom ost_mol ost_seq LINK ${PARASAIL_LIBRARY}) diff --git a/modules/bindings/src/wrap_parasail.cc b/modules/bindings/src/wrap_parasail.cc new file mode 100644 index 000000000..34e9fe1ec --- /dev/null +++ b/modules/bindings/src/wrap_parasail.cc @@ -0,0 +1,195 @@ +//------------------------------------------------------------------------------ +// This file is part of the OpenStructure project <www.openstructure.org> +// +// Copyright (C) 2008-2024 by the OpenStructure authors +// +// This library is free software; you can redistribute it and/or modify it under +// the terms of the GNU Lesser General Public License as published by the Free +// Software Foundation; either version 3.0 of the License, or (at your option) +// any later version. +// This library is distributed in the hope that it will be useful, but WITHOUT +// ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS +// FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more +// details. +// +// You should have received a copy of the GNU Lesser General Public License +// along with this library; if not, write to the Free Software Foundation, Inc., +// 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA +//------------------------------------------------------------------------------ + +#include <ost/bindings/wrap_parasail.hh> + +#if OST_PARASAIL_ENABLED + +#include <parasail.h> // include for external parasail + +typedef parasail_result_t* (*parasail_aln_fn)(const char*, int, const char*, + int, int, int, + const parasail_matrix_t *); + +namespace{ + +ost::seq::AlignmentHandle Align(const ost::seq::SequenceHandle& s1, + const ost::seq::SequenceHandle& s2, + int gap_open_penalty, int gap_extension_penalty, + const parasail_matrix_t* matrix, + parasail_aln_fn aln_fn, + bool set_offset) { + + parasail_result_t *r = NULL; + parasail_traceback_t *traceback_r = NULL; + + String s1_str = s1.GetGaplessString(); + String s2_str = s2.GetGaplessString(); + + const char* s1_c_str = s1_str.c_str(); + int s1_len = s1_str.size(); + const char* s2_c_str = s2_str.c_str(); + int s2_len = s2_str.size(); + + r = aln_fn(s1_c_str, s1_len, s2_c_str, s2_len, 11, 1, matrix); + traceback_r = parasail_result_get_traceback(r, s1_c_str, s1_len, + s2_c_str, s2_len, matrix, + '|', ':', '.'); + + ost::seq::AlignmentHandle aln = ost::seq::CreateAlignment(); + ost::seq::SequenceHandle aln_s1 = + ost::seq::CreateSequence(s1.GetName(), String(traceback_r->query)); + + ost::seq::SequenceHandle aln_s2 = + ost::seq::CreateSequence(s2.GetName(), String(traceback_r->ref)); + + if(set_offset) { + + /* + Tried the code below to set offsets but observed wrongly reported + offset which can be triggered from Python: + + from ost import io + from ost import seq + from ost import bindings + + test_seq = seq.CreateSequence("s", "MMDKHKYRVEIQQMMFVSGEINDPPVETTSLIEDIVRGQVIEILLQSNKTAHLRGSRSIL" + "PEDVIFLIRHDKAKVNRLRTYLSWKDLRKNAKDQDASAGVASGTGNPGAGGEDDLKKAGG" + "GEKDEKDGGNMMKVKKSQIKLPWELQFMFNEHPLENNDDNDDMDEDEREANIVTLKRLKM" + "ADDRTRNMTKEEYVHWSDCRQASFTFRKNKRFKDWSGISQLTEGKPHDDVIDILGFLTFE" + "IVCSLTETALKIKQREQVLQTQKDKSQQSSQDNTNFEFASSTLHRKKRLFDGPENVINPL" + "KPRHIEEAWRVLQTIDMRHRALTNFKGGRLSSKPIIM") + + + s = seq.CreateSequence("asdf", "MTKSIYIIIGYMLHDEEFFYFFFISFYTLWIVFFLLHLSFFSTLSFGIFHDFDTDVYIKVGNYIL" + "HFLELSKNSNLLKNSSEMLKHFRLASLMYMYVYTQMICPSLLGIRN") + + + aln = bindings.ParaLocalAlign(test_seq, s) + + print(aln.ToString()) + print(aln.GetSequence(0).offset) + print(aln.GetSequence(1).offset) + + + + + // Not sure if this is the most efficient way to set offsets, + // i.e. the index of start characters which are actually + // present in returned alignments + parasail_cigar_t* cigar = parasail_result_get_cigar(r, s1_c_str, s1_len, + s2_c_str, s2_len, + matrix); + + aln_s1.SetOffset(cigar->beg_query); + aln_s2.SetOffset(cigar->beg_ref); + parasail_cigar_free(cigar); + */ + + // this is far from optimal but doesn't have the issue described above + aln_s1.SetOffset(s1.GetString().find(aln_s1.GetGaplessString())); + aln_s2.SetOffset(s2.GetString().find(aln_s2.GetGaplessString())); + } + aln.AddSequence(aln_s1); + aln.AddSequence(aln_s2); + + parasail_result_free(r); + parasail_traceback_free(traceback_r); + + return aln; +} + +} + +namespace ost{ namespace bindings{ + +ost::seq::AlignmentHandle ParaLocalAlign(const ost::seq::SequenceHandle& s1, + const ost::seq::SequenceHandle& s2, + int gap_open_penalty, + int gap_extension_penalty, + const String& matrix) { + const parasail_matrix_t* m = parasail_matrix_lookup(matrix.c_str()); + return Align(s1, s2, gap_open_penalty, gap_extension_penalty, + m, parasail_sw_trace_scan_sat, true); +} + +ost::seq::AlignmentHandle ParaGlobalAlign(const ost::seq::SequenceHandle& s1, + const ost::seq::SequenceHandle& s2, + int gap_open_penalty, + int gap_extension_penalty, + const String& matrix) { + const parasail_matrix_t* m = parasail_matrix_lookup(matrix.c_str()); + return Align(s1, s2, gap_open_penalty, gap_extension_penalty, + m, parasail_nw_trace_scan_sat, false); +} + +ost::seq::AlignmentHandle ParaSemiGlobalAlign(const ost::seq::SequenceHandle& s1, + const ost::seq::SequenceHandle& s2, + int gap_open_penalty, + int gap_extension_penalty, + const String& matrix) { + const parasail_matrix_t* m = parasail_matrix_lookup(matrix.c_str()); + return Align(s1, s2, gap_open_penalty, gap_extension_penalty, + m, parasail_sg_trace_scan_sat, false); +} + +bool ParasailAvailable() { + return true; +} + +}} // ns + +#else + +namespace ost{ namespace bindings{ + +ost::seq::AlignmentHandle ParaLocalAlign(const ost::seq::SequenceHandle& s1, + const ost::seq::SequenceHandle& s2, + int gap_open_penalty, + int gap_extension_penalty, + const String& matrix) { + throw ost::Error("Must enable Parasail when compiling OpenStructure to use " + "ParaLocalAlign"); +} + +ost::seq::AlignmentHandle ParaGlobalAlign(const ost::seq::SequenceHandle& s1, + const ost::seq::SequenceHandle& s2, + int gap_open_penalty, + int gap_extension_penalty, + const String& matrix) { + throw ost::Error("Must enable Parasail when compiling OpenStructure to use " + "ParaGlobalAlign"); +} + +ost::seq::AlignmentHandle ParaSemiGlobalAlign(const ost::seq::SequenceHandle& s1, + const ost::seq::SequenceHandle& s2, + int gap_open_penalty, + int gap_extension_penalty, + const String& matrix) { + throw ost::Error("Must enable Parasail when compiling OpenStructure to use " + "ParaSemiGlobalAlign"); +} + +bool ParasailAvailable() { + return false; +} + +}} // ns + +#endif diff --git a/modules/bindings/src/wrap_parasail.hh b/modules/bindings/src/wrap_parasail.hh new file mode 100644 index 000000000..785965467 --- /dev/null +++ b/modules/bindings/src/wrap_parasail.hh @@ -0,0 +1,49 @@ +//------------------------------------------------------------------------------ +// This file is part of the OpenStructure project <www.openstructure.org> +// +// Copyright (C) 2008-2024 by the OpenStructure authors +// +// This library is free software; you can redistribute it and/or modify it under +// the terms of the GNU Lesser General Public License as published by the Free +// Software Foundation; either version 3.0 of the License, or (at your option) +// any later version. +// This library is distributed in the hope that it will be useful, but WITHOUT +// ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS +// FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more +// details. +// +// You should have received a copy of the GNU Lesser General Public License +// along with this library; if not, write to the Free Software Foundation, Inc., +// 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA +//------------------------------------------------------------------------------ +#ifndef OST_BINDINGS_PARASAIL_H +#define OST_BINDINGS_PARASAIL_H + +#include <ost/seq/sequence_handle.hh> +#include <ost/seq/alignment_handle.hh> + +namespace ost { namespace bindings { + +ost::seq::AlignmentHandle ParaLocalAlign(const ost::seq::SequenceHandle& s1, + const ost::seq::SequenceHandle& s2, + int gap_open_penalty = 11, + int gap_extension_penalty = 1, + const String& matrix="blosum62"); + +ost::seq::AlignmentHandle ParaGlobalAlign(const ost::seq::SequenceHandle& s1, + const ost::seq::SequenceHandle& s2, + int gap_open_penalty = 11, + int gap_extension_penalty = 1, + const String& matrix="blosum62"); + +ost::seq::AlignmentHandle ParaSemiGlobalAlign(const ost::seq::SequenceHandle& s1, + const ost::seq::SequenceHandle& s2, + int gap_open_penalty = 11, + int gap_extension_penalty = 1, + const String& matrix="blosum62"); + +bool ParasailAvailable(); + +}} //ns + +#endif diff --git a/modules/config/CMakeLists.txt b/modules/config/CMakeLists.txt index 826de455f..91d922320 100644 --- a/modules/config/CMakeLists.txt +++ b/modules/config/CMakeLists.txt @@ -50,6 +50,11 @@ if (ENABLE_INFO) else() set(info_enabled 0) endif() +if (ENABLE_PARASAIL) + set(parasail_enabled 1) +else() + set(parasail_enabled 0) +endif() set(config_hh_generator "CMake") set(CONFIG_HH_FILE "${CMAKE_CURRENT_SOURCE_DIR}/config.hh") diff --git a/modules/config/config.hh.in b/modules/config/config.hh.in index e48f750d4..d84ca3b68 100644 --- a/modules/config/config.hh.in +++ b/modules/config/config.hh.in @@ -31,5 +31,6 @@ #define OST_FFT_USE_THREADS @fftw_use_threads@ #define OST_UBUNTU_LAYOUT @ubuntu_layout@ #define OST_INFO_ENABLED @info_enabled@ +#define OST_PARASAIL_ENABLED @parasail_enabled@ #endif diff --git a/modules/doc/install.rst b/modules/doc/install.rst index 1fc703dd9..42cf59b91 100644 --- a/modules/doc/install.rst +++ b/modules/doc/install.rst @@ -57,6 +57,11 @@ If you would like to use the :mod:`molecular mechanics <ost.mol.mm>` module: * `OpenMM <https://simtk.org/home/openmm>`_ (7.7.0) +If you would like to do pairwise sequence alignments with parasail +in the :mod:`bindings <ost.bindings>` module: + +* `parasail <https://github.com/jeffdaily/parasail/>`_ (2.6.2) + We do not provide backwards compatibility to Python 2.7. The last release supporting Python 2.7 is 1.11.0. @@ -187,6 +192,13 @@ can influence it. * `OPEN_MM_PLUGIN_DIR`: the path for OpenMM plugins * see example below for commonly used paths +* `ENABLE_PARASAIL` controls whether parasail should be enabled. By default, + this is switched off. If it is turned on, you must also set the paths + to your parasail installation: + + * `PARASAIL_INCLUDE_DIR`: the include path containing the file parasail.h + * `PARASAIL_LIBRARY`: the parasail library + * Several paths to other libraries can be set if they are not in the expected locations: -- GitLab