report.json 2.36 KB
Newer Older
1
{"modelling":{"comment":"e_value=5.39014e-12, bit_score=59.6918, score=143","short_method":"X-ray","pred_lddt":0.6409999728,"trg_seq":"ARNPITITPQFDCGATNSQQYVARSGDTLTKIAQEIYHDVVGVCDIARANNLADPNRIDAGTPYTIPINCQTYDRNSCL","ProMod":null,"id":"1f7ee0185c027f840714313bee002b90c1645193","QMean":{"local_scores":{"A":[null,null,null,null,null,null,null,null,null,null,null,null,0.7595292171,0.7709733199,0.7679715335,0.6820321387,0.6794604594,0.7352636235,0.7226174383,0.7494432568,0.7677644492,0.7858676785,0.7878309719,0.6730515146,0.7086870985,0.7589610189,0.7607696096,0.7466237069,0.7449181176,0.7246933642,0.7050858737,0.7261962419,0.7584532412,0.6333229049,0.43971576,0.1634149258,0.1554763455,0.2373588915,0.318227385,0.4479396439,0.7316497638,0.7062396185,0.7575763978,0.7841259311,0.7706970752,0.7719843127,0.8095682517,0.729691249,0.8273358234,0.7909998149,0.7513066077,0.7295026071,0.6877599727,0.6585904841,0.7421009272,0.7107673751,0.6399285621,0.7359773907,0.7313914551,0.7494003413,0.76231139,0.7656656656,0.8042642126,0.7876690829,0.7929124565,0.7871559264,0.7826168183,0.7099086222,0.6682278917,0.7148507187,0.6419257498,0.6889439201,0.6746461196,0.7482797818,0.674896879,0.6848403448,0.7668447042,0.7403137208,0.6808314423]},"global_scores":{"interaction_norm_score":-0.0142020561,"qmean6_z_score":-1.469761816,"torsion_z_score":-0.7130880371,"torsion_norm_score":-0.1998463023,"ss_agreement_z_score":-0.7636034172,"acc_agreement_norm_score":0.5373134328,"cbeta_norm_score":-0.0138066274,"packing_z_score":-0.675742068,"packing_norm_score":-0.3204136162,"qmean4_z_score":-1.1247422437,"interaction_z_score":-1.1237743381,"ss_agreement_norm_score":0.4854423844,"avg_local_score":0.695602226,"cbeta_z_score":-0.4576629659,"qmean6_norm_score":0.6861979829,"qmean4_norm_score":0.7195471638,"acc_agreement_z_score":-1.676258949,"avg_local_score_error":0.108}},"chain":"A","assembly_id":1,"seq_id":43.4782600403,"SPDBV":null,"pdb_id":"4b8v","score":1.4957641363,"MODELLER":null,"method":"X-RAY DIFFRACTION","description":"EXTRACELLULAR PROTEIN 6","seq_sim":0.4202957451,"tpl_seq":"-------TKATDCGSTSNIKYTVVKGDTLTSIAKKFKS---GICNIVSVNKLANPNLIELGATLIIPENCSNPDNKSCV","oligo_state":"monomer","coverage":0.8734177351,"offset":30,"found_by":"BLAST","endtime":"12-10-19 (11:13:03)","mod_engine":["ProMod3"],"title":"Modelling","ProMod3":{"version":"2.0.0"},"starttime":"12-10-19 (11:12:56)","resolution":1.5900000334}}