model.pdb 46 KB
Newer Older
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174
175
176
177
178
179
180
181
182
183
184
185
186
187
188
189
190
191
192
193
194
195
196
197
198
199
200
201
202
203
204
205
206
207
208
209
210
211
212
213
214
215
216
217
218
219
220
221
222
223
224
225
226
227
228
229
230
231
232
233
234
235
236
237
238
239
240
241
242
243
244
245
246
247
248
249
250
251
252
253
254
255
256
257
258
259
260
261
262
263
264
265
266
267
268
269
270
271
272
273
274
275
276
277
278
279
280
281
282
283
284
285
286
287
288
289
290
291
292
293
294
295
296
297
298
299
300
301
302
303
304
305
306
307
308
309
310
311
312
313
314
315
316
317
318
319
320
321
322
323
324
325
326
327
328
329
330
331
332
333
334
335
336
337
338
339
340
341
342
343
344
345
346
347
348
349
350
351
352
353
354
355
356
357
358
359
360
361
362
363
364
365
366
367
368
369
370
371
372
373
374
375
376
377
378
379
380
381
382
383
384
385
386
387
388
389
390
391
392
393
394
395
396
397
398
399
400
401
402
403
404
405
406
407
408
409
410
411
412
413
414
415
416
417
418
419
420
421
422
423
424
425
426
427
428
429
430
431
432
433
434
435
436
437
438
439
440
441
442
443
444
445
446
447
448
449
450
451
452
453
454
455
456
457
458
459
460
461
462
463
464
465
466
467
468
469
470
471
472
473
474
475
476
477
478
479
480
481
482
483
484
485
486
487
488
489
490
491
492
493
494
495
496
497
498
499
500
501
502
503
504
505
506
507
508
509
510
511
512
513
514
515
516
517
518
519
520
521
522
523
524
525
526
527
528
529
530
531
532
533
534
535
536
537
538
539
540
541
542
543
544
545
546
547
548
549
550
551
552
553
554
555
556
557
558
559
560
561
562
563
564
565
566
567
568
569
570
571
572
573
574
575
576
577
578
579
580
581
582
583
584
585
586
587
588
589
590
591
592
593
594
595
596
597
598
599
600
601
602
603
604
605
606
607
608
609
610
611
612
613
614
615
616
617
618
619
620
621
622
623
624
625
626
627
628
629
TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 2019-10-12_00000117_1_54
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   12-OCT-19 1MOD    1       11:13
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  22       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   2.0.0
REMARK   3  OSTAT   monomer
REMARK   3  OSRSN   PREDICTION
REMARK   3  QSPRD   0.000
REMARK   3  QMN4    -1.12
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   4b8v
REMARK   3  CHAIN   A
REMARK   3  MMCIF   A
REMARK   3  PDBV    2019-10-04
REMARK   3  SMTLE   4b8v.1.A
REMARK   3  SMTLV   2019-10-09
REMARK   3  MTHD    X-RAY DIFFRACTION 1.59 A
REMARK   3  FOUND   BLAST
REMARK   3  SIM     0.42
REMARK   3  SID     43.48
REMARK   3  OSTAT   monomer
REMARK   3  LIGND   NAG-NAG
REMARK   3  LIGND 2 NAG-NAG
REMARK   3  LIGND 3 NAG
REMARK   3  LIGND 4 NAG
REMARK   3  ALN A TRG ARNPITITPQFDCGATNSQQYVARSGDTLTKIAQEIYHDVVGVCDIARANNLADPNRI
REMARK   3  ALN A TRG DAGTPYTIPINCQTYDRNSCL
REMARK   3  ALN A TPL -------TKATDCGSTSNIKYTVVKGDTLTSIAKKFKS---GICNIVSVNKLANPNLI
REMARK   3  ALN A TPL ELGATLIIPENCSNPDNKSCV
REMARK   3  ALN A OFF 30
ATOM      1  N   CYS A  13      15.366  43.126  11.349  1.00  0.76           N  
ATOM      2  CA  CYS A  13      13.982  42.733  10.896  1.00  0.76           C  
ATOM      3  C   CYS A  13      13.118  43.737  10.134  1.00  0.76           C  
ATOM      4  O   CYS A  13      12.441  43.371   9.184  1.00  0.76           O  
ATOM      5  CB  CYS A  13      13.164  42.176  12.103  1.00  0.76           C  
ATOM      6  SG  CYS A  13      12.300  40.613  11.727  1.00  0.76           S  
ATOM      7  N   GLY A  14      13.040  45.039  10.515  1.00  0.77           N  
ATOM      8  CA  GLY A  14      12.101  45.940   9.823  1.00  0.77           C  
ATOM      9  C   GLY A  14      10.664  45.629  10.155  1.00  0.77           C  
ATOM     10  O   GLY A  14       9.794  45.619   9.290  1.00  0.77           O  
ATOM     11  N   ALA A  15      10.431  45.281  11.429  1.00  0.77           N  
ATOM     12  CA  ALA A  15       9.151  44.921  11.984  1.00  0.77           C  
ATOM     13  C   ALA A  15       8.218  46.101  12.165  1.00  0.77           C  
ATOM     14  O   ALA A  15       8.656  47.236  12.337  1.00  0.77           O  
ATOM     15  CB  ALA A  15       9.381  44.248  13.343  1.00  0.77           C  
ATOM     16  N   THR A  16       6.894  45.862  12.146  1.00  0.68           N  
ATOM     17  CA  THR A  16       5.929  46.953  12.281  1.00  0.68           C  
ATOM     18  C   THR A  16       5.413  47.089  13.699  1.00  0.68           C  
ATOM     19  O   THR A  16       4.728  48.052  14.033  1.00  0.68           O  
ATOM     20  CB  THR A  16       4.735  46.822  11.337  1.00  0.68           C  
ATOM     21  OG1 THR A  16       3.928  45.684  11.614  1.00  0.68           O  
ATOM     22  CG2 THR A  16       5.246  46.662   9.896  1.00  0.68           C  
ATOM     23  N   ASN A  17       5.748  46.122  14.573  1.00  0.68           N  
ATOM     24  CA  ASN A  17       5.410  46.122  15.979  1.00  0.68           C  
ATOM     25  C   ASN A  17       6.245  45.031  16.646  1.00  0.68           C  
ATOM     26  O   ASN A  17       6.881  44.223  15.974  1.00  0.68           O  
ATOM     27  CB  ASN A  17       3.886  45.864  16.182  1.00  0.68           C  
ATOM     28  CG  ASN A  17       3.370  46.403  17.507  1.00  0.68           C  
ATOM     29  OD1 ASN A  17       4.122  46.810  18.390  1.00  0.68           O  
ATOM     30  ND2 ASN A  17       2.029  46.374  17.677  1.00  0.68           N  
ATOM     31  N   SER A  18       6.226  44.953  17.983  1.00  0.74           N  
ATOM     32  CA  SER A  18       6.801  43.839  18.723  1.00  0.74           C  
ATOM     33  C   SER A  18       5.728  43.286  19.627  1.00  0.74           C  
ATOM     34  O   SER A  18       5.033  44.032  20.309  1.00  0.74           O  
ATOM     35  CB  SER A  18       8.003  44.218  19.627  1.00  0.74           C  
ATOM     36  OG  SER A  18       9.170  44.509  18.858  1.00  0.74           O  
ATOM     37  N   GLN A  19       5.554  41.953  19.654  1.00  0.72           N  
ATOM     38  CA  GLN A  19       4.596  41.299  20.530  1.00  0.72           C  
ATOM     39  C   GLN A  19       5.342  40.458  21.544  1.00  0.72           C  
ATOM     40  O   GLN A  19       6.319  39.791  21.216  1.00  0.72           O  
ATOM     41  CB  GLN A  19       3.638  40.341  19.771  1.00  0.72           C  
ATOM     42  CG  GLN A  19       2.720  41.014  18.724  1.00  0.72           C  
ATOM     43  CD  GLN A  19       1.714  41.963  19.376  1.00  0.72           C  
ATOM     44  OE1 GLN A  19       1.030  41.627  20.340  1.00  0.72           O  
ATOM     45  NE2 GLN A  19       1.592  43.192  18.826  1.00  0.72           N  
ATOM     46  N   GLN A  20       4.880  40.438  22.809  1.00  0.75           N  
ATOM     47  CA  GLN A  20       5.361  39.467  23.774  1.00  0.75           C  
ATOM     48  C   GLN A  20       4.514  38.204  23.662  1.00  0.75           C  
ATOM     49  O   GLN A  20       3.299  38.229  23.825  1.00  0.75           O  
ATOM     50  CB  GLN A  20       5.336  39.999  25.229  1.00  0.75           C  
ATOM     51  CG  GLN A  20       6.032  41.370  25.427  1.00  0.75           C  
ATOM     52  CD  GLN A  20       7.483  41.405  24.941  1.00  0.75           C  
ATOM     53  OE1 GLN A  20       7.816  42.120  23.997  1.00  0.75           O  
ATOM     54  NE2 GLN A  20       8.373  40.634  25.604  1.00  0.75           N  
ATOM     55  N   TYR A  21       5.148  37.067  23.340  1.00  0.77           N  
ATOM     56  CA  TYR A  21       4.466  35.837  22.983  1.00  0.77           C  
ATOM     57  C   TYR A  21       4.817  34.734  23.965  1.00  0.77           C  
ATOM     58  O   TYR A  21       5.965  34.583  24.359  1.00  0.77           O  
ATOM     59  CB  TYR A  21       4.886  35.446  21.538  1.00  0.77           C  
ATOM     60  CG  TYR A  21       4.385  34.100  21.093  1.00  0.77           C  
ATOM     61  CD1 TYR A  21       3.041  33.915  20.733  1.00  0.77           C  
ATOM     62  CD2 TYR A  21       5.261  33.001  21.072  1.00  0.77           C  
ATOM     63  CE1 TYR A  21       2.575  32.639  20.384  1.00  0.77           C  
ATOM     64  CE2 TYR A  21       4.789  31.725  20.739  1.00  0.77           C  
ATOM     65  CZ  TYR A  21       3.444  31.541  20.412  1.00  0.77           C  
ATOM     66  OH  TYR A  21       2.952  30.255  20.115  1.00  0.77           O  
ATOM     67  N   VAL A  22       3.829  33.918  24.374  1.00  0.79           N  
ATOM     68  CA  VAL A  22       4.046  32.817  25.303  1.00  0.79           C  
ATOM     69  C   VAL A  22       4.202  31.522  24.537  1.00  0.79           C  
ATOM     70  O   VAL A  22       3.259  31.076  23.887  1.00  0.79           O  
ATOM     71  CB  VAL A  22       2.861  32.651  26.254  1.00  0.79           C  
ATOM     72  CG1 VAL A  22       3.039  31.444  27.202  1.00  0.79           C  
ATOM     73  CG2 VAL A  22       2.671  33.939  27.074  1.00  0.79           C  
ATOM     74  N   ALA A  23       5.383  30.873  24.618  1.00  0.79           N  
ATOM     75  CA  ALA A  23       5.629  29.603  23.957  1.00  0.79           C  
ATOM     76  C   ALA A  23       4.715  28.465  24.421  1.00  0.79           C  
ATOM     77  O   ALA A  23       4.530  28.231  25.618  1.00  0.79           O  
ATOM     78  CB  ALA A  23       7.103  29.192  24.146  1.00  0.79           C  
ATOM     79  N   ARG A  24       4.127  27.720  23.467  1.00  0.67           N  
ATOM     80  CA  ARG A  24       3.151  26.680  23.735  1.00  0.67           C  
ATOM     81  C   ARG A  24       3.549  25.350  23.106  1.00  0.67           C  
ATOM     82  O   ARG A  24       4.586  25.193  22.467  1.00  0.67           O  
ATOM     83  CB  ARG A  24       1.727  27.094  23.260  1.00  0.67           C  
ATOM     84  CG  ARG A  24       1.134  28.269  24.068  1.00  0.67           C  
ATOM     85  CD  ARG A  24      -0.309  28.622  23.693  1.00  0.67           C  
ATOM     86  NE  ARG A  24      -0.727  29.746  24.594  1.00  0.67           N  
ATOM     87  CZ  ARG A  24      -1.954  30.284  24.602  1.00  0.67           C  
ATOM     88  NH1 ARG A  24      -2.227  31.286  25.436  1.00  0.67           N  
ATOM     89  NH2 ARG A  24      -2.913  29.840  23.796  1.00  0.67           N  
ATOM     90  N   SER A  25       2.740  24.293  23.341  1.00  0.71           N  
ATOM     91  CA  SER A  25       2.994  22.964  22.796  1.00  0.71           C  
ATOM     92  C   SER A  25       3.033  22.932  21.274  1.00  0.71           C  
ATOM     93  O   SER A  25       2.109  23.372  20.596  1.00  0.71           O  
ATOM     94  CB  SER A  25       1.925  21.943  23.266  1.00  0.71           C  
ATOM     95  OG  SER A  25       2.274  20.601  22.919  1.00  0.71           O  
ATOM     96  N   GLY A  26       4.128  22.387  20.708  1.00  0.76           N  
ATOM     97  CA  GLY A  26       4.313  22.236  19.273  1.00  0.76           C  
ATOM     98  C   GLY A  26       5.070  23.349  18.610  1.00  0.76           C  
ATOM     99  O   GLY A  26       5.424  23.203  17.436  1.00  0.76           O  
ATOM    100  N   ASP A  27       5.349  24.449  19.339  1.00  0.76           N  
ATOM    101  CA  ASP A  27       6.158  25.565  18.893  1.00  0.76           C  
ATOM    102  C   ASP A  27       7.607  25.210  18.558  1.00  0.76           C  
ATOM    103  O   ASP A  27       8.263  24.372  19.172  1.00  0.76           O  
ATOM    104  CB  ASP A  27       6.157  26.732  19.923  1.00  0.76           C  
ATOM    105  CG  ASP A  27       4.866  27.530  19.918  1.00  0.76           C  
ATOM    106  OD1 ASP A  27       4.040  27.353  18.996  1.00  0.76           O  
ATOM    107  OD2 ASP A  27       4.721  28.389  20.832  1.00  0.76           O  
ATOM    108  N   THR A  28       8.147  25.901  17.544  1.00  0.75           N  
ATOM    109  CA  THR A  28       9.568  25.965  17.245  1.00  0.75           C  
ATOM    110  C   THR A  28       9.762  27.391  16.820  1.00  0.75           C  
ATOM    111  O   THR A  28       8.791  28.053  16.456  1.00  0.75           O  
ATOM    112  CB  THR A  28      10.086  25.044  16.127  1.00  0.75           C  
ATOM    113  OG1 THR A  28       9.432  25.246  14.875  1.00  0.75           O  
ATOM    114  CG2 THR A  28       9.876  23.575  16.514  1.00  0.75           C  
ATOM    115  N   LEU A  29      11.004  27.926  16.807  1.00  0.74           N  
ATOM    116  CA  LEU A  29      11.231  29.254  16.254  1.00  0.74           C  
ATOM    117  C   LEU A  29      10.805  29.360  14.803  1.00  0.74           C  
ATOM    118  O   LEU A  29      10.252  30.375  14.407  1.00  0.74           O  
ATOM    119  CB  LEU A  29      12.687  29.751  16.396  1.00  0.74           C  
ATOM    120  CG  LEU A  29      13.110  30.114  17.833  1.00  0.74           C  
ATOM    121  CD1 LEU A  29      14.550  30.644  17.817  1.00  0.74           C  
ATOM    122  CD2 LEU A  29      12.194  31.166  18.472  1.00  0.74           C  
ATOM    123  N   THR A  30      10.972  28.293  13.992  1.00  0.72           N  
ATOM    124  CA  THR A  30      10.423  28.235  12.641  1.00  0.72           C  
ATOM    125  C   THR A  30       8.920  28.420  12.602  1.00  0.72           C  
ATOM    126  O   THR A  30       8.427  29.250  11.853  1.00  0.72           O  
ATOM    127  CB  THR A  30      10.734  26.919  11.935  1.00  0.72           C  
ATOM    128  OG1 THR A  30      12.131  26.680  11.970  1.00  0.72           O  
ATOM    129  CG2 THR A  30      10.321  26.965  10.457  1.00  0.72           C  
ATOM    130  N   LYS A  31       8.134  27.711  13.435  1.00  0.71           N  
ATOM    131  CA  LYS A  31       6.689  27.914  13.466  1.00  0.71           C  
ATOM    132  C   LYS A  31       6.235  29.275  13.978  1.00  0.71           C  
ATOM    133  O   LYS A  31       5.320  29.856  13.410  1.00  0.71           O  
ATOM    134  CB  LYS A  31       5.969  26.800  14.248  1.00  0.71           C  
ATOM    135  CG  LYS A  31       6.036  25.433  13.550  1.00  0.71           C  
ATOM    136  CD  LYS A  31       5.294  24.382  14.380  1.00  0.71           C  
ATOM    137  CE  LYS A  31       5.509  22.945  13.920  1.00  0.71           C  
ATOM    138  NZ  LYS A  31       4.865  22.055  14.905  1.00  0.71           N  
ATOM    139  N   ILE A  32       6.870  29.825  15.033  1.00  0.73           N  
ATOM    140  CA  ILE A  32       6.616  31.178  15.536  1.00  0.73           C  
ATOM    141  C   ILE A  32       6.964  32.262  14.506  1.00  0.73           C  
ATOM    142  O   ILE A  32       6.271  33.263  14.348  1.00  0.73           O  
ATOM    143  CB  ILE A  32       7.390  31.405  16.843  1.00  0.73           C  
ATOM    144  CG1 ILE A  32       6.937  30.420  17.948  1.00  0.73           C  
ATOM    145  CG2 ILE A  32       7.219  32.857  17.342  1.00  0.73           C  
ATOM    146  CD1 ILE A  32       7.902  30.382  19.141  1.00  0.73           C  
ATOM    147  N   ALA A  33       8.079  32.076  13.774  1.00  0.76           N  
ATOM    148  CA  ALA A  33       8.553  32.932  12.706  1.00  0.76           C  
ATOM    149  C   ALA A  33       7.627  33.025  11.488  1.00  0.76           C  
ATOM    150  O   ALA A  33       7.527  34.043  10.800  1.00  0.76           O  
ATOM    151  CB  ALA A  33       9.933  32.424  12.264  1.00  0.76           C  
ATOM    152  N   GLN A  34       6.944  31.921  11.165  1.00  0.63           N  
ATOM    153  CA  GLN A  34       5.929  31.898  10.137  1.00  0.63           C  
ATOM    154  C   GLN A  34       4.582  32.442  10.612  1.00  0.63           C  
ATOM    155  O   GLN A  34       4.027  32.003  11.611  1.00  0.63           O  
ATOM    156  CB  GLN A  34       5.711  30.447   9.644  1.00  0.63           C  
ATOM    157  CG  GLN A  34       6.956  29.762   9.028  1.00  0.63           C  
ATOM    158  CD  GLN A  34       7.474  30.474   7.782  1.00  0.63           C  
ATOM    159  OE1 GLN A  34       6.795  30.583   6.763  1.00  0.63           O  
ATOM    160  NE2 GLN A  34       8.738  30.957   7.838  1.00  0.63           N  
ATOM    161  N   GLU A  35       3.990  33.381   9.852  1.00  0.44           N  
ATOM    162  CA  GLU A  35       2.616  33.791  10.063  1.00  0.44           C  
ATOM    163  C   GLU A  35       1.815  33.285   8.881  1.00  0.44           C  
ATOM    164  O   GLU A  35       2.313  33.178   7.760  1.00  0.44           O  
ATOM    165  CB  GLU A  35       2.476  35.325  10.144  1.00  0.44           C  
ATOM    166  CG  GLU A  35       1.084  35.874  10.515  1.00  0.44           C  
ATOM    167  CD  GLU A  35       0.557  35.320  11.827  1.00  0.44           C  
ATOM    168  OE1 GLU A  35      -0.150  34.277  11.745  1.00  0.44           O  
ATOM    169  OE2 GLU A  35       0.822  35.926  12.892  1.00  0.44           O  
ATOM    170  N   ILE A  36       0.532  32.949   9.073  1.00  0.16           N  
ATOM    171  CA  ILE A  36      -0.283  32.396   7.998  1.00  0.16           C  
ATOM    172  C   ILE A  36      -0.855  33.471   7.075  1.00  0.16           C  
ATOM    173  O   ILE A  36      -1.382  33.187   6.001  1.00  0.16           O  
ATOM    174  CB  ILE A  36      -1.392  31.512   8.552  1.00  0.16           C  
ATOM    175  CG1 ILE A  36      -2.358  32.303   9.466  1.00  0.16           C  
ATOM    176  CG2 ILE A  36      -0.734  30.321   9.290  1.00  0.16           C  
ATOM    177  CD1 ILE A  36      -3.602  31.509   9.877  1.00  0.16           C  
ATOM    178  N   TYR A  37      -0.731  34.754   7.453  1.00  0.16           N  
ATOM    179  CA  TYR A  37      -1.361  35.870   6.773  1.00  0.16           C  
ATOM    180  C   TYR A  37      -0.467  36.521   5.720  1.00  0.16           C  
ATOM    181  O   TYR A  37      -0.885  37.485   5.086  1.00  0.16           O  
ATOM    182  CB  TYR A  37      -1.762  36.922   7.842  1.00  0.16           C  
ATOM    183  CG  TYR A  37      -2.920  36.437   8.687  1.00  0.16           C  
ATOM    184  CD1 TYR A  37      -4.212  36.391   8.137  1.00  0.16           C  
ATOM    185  CD2 TYR A  37      -2.748  36.037  10.026  1.00  0.16           C  
ATOM    186  CE1 TYR A  37      -5.303  35.942   8.898  1.00  0.16           C  
ATOM    187  CE2 TYR A  37      -3.836  35.579  10.788  1.00  0.16           C  
ATOM    188  CZ  TYR A  37      -5.113  35.533  10.222  1.00  0.16           C  
ATOM    189  OH  TYR A  37      -6.213  35.087  10.984  1.00  0.16           O  
ATOM    190  N   HIS A  38       0.741  35.942   5.492  1.00  0.24           N  
ATOM    191  CA  HIS A  38       1.831  36.375   4.605  1.00  0.24           C  
ATOM    192  C   HIS A  38       2.834  37.272   5.307  1.00  0.24           C  
ATOM    193  O   HIS A  38       3.718  37.859   4.686  1.00  0.24           O  
ATOM    194  CB  HIS A  38       1.401  37.069   3.284  1.00  0.24           C  
ATOM    195  CG  HIS A  38       0.659  36.157   2.356  1.00  0.24           C  
ATOM    196  ND1 HIS A  38       1.390  35.254   1.612  1.00  0.24           N  
ATOM    197  CD2 HIS A  38      -0.670  36.016   2.095  1.00  0.24           C  
ATOM    198  CE1 HIS A  38       0.502  34.582   0.912  1.00  0.24           C  
ATOM    199  NE2 HIS A  38      -0.760  35.000   1.165  1.00  0.24           N  
ATOM    200  N   ASP A  39       2.766  37.349   6.641  1.00  0.32           N  
ATOM    201  CA  ASP A  39       3.613  38.231   7.394  1.00  0.32           C  
ATOM    202  C   ASP A  39       4.819  37.483   7.948  1.00  0.32           C  
ATOM    203  O   ASP A  39       4.734  36.387   8.484  1.00  0.32           O  
ATOM    204  CB  ASP A  39       2.834  38.867   8.543  1.00  0.32           C  
ATOM    205  CG  ASP A  39       1.566  39.538   8.054  1.00  0.32           C  
ATOM    206  OD1 ASP A  39       1.682  40.483   7.234  1.00  0.32           O  
ATOM    207  OD2 ASP A  39       0.469  39.118   8.494  1.00  0.32           O  
ATOM    208  N   VAL A  40       6.029  38.032   7.807  1.00  0.45           N  
ATOM    209  CA  VAL A  40       7.215  37.246   8.117  1.00  0.45           C  
ATOM    210  C   VAL A  40       7.926  37.753   9.379  1.00  0.45           C  
ATOM    211  O   VAL A  40       8.052  38.940   9.603  1.00  0.45           O  
ATOM    212  CB  VAL A  40       8.122  37.204   6.898  1.00  0.45           C  
ATOM    213  CG1 VAL A  40       9.161  36.116   7.105  1.00  0.45           C  
ATOM    214  CG2 VAL A  40       7.344  36.827   5.616  1.00  0.45           C  
ATOM    215  N   VAL A  41       8.379  36.852  10.283  1.00  0.73           N  
ATOM    216  CA  VAL A  41       9.018  37.209  11.562  1.00  0.73           C  
ATOM    217  C   VAL A  41      10.360  36.467  11.702  1.00  0.73           C  
ATOM    218  O   VAL A  41      10.339  35.275  11.540  1.00  0.73           O  
ATOM    219  CB  VAL A  41       8.114  36.745  12.710  1.00  0.73           C  
ATOM    220  CG1 VAL A  41       8.813  36.785  14.071  1.00  0.73           C  
ATOM    221  CG2 VAL A  41       6.822  37.579  12.772  1.00  0.73           C  
ATOM    222  N   GLY A  42      11.548  37.123  12.006  1.00  0.71           N  
ATOM    223  CA  GLY A  42      12.929  36.525  12.124  1.00  0.71           C  
ATOM    224  C   GLY A  42      13.170  35.310  13.014  1.00  0.71           C  
ATOM    225  O   GLY A  42      13.067  35.429  14.195  1.00  0.71           O  
ATOM    226  N   VAL A  43      13.647  34.113  12.502  1.00  0.76           N  
ATOM    227  CA  VAL A  43      14.228  33.125  13.430  1.00  0.76           C  
ATOM    228  C   VAL A  43      15.435  33.727  14.136  1.00  0.76           C  
ATOM    229  O   VAL A  43      15.568  33.696  15.353  1.00  0.76           O  
ATOM    230  CB  VAL A  43      14.676  31.826  12.730  1.00  0.76           C  
ATOM    231  CG1 VAL A  43      15.683  30.969  13.540  1.00  0.76           C  
ATOM    232  CG2 VAL A  43      13.451  30.948  12.431  1.00  0.76           C  
ATOM    233  N   CYS A  44      16.317  34.375  13.347  1.00  0.78           N  
ATOM    234  CA  CYS A  44      17.535  34.948  13.868  1.00  0.78           C  
ATOM    235  C   CYS A  44      17.313  36.301  14.513  1.00  0.78           C  
ATOM    236  O   CYS A  44      17.985  36.631  15.490  1.00  0.78           O  
ATOM    237  CB  CYS A  44      18.617  34.967  12.771  1.00  0.78           C  
ATOM    238  SG  CYS A  44      18.896  33.287  12.122  1.00  0.78           S  
ATOM    239  N   ASP A  45      16.317  37.110  14.075  1.00  0.77           N  
ATOM    240  CA  ASP A  45      15.902  38.275  14.842  1.00  0.77           C  
ATOM    241  C   ASP A  45      15.267  37.924  16.193  1.00  0.77           C  
ATOM    242  O   ASP A  45      15.570  38.580  17.182  1.00  0.77           O  
ATOM    243  CB  ASP A  45      14.953  39.261  14.110  1.00  0.77           C  
ATOM    244  CG  ASP A  45      15.501  39.819  12.811  1.00  0.77           C  
ATOM    245  OD1 ASP A  45      15.270  39.180  11.764  1.00  0.77           O  
ATOM    246  OD2 ASP A  45      16.044  40.966  12.834  1.00  0.77           O  
ATOM    247  N   ILE A  46      14.401  36.879  16.298  1.00  0.77           N  
ATOM    248  CA  ILE A  46      13.889  36.417  17.594  1.00  0.77           C  
ATOM    249  C   ILE A  46      15.036  35.938  18.480  1.00  0.77           C  
ATOM    250  O   ILE A  46      15.125  36.321  19.650  1.00  0.77           O  
ATOM    251  CB  ILE A  46      12.837  35.302  17.464  1.00  0.77           C  
ATOM    252  CG1 ILE A  46      11.532  35.750  16.766  1.00  0.77           C  
ATOM    253  CG2 ILE A  46      12.454  34.727  18.848  1.00  0.77           C  
ATOM    254  CD1 ILE A  46      10.760  34.548  16.189  1.00  0.77           C  
ATOM    255  N   ALA A  47      15.995  35.159  17.936  1.00  0.81           N  
ATOM    256  CA  ALA A  47      17.180  34.735  18.663  1.00  0.81           C  
ATOM    257  C   ALA A  47      18.028  35.898  19.177  1.00  0.81           C  
ATOM    258  O   ALA A  47      18.381  35.956  20.353  1.00  0.81           O  
ATOM    259  CB  ALA A  47      18.037  33.825  17.759  1.00  0.81           C  
ATOM    260  N   ARG A  48      18.303  36.888  18.310  1.00  0.73           N  
ATOM    261  CA  ARG A  48      19.025  38.102  18.635  1.00  0.73           C  
ATOM    262  C   ARG A  48      18.332  39.008  19.645  1.00  0.73           C  
ATOM    263  O   ARG A  48      18.952  39.497  20.584  1.00  0.73           O  
ATOM    264  CB  ARG A  48      19.257  38.877  17.315  1.00  0.73           C  
ATOM    265  CG  ARG A  48      20.057  40.188  17.443  1.00  0.73           C  
ATOM    266  CD  ARG A  48      20.284  40.933  16.113  1.00  0.73           C  
ATOM    267  NE  ARG A  48      18.971  41.104  15.393  1.00  0.73           N  
ATOM    268  CZ  ARG A  48      17.974  41.896  15.806  1.00  0.73           C  
ATOM    269  NH1 ARG A  48      16.819  41.915  15.151  1.00  0.73           N  
ATOM    270  NH2 ARG A  48      18.089  42.705  16.854  1.00  0.73           N  
ATOM    271  N   ALA A  49      17.018  39.261  19.501  1.00  0.83           N  
ATOM    272  CA  ALA A  49      16.282  40.125  20.406  1.00  0.83           C  
ATOM    273  C   ALA A  49      16.118  39.564  21.812  1.00  0.83           C  
ATOM    274  O   ALA A  49      16.075  40.306  22.789  1.00  0.83           O  
ATOM    275  CB  ALA A  49      14.903  40.460  19.808  1.00  0.83           C  
ATOM    276  N   ASN A  50      16.019  38.229  21.942  1.00  0.79           N  
ATOM    277  CA  ASN A  50      15.792  37.584  23.223  1.00  0.79           C  
ATOM    278  C   ASN A  50      17.067  37.003  23.820  1.00  0.79           C  
ATOM    279  O   ASN A  50      17.030  36.391  24.885  1.00  0.79           O  
ATOM    280  CB  ASN A  50      14.760  36.446  23.050  1.00  0.79           C  
ATOM    281  CG  ASN A  50      13.405  37.035  22.690  1.00  0.79           C  
ATOM    282  OD1 ASN A  50      12.639  37.448  23.557  1.00  0.79           O  
ATOM    283  ND2 ASN A  50      13.077  37.064  21.380  1.00  0.79           N  
ATOM    284  N   ASN A  51      18.226  37.192  23.151  1.00  0.75           N  
ATOM    285  CA  ASN A  51      19.533  36.669  23.534  1.00  0.75           C  
ATOM    286  C   ASN A  51      19.582  35.154  23.713  1.00  0.75           C  
ATOM    287  O   ASN A  51      20.082  34.623  24.705  1.00  0.75           O  
ATOM    288  CB  ASN A  51      20.133  37.396  24.767  1.00  0.75           C  
ATOM    289  CG  ASN A  51      20.452  38.839  24.406  1.00  0.75           C  
ATOM    290  OD1 ASN A  51      21.115  39.117  23.408  1.00  0.75           O  
ATOM    291  ND2 ASN A  51      20.011  39.801  25.248  1.00  0.75           N  
ATOM    292  N   LEU A  52      19.069  34.402  22.726  1.00  0.73           N  
ATOM    293  CA  LEU A  52      18.994  32.960  22.833  1.00  0.73           C  
ATOM    294  C   LEU A  52      20.291  32.279  22.457  1.00  0.73           C  
ATOM    295  O   LEU A  52      20.834  32.463  21.373  1.00  0.73           O  
ATOM    296  CB  LEU A  52      17.860  32.359  21.980  1.00  0.73           C  
ATOM    297  CG  LEU A  52      16.494  33.011  22.241  1.00  0.73           C  
ATOM    298  CD1 LEU A  52      15.430  32.337  21.368  1.00  0.73           C  
ATOM    299  CD2 LEU A  52      16.078  32.959  23.719  1.00  0.73           C  
ATOM    300  N   ALA A  53      20.807  31.444  23.380  1.00  0.69           N  
ATOM    301  CA  ALA A  53      22.012  30.661  23.191  1.00  0.69           C  
ATOM    302  C   ALA A  53      21.907  29.613  22.083  1.00  0.69           C  
ATOM    303  O   ALA A  53      22.860  29.361  21.351  1.00  0.69           O  
ATOM    304  CB  ALA A  53      22.405  30.016  24.537  1.00  0.69           C  
ATOM    305  N   ASP A  54      20.726  28.985  21.948  1.00  0.66           N  
ATOM    306  CA  ASP A  54      20.461  27.942  20.984  1.00  0.66           C  
ATOM    307  C   ASP A  54      19.167  28.287  20.233  1.00  0.66           C  
ATOM    308  O   ASP A  54      18.129  28.442  20.882  1.00  0.66           O  
ATOM    309  CB  ASP A  54      20.359  26.607  21.765  1.00  0.66           C  
ATOM    310  CG  ASP A  54      20.125  25.376  20.904  1.00  0.66           C  
ATOM    311  OD1 ASP A  54      19.845  25.520  19.687  1.00  0.66           O  
ATOM    312  OD2 ASP A  54      20.191  24.264  21.483  1.00  0.66           O  
ATOM    313  N   PRO A  55      19.140  28.415  18.900  1.00  0.74           N  
ATOM    314  CA  PRO A  55      17.907  28.602  18.138  1.00  0.74           C  
ATOM    315  C   PRO A  55      16.963  27.416  18.177  1.00  0.74           C  
ATOM    316  O   PRO A  55      15.791  27.577  17.838  1.00  0.74           O  
ATOM    317  CB  PRO A  55      18.385  28.850  16.697  1.00  0.74           C  
ATOM    318  CG  PRO A  55      19.819  29.356  16.851  1.00  0.74           C  
ATOM    319  CD  PRO A  55      20.328  28.578  18.059  1.00  0.74           C  
ATOM    320  N   ASN A  56      17.429  26.210  18.546  1.00  0.71           N  
ATOM    321  CA  ASN A  56      16.570  25.041  18.579  1.00  0.71           C  
ATOM    322  C   ASN A  56      15.874  24.884  19.917  1.00  0.71           C  
ATOM    323  O   ASN A  56      14.953  24.082  20.060  1.00  0.71           O  
ATOM    324  CB  ASN A  56      17.391  23.752  18.343  1.00  0.71           C  
ATOM    325  CG  ASN A  56      17.795  23.654  16.882  1.00  0.71           C  
ATOM    326  OD1 ASN A  56      17.130  24.146  15.972  1.00  0.71           O  
ATOM    327  ND2 ASN A  56      18.907  22.927  16.628  1.00  0.71           N  
ATOM    328  N   ARG A  57      16.276  25.669  20.927  1.00  0.64           N  
ATOM    329  CA  ARG A  57      15.757  25.542  22.265  1.00  0.64           C  
ATOM    330  C   ARG A  57      14.898  26.727  22.635  1.00  0.64           C  
ATOM    331  O   ARG A  57      15.369  27.841  22.858  1.00  0.64           O  
ATOM    332  CB  ARG A  57      16.908  25.421  23.281  1.00  0.64           C  
ATOM    333  CG  ARG A  57      16.420  25.288  24.733  1.00  0.64           C  
ATOM    334  CD  ARG A  57      17.558  25.169  25.731  1.00  0.64           C  
ATOM    335  NE  ARG A  57      16.929  25.375  27.069  1.00  0.64           N  
ATOM    336  CZ  ARG A  57      17.634  25.520  28.193  1.00  0.64           C  
ATOM    337  NH1 ARG A  57      17.002  25.899  29.296  1.00  0.64           N  
ATOM    338  NH2 ARG A  57      18.949  25.298  28.204  1.00  0.64           N  
ATOM    339  N   ILE A  58      13.586  26.474  22.767  1.00  0.74           N  
ATOM    340  CA  ILE A  58      12.653  27.401  23.363  1.00  0.74           C  
ATOM    341  C   ILE A  58      11.819  26.632  24.374  1.00  0.74           C  
ATOM    342  O   ILE A  58      11.229  25.598  24.075  1.00  0.74           O  
ATOM    343  CB  ILE A  58      11.789  28.162  22.358  1.00  0.74           C  
ATOM    344  CG1 ILE A  58      11.038  27.227  21.386  1.00  0.74           C  
ATOM    345  CG2 ILE A  58      12.710  29.141  21.596  1.00  0.74           C  
ATOM    346  CD1 ILE A  58      10.011  27.967  20.529  1.00  0.74           C  
ATOM    347  N   ASP A  59      11.793  27.096  25.637  1.00  0.73           N  
ATOM    348  CA  ASP A  59      11.173  26.347  26.711  1.00  0.73           C  
ATOM    349  C   ASP A  59       9.664  26.679  26.815  1.00  0.73           C  
ATOM    350  O   ASP A  59       9.228  27.811  26.597  1.00  0.73           O  
ATOM    351  CB  ASP A  59      11.978  26.586  28.034  1.00  0.73           C  
ATOM    352  CG  ASP A  59      13.464  26.185  27.949  1.00  0.73           C  
ATOM    353  OD1 ASP A  59      13.842  25.351  27.090  1.00  0.73           O  
ATOM    354  OD2 ASP A  59      14.295  26.709  28.743  1.00  0.73           O  
ATOM    355  N   ALA A  60       8.799  25.674  27.099  1.00  0.75           N  
ATOM    356  CA  ALA A  60       7.356  25.849  27.214  1.00  0.75           C  
ATOM    357  C   ALA A  60       6.943  26.827  28.322  1.00  0.75           C  
ATOM    358  O   ALA A  60       7.396  26.734  29.457  1.00  0.75           O  
ATOM    359  CB  ALA A  60       6.694  24.477  27.462  1.00  0.75           C  
ATOM    360  N   GLY A  61       6.062  27.804  28.008  1.00  0.76           N  
ATOM    361  CA  GLY A  61       5.626  28.840  28.945  1.00  0.76           C  
ATOM    362  C   GLY A  61       6.534  30.038  29.054  1.00  0.76           C  
ATOM    363  O   GLY A  61       6.196  31.021  29.709  1.00  0.76           O  
ATOM    364  N   THR A  62       7.698  30.024  28.388  1.00  0.77           N  
ATOM    365  CA  THR A  62       8.605  31.170  28.313  1.00  0.77           C  
ATOM    366  C   THR A  62       8.039  32.323  27.488  1.00  0.77           C  
ATOM    367  O   THR A  62       7.484  32.064  26.413  1.00  0.77           O  
ATOM    368  CB  THR A  62       9.956  30.759  27.733  1.00  0.77           C  
ATOM    369  OG1 THR A  62      10.615  29.881  28.627  1.00  0.77           O  
ATOM    370  CG2 THR A  62      10.936  31.911  27.491  1.00  0.77           C  
ATOM    371  N   PRO A  63       8.139  33.602  27.894  1.00  0.80           N  
ATOM    372  CA  PRO A  63       7.778  34.714  27.041  1.00  0.80           C  
ATOM    373  C   PRO A  63       8.907  35.063  26.080  1.00  0.80           C  
ATOM    374  O   PRO A  63      10.069  35.120  26.474  1.00  0.80           O  
ATOM    375  CB  PRO A  63       7.520  35.854  28.040  1.00  0.80           C  
ATOM    376  CG  PRO A  63       8.479  35.586  29.206  1.00  0.80           C  
ATOM    377  CD  PRO A  63       8.691  34.066  29.174  1.00  0.80           C  
ATOM    378  N   TYR A  64       8.573  35.324  24.810  1.00  0.79           N  
ATOM    379  CA  TYR A  64       9.509  35.768  23.795  1.00  0.79           C  
ATOM    380  C   TYR A  64       9.068  37.096  23.227  1.00  0.79           C  
ATOM    381  O   TYR A  64       7.901  37.290  22.894  1.00  0.79           O  
ATOM    382  CB  TYR A  64       9.600  34.787  22.596  1.00  0.79           C  
ATOM    383  CG  TYR A  64      10.372  33.579  23.013  1.00  0.79           C  
ATOM    384  CD1 TYR A  64      11.768  33.581  22.887  1.00  0.79           C  
ATOM    385  CD2 TYR A  64       9.738  32.480  23.621  1.00  0.79           C  
ATOM    386  CE1 TYR A  64      12.513  32.530  23.427  1.00  0.79           C  
ATOM    387  CE2 TYR A  64      10.497  31.420  24.138  1.00  0.79           C  
ATOM    388  CZ  TYR A  64      11.888  31.470  24.066  1.00  0.79           C  
ATOM    389  OH  TYR A  64      12.668  30.457  24.643  1.00  0.79           O  
ATOM    390  N   THR A  65      10.005  38.045  23.059  1.00  0.79           N  
ATOM    391  CA  THR A  65       9.781  39.261  22.286  1.00  0.79           C  
ATOM    392  C   THR A  65       9.873  38.945  20.814  1.00  0.79           C  
ATOM    393  O   THR A  65      10.921  38.558  20.302  1.00  0.79           O  
ATOM    394  CB  THR A  65      10.809  40.355  22.544  1.00  0.79           C  
ATOM    395  OG1 THR A  65      10.809  40.717  23.916  1.00  0.79           O  
ATOM    396  CG2 THR A  65      10.498  41.632  21.740  1.00  0.79           C  
ATOM    397  N   ILE A  66       8.764  39.106  20.083  1.00  0.79           N  
ATOM    398  CA  ILE A  66       8.693  38.736  18.686  1.00  0.79           C  
ATOM    399  C   ILE A  66       8.532  39.993  17.832  1.00  0.79           C  
ATOM    400  O   ILE A  66       7.466  40.615  17.897  1.00  0.79           O  
ATOM    401  CB  ILE A  66       7.532  37.781  18.447  1.00  0.79           C  
ATOM    402  CG1 ILE A  66       7.582  36.510  19.334  1.00  0.79           C  
ATOM    403  CG2 ILE A  66       7.543  37.361  16.979  1.00  0.79           C  
ATOM    404  CD1 ILE A  66       8.813  35.614  19.156  1.00  0.79           C  
ATOM    405  N   PRO A  67       9.517  40.456  17.038  1.00  0.78           N  
ATOM    406  CA  PRO A  67       9.277  41.473  16.016  1.00  0.78           C  
ATOM    407  C   PRO A  67       8.266  41.016  14.968  1.00  0.78           C  
ATOM    408  O   PRO A  67       8.544  40.053  14.268  1.00  0.78           O  
ATOM    409  CB  PRO A  67      10.666  41.726  15.382  1.00  0.78           C  
ATOM    410  CG  PRO A  67      11.668  40.837  16.133  1.00  0.78           C  
ATOM    411  CD  PRO A  67      10.803  39.788  16.828  1.00  0.78           C  
ATOM    412  N   ILE A  68       7.127  41.704  14.787  1.00  0.71           N  
ATOM    413  CA  ILE A  68       6.057  41.226  13.909  1.00  0.71           C  
ATOM    414  C   ILE A  68       6.143  41.842  12.506  1.00  0.71           C  
ATOM    415  O   ILE A  68       6.591  42.970  12.340  1.00  0.71           O  
ATOM    416  CB  ILE A  68       4.673  41.484  14.521  1.00  0.71           C  
ATOM    417  CG1 ILE A  68       3.598  40.464  14.068  1.00  0.71           C  
ATOM    418  CG2 ILE A  68       4.250  42.939  14.245  1.00  0.71           C  
ATOM    419  CD1 ILE A  68       2.196  40.688  14.656  1.00  0.71           C  
ATOM    420  N   ASN A  69       5.680  41.123  11.453  1.00  0.67           N  
ATOM    421  CA  ASN A  69       5.467  41.663  10.104  1.00  0.67           C  
ATOM    422  C   ASN A  69       6.691  42.318   9.469  1.00  0.67           C  
ATOM    423  O   ASN A  69       6.631  43.411   8.892  1.00  0.67           O  
ATOM    424  CB  ASN A  69       4.252  42.629  10.034  1.00  0.67           C  
ATOM    425  CG  ASN A  69       2.992  41.978  10.578  1.00  0.67           C  
ATOM    426  OD1 ASN A  69       2.922  40.776  10.842  1.00  0.67           O  
ATOM    427  ND2 ASN A  69       1.951  42.783  10.847  1.00  0.67           N  
ATOM    428  N   CYS A  70       7.843  41.654   9.569  1.00  0.71           N  
ATOM    429  CA  CYS A  70       9.131  42.100   9.092  1.00  0.71           C  
ATOM    430  C   CYS A  70       9.272  42.242   7.592  1.00  0.71           C  
ATOM    431  O   CYS A  70       9.041  41.314   6.822  1.00  0.71           O  
ATOM    432  CB  CYS A  70      10.254  41.153   9.573  1.00  0.71           C  
ATOM    433  SG  CYS A  70      10.386  41.150  11.382  1.00  0.71           S  
ATOM    434  N   GLN A  71       9.756  43.415   7.145  1.00  0.64           N  
ATOM    435  CA  GLN A  71      10.138  43.615   5.761  1.00  0.64           C  
ATOM    436  C   GLN A  71      11.470  42.941   5.423  1.00  0.64           C  
ATOM    437  O   GLN A  71      11.755  42.622   4.272  1.00  0.64           O  
ATOM    438  CB  GLN A  71      10.233  45.133   5.463  1.00  0.64           C  
ATOM    439  CG  GLN A  71       8.933  45.926   5.757  1.00  0.64           C  
ATOM    440  CD  GLN A  71       7.764  45.478   4.876  1.00  0.64           C  
ATOM    441  OE1 GLN A  71       7.835  45.508   3.648  1.00  0.64           O  
ATOM    442  NE2 GLN A  71       6.638  45.072   5.507  1.00  0.64           N  
ATOM    443  N   THR A  72      12.329  42.689   6.434  1.00  0.69           N  
ATOM    444  CA  THR A  72      13.689  42.186   6.235  1.00  0.69           C  
ATOM    445  C   THR A  72      14.012  41.041   7.192  1.00  0.69           C  
ATOM    446  O   THR A  72      14.895  41.108   8.043  1.00  0.69           O  
ATOM    447  CB  THR A  72      14.777  43.271   6.250  1.00  0.69           C  
ATOM    448  OG1 THR A  72      14.798  44.053   7.442  1.00  0.69           O  
ATOM    449  CG2 THR A  72      14.541  44.243   5.077  1.00  0.69           C  
ATOM    450  N   TYR A  73      13.255  39.931   7.055  1.00  0.67           N  
ATOM    451  CA  TYR A  73      13.411  38.660   7.755  1.00  0.67           C  
ATOM    452  C   TYR A  73      14.773  37.950   7.617  1.00  0.67           C  
ATOM    453  O   TYR A  73      15.195  37.602   6.516  1.00  0.67           O  
ATOM    454  CB  TYR A  73      12.310  37.718   7.180  1.00  0.67           C  
ATOM    455  CG  TYR A  73      12.290  36.310   7.691  1.00  0.67           C  
ATOM    456  CD1 TYR A  73      12.046  35.264   6.810  1.00  0.67           C  
ATOM    457  CD2 TYR A  73      12.322  36.044   9.041  1.00  0.67           C  
ATOM    458  CE1 TYR A  73      11.663  34.011   7.283  1.00  0.67           C  
ATOM    459  CE2 TYR A  73      12.184  34.715   9.505  1.00  0.67           C  
ATOM    460  CZ  TYR A  73      11.798  33.692   8.642  1.00  0.67           C  
ATOM    461  OH  TYR A  73      11.567  32.376   9.146  1.00  0.67           O  
ATOM    462  N   ASP A  74      15.430  37.616   8.757  1.00  0.75           N  
ATOM    463  CA  ASP A  74      16.538  36.675   8.775  1.00  0.75           C  
ATOM    464  C   ASP A  74      16.104  35.310   9.330  1.00  0.75           C  
ATOM    465  O   ASP A  74      15.669  35.145  10.474  1.00  0.75           O  
ATOM    466  CB  ASP A  74      17.742  37.249   9.536  1.00  0.75           C  
ATOM    467  CG  ASP A  74      18.962  36.369   9.446  1.00  0.75           C  
ATOM    468  OD1 ASP A  74      19.004  35.316   8.752  1.00  0.75           O  
ATOM    469  OD2 ASP A  74      19.902  36.777  10.154  1.00  0.75           O  
ATOM    470  N   ARG A  75      16.246  34.275   8.482  1.00  0.67           N  
ATOM    471  CA  ARG A  75      16.042  32.882   8.833  1.00  0.67           C  
ATOM    472  C   ARG A  75      17.287  32.046   8.577  1.00  0.67           C  
ATOM    473  O   ARG A  75      17.210  30.825   8.663  1.00  0.67           O  
ATOM    474  CB  ARG A  75      14.911  32.227   7.997  1.00  0.67           C  
ATOM    475  CG  ARG A  75      15.181  32.200   6.480  1.00  0.67           C  
ATOM    476  CD  ARG A  75      13.997  31.667   5.678  1.00  0.67           C  
ATOM    477  NE  ARG A  75      14.355  31.638   4.192  1.00  0.67           N  
ATOM    478  CZ  ARG A  75      14.862  30.579   3.531  1.00  0.67           C  
ATOM    479  NH1 ARG A  75      14.975  30.622   2.198  1.00  0.67           N  
ATOM    480  NH2 ARG A  75      15.231  29.463   4.149  1.00  0.67           N  
ATOM    481  N   ASN A  76      18.436  32.660   8.208  1.00  0.68           N  
ATOM    482  CA  ASN A  76      19.550  31.919   7.617  1.00  0.68           C  
ATOM    483  C   ASN A  76      20.906  32.204   8.253  1.00  0.68           C  
ATOM    484  O   ASN A  76      21.850  31.452   8.049  1.00  0.68           O  
ATOM    485  CB  ASN A  76      19.735  32.275   6.109  1.00  0.68           C  
ATOM    486  CG  ASN A  76      18.497  31.978   5.272  1.00  0.68           C  
ATOM    487  OD1 ASN A  76      18.042  30.850   5.079  1.00  0.68           O  
ATOM    488  ND2 ASN A  76      17.905  33.054   4.698  1.00  0.68           N  
ATOM    489  N   SER A  77      21.091  33.303   9.008  1.00  0.77           N  
ATOM    490  CA  SER A  77      22.418  33.602   9.552  1.00  0.77           C  
ATOM    491  C   SER A  77      22.825  32.758  10.761  1.00  0.77           C  
ATOM    492  O   SER A  77      24.010  32.563  11.025  1.00  0.77           O  
ATOM    493  CB  SER A  77      22.561  35.104   9.887  1.00  0.77           C  
ATOM    494  OG  SER A  77      21.809  35.452  11.047  1.00  0.77           O  
ATOM    495  N   CYS A  78      21.848  32.234  11.529  1.00  0.74           N  
ATOM    496  CA  CYS A  78      22.080  31.602  12.814  1.00  0.74           C  
ATOM    497  C   CYS A  78      21.695  30.134  12.885  1.00  0.74           C  
ATOM    498  O   CYS A  78      21.759  29.542  13.961  1.00  0.74           O  
ATOM    499  CB  CYS A  78      21.257  32.354  13.903  1.00  0.74           C  
ATOM    500  SG  CYS A  78      19.433  32.203  13.763  1.00  0.74           S  
ATOM    501  N   LEU A  79      21.278  29.524  11.766  1.00  0.68           N  
ATOM    502  CA  LEU A  79      20.765  28.171  11.733  1.00  0.68           C  
ATOM    503  C   LEU A  79      21.287  27.480  10.449  1.00  0.68           C  
ATOM    504  O   LEU A  79      21.718  28.210   9.516  1.00  0.68           O  
ATOM    505  CB  LEU A  79      19.209  28.172  11.732  1.00  0.68           C  
ATOM    506  CG  LEU A  79      18.528  26.786  11.839  1.00  0.68           C  
ATOM    507  CD1 LEU A  79      18.904  26.047  13.131  1.00  0.68           C  
ATOM    508  CD2 LEU A  79      17.000  26.911  11.751  1.00  0.68           C  
ATOM    509  OXT LEU A  79      21.265  26.220  10.391  1.00  0.68           O  
TER     510      LEU A  79                                                      
END