Skip to content
Snippets Groups Projects
Commit a12356ba authored by Gabriel Studer's avatar Gabriel Studer
Browse files

necessary file for unit tests of blast binding

parent 6ab2b389
No related branches found
No related tags found
No related merge requests found
<?xml version="1.0"?>
<!DOCTYPE BlastOutput PUBLIC "-//NCBI//NCBI BlastOutput/EN" "http://www.ncbi.nlm.nih.gov/dtd/NCBI_BlastOutput.dtd">
<BlastOutput>
<BlastOutput_program>blastp</BlastOutput_program>
<BlastOutput_version>blastp 2.2.16 [Mar-25-2007]</BlastOutput_version>
<BlastOutput_reference>~Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, ~Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), ~&quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search~programs&quot;, Nucleic Acids Res. 25:3389-3402.</BlastOutput_reference>
<BlastOutput_db>seqdb</BlastOutput_db>
<BlastOutput_query-ID>lcl|1_0</BlastOutput_query-ID>
<BlastOutput_query-def>A</BlastOutput_query-def>
<BlastOutput_query-len>101</BlastOutput_query-len>
<BlastOutput_param>
<Parameters>
<Parameters_matrix>BLOSUM62</Parameters_matrix>
<Parameters_expect>10</Parameters_expect>
<Parameters_gap-open>11</Parameters_gap-open>
<Parameters_gap-extend>1</Parameters_gap-extend>
<Parameters_filter>F</Parameters_filter>
</Parameters>
</BlastOutput_param>
<BlastOutput_iterations>
<Iteration>
<Iteration_iter-num>1</Iteration_iter-num>
<Iteration_query-ID>lcl|1_0</Iteration_query-ID>
<Iteration_query-def>A</Iteration_query-def>
<Iteration_query-len>101</Iteration_query-len>
<Iteration_hits>
<Hit>
<Hit_num>1</Hit_num>
<Hit_id>gnl|BL_ORD_ID|1</Hit_id>
<Hit_def>1griA</Hit_def>
<Hit_accession>1</Hit_accession>
<Hit_len>211</Hit_len>
<Hit_hsps>
<Hsp>
<Hsp_num>1</Hsp_num>
<Hsp_bit-score>210.305</Hsp_bit-score>
<Hsp_score>534</Hsp_score>
<Hsp_evalue>4.80893e-59</Hsp_evalue>
<Hsp_query-from>1</Hsp_query-from>
<Hsp_query-to>101</Hsp_query-to>
<Hsp_hit-from>49</Hsp_hit-from>
<Hsp_hit-to>149</Hsp_hit-to>
<Hsp_query-frame>1</Hsp_query-frame>
<Hsp_hit-frame>1</Hsp_hit-frame>
<Hsp_identity>101</Hsp_identity>
<Hsp_positive>101</Hsp_positive>
<Hsp_align-len>101</Hsp_align-len>
<Hsp_qseq>MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVP</Hsp_qseq>
<Hsp_hseq>MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVP</Hsp_hseq>
<Hsp_midline>MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVP</Hsp_midline>
</Hsp>
</Hit_hsps>
</Hit>
<Hit>
<Hit_num>2</Hit_num>
<Hit_id>gnl|BL_ORD_ID|0</Hit_id>
<Hit_def>1fhsA</Hit_def>
<Hit_accession>0</Hit_accession>
<Hit_len>112</Hit_len>
<Hit_hsps>
<Hsp>
<Hsp_num>1</Hsp_num>
<Hsp_bit-score>210.305</Hsp_bit-score>
<Hsp_score>534</Hsp_score>
<Hsp_evalue>4.80893e-59</Hsp_evalue>
<Hsp_query-from>1</Hsp_query-from>
<Hsp_query-to>101</Hsp_query-to>
<Hsp_hit-from>4</Hsp_hit-from>
<Hsp_hit-to>104</Hsp_hit-to>
<Hsp_query-frame>1</Hsp_query-frame>
<Hsp_hit-frame>1</Hsp_hit-frame>
<Hsp_identity>101</Hsp_identity>
<Hsp_positive>101</Hsp_positive>
<Hsp_align-len>101</Hsp_align-len>
<Hsp_qseq>MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVP</Hsp_qseq>
<Hsp_hseq>MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVP</Hsp_hseq>
<Hsp_midline>MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVP</Hsp_midline>
</Hsp>
</Hit_hsps>
</Hit>
<Hit>
<Hit_num>3</Hit_num>
<Hit_id>gnl|BL_ORD_ID|2</Hit_id>
<Hit_def>3n84E</Hit_def>
<Hit_accession>2</Hit_accession>
<Hit_len>102</Hit_len>
<Hit_hsps>
<Hsp>
<Hsp_num>1</Hsp_num>
<Hsp_bit-score>206.068</Hsp_bit-score>
<Hsp_score>523</Hsp_score>
<Hsp_evalue>9.06925e-58</Hsp_evalue>
<Hsp_query-from>1</Hsp_query-from>
<Hsp_query-to>99</Hsp_query-to>
<Hsp_hit-from>4</Hsp_hit-from>
<Hsp_hit-to>102</Hsp_hit-to>
<Hsp_query-frame>1</Hsp_query-frame>
<Hsp_hit-frame>1</Hsp_hit-frame>
<Hsp_identity>99</Hsp_identity>
<Hsp_positive>99</Hsp_positive>
<Hsp_align-len>99</Hsp_align-len>
<Hsp_qseq>MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQ</Hsp_qseq>
<Hsp_hseq>MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQ</Hsp_hseq>
<Hsp_midline>MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQ</Hsp_midline>
</Hsp>
</Hit_hsps>
</Hit>
<Hit>
<Hit_num>4</Hit_num>
<Hit_id>gnl|BL_ORD_ID|5</Hit_id>
<Hit_def>1mw9X</Hit_def>
<Hit_accession>5</Hit_accession>
<Hit_len>556</Hit_len>
<Hit_hsps>
<Hsp>
<Hsp_num>1</Hsp_num>
<Hsp_bit-score>15.0086</Hsp_bit-score>
<Hsp_score>27</Hsp_score>
<Hsp_evalue>2.96523</Hsp_evalue>
<Hsp_query-from>31</Hsp_query-from>
<Hsp_query-to>43</Hsp_query-to>
<Hsp_hit-from>123</Hsp_hit-from>
<Hsp_hit-to>135</Hsp_hit-to>
<Hsp_query-frame>1</Hsp_query-frame>
<Hsp_hit-frame>1</Hsp_hit-frame>
<Hsp_identity>4</Hsp_identity>
<Hsp_positive>10</Hsp_positive>
<Hsp_align-len>13</Hsp_align-len>
<Hsp_qseq>IRESESAPGDFSL</Hsp_qseq>
<Hsp_hseq>IRQAFNKPGELNI</Hsp_hseq>
<Hsp_midline>IR++ + PG+ ++</Hsp_midline>
</Hsp>
<Hsp>
<Hsp_num>2</Hsp_num>
<Hsp_bit-score>13.853</Hsp_bit-score>
<Hsp_score>24</Hsp_score>
<Hsp_evalue>6.60584</Hsp_evalue>
<Hsp_query-from>9</Hsp_query-from>
<Hsp_query-to>33</Hsp_query-to>
<Hsp_hit-from>170</Hsp_hit-from>
<Hsp_hit-to>194</Hsp_hit-to>
<Hsp_query-frame>1</Hsp_query-frame>
<Hsp_hit-frame>1</Hsp_hit-frame>
<Hsp_identity>5</Hsp_identity>
<Hsp_positive>12</Hsp_positive>
<Hsp_align-len>25</Hsp_align-len>
<Hsp_qseq>GKIPRAKAEEMLSKQRHDGAFLIRE</Hsp_qseq>
<Hsp_hseq>GRVQSVAVRLVVEREREIKAFVPEE</Hsp_hseq>
<Hsp_midline>G++ ++ ++R AF+ E</Hsp_midline>
</Hsp>
</Hit_hsps>
</Hit>
</Iteration_hits>
<Iteration_stat>
<Statistics>
<Statistics_db-num>6</Statistics_db-num>
<Statistics_db-len>1507</Statistics_db-len>
<Statistics_hsp-len>28</Statistics_hsp-len>
<Statistics_eff-space>97747</Statistics_eff-space>
<Statistics_kappa>0.041</Statistics_kappa>
<Statistics_lambda>0.267</Statistics_lambda>
<Statistics_entropy>0.14</Statistics_entropy>
</Statistics>
</Iteration_stat>
</Iteration>
</BlastOutput_iterations>
</BlastOutput>
0% Loading or .
You are about to add 0 people to the discussion. Proceed with caution.
Please register or to comment